Therapy for Modulating Immune Response with Recombinant MVA Encoding IL-12
20250049903 · 2025-02-13
Assignee
Inventors
- Cigdem Atay Langbein (Munich, DE)
- André Riedl (Schweitenkirchen, DE)
- Markus Kalla (Penzberg, DE)
- Maria Hinterberger (Sauerlach, DE)
- José Medina Echeverz (Munich, DE)
- Pedro Berraondo López (Pamplona, ES)
Cpc classification
C12N2710/24141
CHEMISTRY; METALLURGY
C12N15/86
CHEMISTRY; METALLURGY
A61K2039/545
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
International classification
A61K39/00
HUMAN NECESSITIES
C12N15/86
CHEMISTRY; METALLURGY
Abstract
The invention relates to a composition and related methods for enhancing the immune response and/or decreasing the size or growth rate of a tumor volume in a subject. The composition comprises a recombinant MVA encoding IL-12 and, optionally, a Tumor Associated Antigen (TAA). In some embodiments, the MVA also encodes 4-1BBL and/or a second MVA encoding 4-1BBL is coadministered to the subject. In some embodiments of the invention, methods comprise injecting these MVAs intratumorally. In some embodiments, the recombinant MVAs are injected intraperitoneally to stimulate an immune response to peritoneal tumors.
Claims
1-6. (canceled)
7. A method for increasing an inflammatory response in a subject having a tumor, the method comprising intratumorally administering to the subject a recombinant modified Vaccinia virus Ankara (MVA) comprising a first nucleic acid encoding a tumor-associated antigen (TAA) and a second nucleic acid encoding IL-12, wherein the intratumoral administration of the recombinant MVA increases an inflammatory response in the tumor as compared to injection of MVA alone.
8. The method of claim 7, wherein the TAA is selected from the group consisting of carcinoembryonic antigen (CEA), mucin 1 cell surface associated (MUC-1), prostatic acid phosphatase (PAP), prostate specific antigen (PSA), human epidermal growth factor receptor 2 (HER-2), survivin, tyrosine related protein 1 (TRP1), tyrosine related protein 1 (TRP2), Brachyury, PRAME, FOLR1, HERV-K-env, HERV-K-gag, and combinations thereof.
9. The method of claim 7, wherein said recombinant MVA further comprises a third nucleic acid encoding 4-1BBL.
10. The method of claim 7, wherein the subject is human.
11-14. (canceled)
15. A method of inducing an increased inflammatory response in a peritoneal tumor of a subject, the method comprising intraperitoneally administering to the subject a recombinant modified Vaccinia Ankara (MVA) comprising a first nucleic acid encoding IL-12, wherein the intraperitoneal administration of the recombinant MVA generates an increased inflammatory response in the tumor as compared to an inflammatory response that would be generated by injection of MVA alone.
16. The method of claim 15, wherein said recombinant MVA further comprises a second nucleic acid encoding a tumor-associated antigen (TAA).
17. The method of claim 15, wherein said recombinant MVA further comprises a third nucleic acid encoding 4-1BBL.
18. A recombinant modified Vaccinia Ankara (MVA), comprising: (a) a first nucleic acid encoding IL-12; and (b) a second nucleic acid encoding a tumor-associated antigen (TAA); wherein the intratumoral administration of the recombinant MVA increases an inflammatory response in a tumor, reduces the growth rate and/or size of the tumor, and/or increases overall survival of the subject as compared to a non-intratumoral injection of said recombinant MVA or an injection of a recombinant MVA that does not comprise a nucleic acid encoding IL-12.
19. The recombinant MVA of claim 18, further comprising (c) a third nucleic acid encoding 4-1BBL.
20. The recombinant MVA of claim 18, wherein said TAA is an endogenous retroviral (ERV) protein.
21. The recombinant MVA of claim 18, wherein said TAA is selected from the group consisting of carcinoembryonic antigen (CEA), mucin 1 cell surface associated (MUC-1), prostatic acid phosphatase (PAP), prostate specific antigen (PSA), human epidermal growth factor receptor 2 (HER-2), survivin, tyrosine related protein 1 (TRP1), tyrosine related protein 1 (TRP2), Brachyury, FOLR1, PRAME, HERV-K-env, HERV-K-gag, p15, and combinations thereof.
22. A pharmaceutical combination comprising the recombinant MVA of claim 18 and a pharmaceutically acceptable carrier.
23. A pharmaceutical combination comprising the recombinant MVA of claim 18 and a second recombinant MVA comprising: (a) a first nucleic acid encoding a tumor-associated antigen (TAA); and (b) a second nucleic acid encoding 4-1BBL, wherein said TAA can be the same TAA as recited in claim 18 or can be a different TAA.
24. The pharmaceutical combination of claim 23 wherein said second recombinant MVA comprises a first nucleic acid encoding a TAA that is a different TAA than the one encoded by the recombinant MVA of claim 18.
25. The method of claim 7, wherein the subject has a plurality of tumors and said recombinant MVA is intratumorally administered to fewer than all of the tumors in said subject.
26. The method of claim 7, wherein the subject has at least one inaccessible tumor and at least one accessible tumor, the method further comprising intratumorally administering to at least one accessible tumor in the subject a recombinant MVA comprising at least one first nucleic acid encoding a TAA and a second nucleic acid encoding 4-1-BBL, whereby the growth of the inaccessible tumor is decreased or stopped.
27. The method of claim 15, whereby the growth of at least one tumor in the subject is decreased or stopped.
28. The method of claim 15, further comprising intraperitoneally administering to the subject a boosting dose of the same recombinant MVA.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039] It is to be understood that both the foregoing Summary and the following Detailed Description are exemplary and explanatory only and are not restrictive of the invention, as claimed.
DETAILED DESCRIPTION OF THE INVENTION
[0040] The recombinant MVAs and methods of the present invention increase and enhance multiple aspects of a subject's immune response to one or more tumors. In various aspects, the present invention demonstrates that when a recombinant MVA comprising a nucleic acid encoding at least one tumor-associated antigen (TAA) and a nucleic acid encoding IL-12 is administered intratumorally to a subject, there is an increased anti-tumor effect realized in the subject. As described in more detail herein, this anti-tumor effect includes, for example, a decrease in tumor size/volume, a decrease in tumor growth rate, increased overall survival rate, an enhanced CD8+ T cell response to the TAA, and enhanced inflammatory responses such as increased cytokine production in the tumor and even in some embodiments systemically in the subject, as compared to an administration of a recombinant MVA by itself.
[0041] In further embodiments of the invention, a recombinant MVA encoding 4-1BB Ligand (also referred to herein as 41BBL, 4-1BBL, or CD137L) when administered in combination with a recombinant MVA encoding IL-12 (wherein at least one of the recombinant MVAs also encodes a TAA) further increases the effectiveness of and/or enhances the immune response and therefore the treatment of a subject having tumors.
[0042] Recombinant modified vaccinia Ankara (MVA) virus as used herein (also recombinant MVA or rMVA) refers to an MVA comprising at least one polynucleotide encoding a heterologous gene, such as, for example, a tumor associated antigen (TAA). By in combination is intended that one or more treatments is present at the same time in a subject. For example, a combination comprising recombinant MVA encoding IL-12 and a recombinant MVA encoding 4-1BBL are present in the subject at the same time, even though they may be administered to the subject at different times and/or by different routes of administration. Thus, recombinant MVAs in a combination treatment may be administered together or may be administered to the subject at separate times, so long as both are present together in the subject for a period of time (such as, for example, at least several hours, at least 12 hours, at least 24 hours, or at least 2 or more days). In some embodiments, the IL-12 and 4-1BBL are encoded by the same recombinant MVA; that is, in some embodiments, a recombinant MVA of the invention comprises a nucleic acid encoding a TAA, a nucleic acid encoding IL-12, and a nucleic acid encoding 4-1BBL.
[0043] Thus, in some methods of the invention, a recombinant MVA encoding IL-12 and optionally a TAA is injected intratumorally or intravenously into a subject having tumors. In some methods of the invention, a recombinant MVA encoding 4-1BBL and optionally a TAA is injected intratumorally or intravenously into a subject in combination with a recombinant MVA encoding IL-12 and optionally the same TAA or a different TAA. In embodiments where IL-12 and 4-1BBL are encoded by separate recombinant MVAs, at least one of the recombinant MVAs encodes at least one TAA, and in some embodiments both recombinant MVAs encode a TAA. In some embodiments, a recombinant MVA encoding a TAA, IL-12, and 4-1BBL is injected into a subject to provide the combination of MVA-encoded IL-12 and 4-1BBL. That is, in some embodiments, the IL-12, 4-1BBL, and TAA are all encoded by the same recombinant MVA, which can be administered to a subject to stimulate an immune response. In some embodiments, the recombinant MVA encoding a TAA, 4-1BBL, and IL-12 is injected intratumorally at least once, or at least two times or at least three times. In such embodiments when the recombinant MVA encoding a TAA, 4-1BBL, and IL-12 is injected intratumorally more than once, the injections can occur within several days of each other or within several weeks of each other, for example, at least three days apart or at least four days or a week apart, or within a month of each other or within two months of each other.
[0044] The invention also provides recombinant MVAs for preparing a medicament for intratumoral or intravenous injection for the treatment of tumors and/or to increase an immune response in a subject to a tumor. In some embodiments, this medicament comprises a recombinant MVA encoding a TAA and IL-12; in some embodiments, the medicament further comprises a recombinant MVA encoding 4-1BBL and optionally the same TAA or a different TAA. In some embodiments, the medicament comprises a recombinant MVA encoding at least one TAA, IL-12, and 4-1BBL; in these embodiments, the nucleic acids encoding each of the TAA, IL-12, and 4-1BBL may be adjacent to each other in the recombinant MVA or may be separated by nucleic acids encoding one or more other genes, or may be inserted into different locations in the recombinant MVA.
[0045] The instant inventors demonstrate in the working examples provided herein that a recombinant MVA encoding a tumor-associated antigen (TAA) and IL-12 administered intratumorally increases and enhances the immune response of a subject to the antigen. In this manner, the invention provides improved treatment of a subject having at least one tumor, including for example a human cancer patient. More particularly, the inventors demonstrated that various recombinant MVAs and combinations thereof of the present invention caused increased inflammation in the tumor when injected intratumorally. The indicia of systemic inflammation that were observed included increased serum IL-12 p70, M-CSF, and IL-33, increased antigen-specific CD8+ T cells, increased percentages of CD8+ T cells expressing IFN-gamma and TNF-alpha, decrease in tumor size and/or growth rate, improved survival, and the like.
[0046] In addition, data presented in the working examples herein showed that subjects cured of tumors following treatment with recombinant MVA encoding IL-12 or the combination of recombinant MVA encoding IL-12 and recombinant MVA encoding 4-1BBL were more likely to reject tumors when subsequently challenged with newly implanted tumors. In this manner, the invention provides compositions and methods of treatment that reduce the likelihood of recurrence of tumors.
[0047] In other embodiments, the inventors demonstrated that intraperitoneal injection of recombinant MVA encoding IL-12 enhanced anti-tumor efficacy of the treatment against intraperitoneal tumors in comparison to intravenous administration of the recombinant MVA. In this manner, the invention provides methods of treating a subject having intraperitoneal tumors comprising intraperitoneal injection of recombinant MVA encoding IL-12. In this manner, the invention also provides a medicament for intraperitoneal injection to treat an intraperitoneal tumor comprising a recombinant MVA encoding IL-12. In some embodiments, this recombinant MVA also encodes a TAA.
[0048] Accordingly, in one embodiment, the present invention includes a method for enhancing the immune response, reducing tumor size, and/or increasing survival in a subject having a cancerous tumor, the method comprising intratumorally administering to the subject a recombinant modified Vaccinia Ankara (MVA) comprising a first nucleic acid encoding a tumor-associated antigen (TAA) and a second nucleic acid encoding IL-12, wherein the intratumoral administration of the recombinant MVA increases and/or enhances an inflammatory response in the tumor, decreases the size of the tumor, and/or decreases the growth rate of the tumor, and/or increases overall survival of the subject as compared to the result expected from injection of MVA alone. In some embodiments, this method further comprises intratumorally administering to the subject a recombinant MVA comprising a nucleic acid encoding 4-1BBL and optionally also comprising a nucleic acid encoding a TAA that is the same or different from the TAA encoded by another recombinant MVA administered to said subject. In embodiments utilizing more than one recombinant MVA in combination, the TAA may be encoded by either the recombinant MVA that also encodes IL-12 or the recombinant MVA that also encodes 4-1BBL.
[0049] In some embodiments, the present invention includes a method for increasing and/or enhancing the immune response, reducing tumor size, and/or increasing survival in a subject having a tumor, the method comprising intratumorally administering to the subject a recombinant modified Vaccinia Ankara (MVA) comprising a first nucleic acid encoding a tumor-associated antigen (TAA) and a second nucleic acid encoding IL-12, wherein the intratumoral administration of the recombinant MVA increases and/or enhances an inflammatory response in the tumor, decreases the size of the tumor, decreases the growth rate of the tumor, and/or increases overall survival of the subject as compared to a non-intratumoral injection of a recombinant MVA virus comprising a first and second nucleic acid encoding a TAA and IL-12, or as compared to an intratumoral or non-intratumoral injection of MVA alone.
[0050] In an additional embodiment, the present invention includes a method for enhancing the immune response, reducing tumor size, and/or increasing survival in a subject having a cancerous tumor, the method comprising intratumorally and/or intravenously administering to the subject a recombinant modified Vaccinia Ankara (MVA) comprising a first nucleic acid encoding a tumor-associated antigen (TAA), a second nucleic acid encoding IL-12, and a third nucleic acid encoding 4-1BBL (CD137L) wherein the administration of the recombinant MVA enhances an inflammatory response in the cancerous tumor, increases tumor reduction, and/or increases overall survival of the subject as compared to an injection of MVA alone or injection of a recombinant MVA comprising a first and second nucleic acid encoding a TAA, IL-12, and a 4-1BBL antigen administered by a different route of injection (i.e., non-intratumoral or non-intravenous injection).
[0051] In an additional embodiment, the present invention includes a method for enhancing the immune response, reducing tumor size, and/or increasing survival in a subject having at least one peritoneal tumor, the method comprising intraperitoneally administering to the subject a recombinant modified Vaccinia Ankara (MVA) comprising a first nucleic acid encoding a tumor-associated antigen (TAA) and a second nucleic acid encoding IL-12, wherein the intraperitoneal administration of the recombinant MVA enhances T-cell responses specific to the TAA as compared to injection of MVA alone or to a non-intraperitoneal injection of a recombinant MVA comprising a nucleic acid encoding a TAA and a nucleic acid encoding IL-12. In another embodiment, the present invention includes a method for enhancing the immune response, reducing tumor size, and/or increasing survival in a subject having a cancerous tumor, the method comprising intraperitoneally administering to the subject a recombinant modified Vaccinia Ankara (MVA) comprising a nucleic acid encoding IL-12, wherein the intraperitoneal administration of the recombinant MVA increases and/or enhances an inflammatory response in the tumor, decreases the size of the tumor, and/or decreases the growth rate of the tumor, and/or increases overall survival of the subject as compared to the result expected from injection of MVA alone.
[0052] In some embodiments, the invention includes a method for enhancing the immune response, reducing tumor size, and/or increasing survival in a subject having a tumor, the method comprising intratumorally administering to the subject a recombinant modified Vaccinia Ankara (MVA) comprising a first nucleic acid encoding a tumor-associated antigen (TAA) and a second nucleic acid encoding IL-12 and a second recombinant MVA comprising a nucleic acid encoding 4-1BBL, wherein the administration of the recombinant MVAs enhances T cell responses specific to the TAA as compared to intratumoral injection of MVA alone or as compared to a non-intratumoral injection of a recombinant MVA virus comprising a first and second nucleic acid encoding a TAA and IL-12. In some embodiments, the TAA is encoded by a second recombinant MVA that also encodes 4-1BBL rather than by the recombinant MVA that encodes IL-12.
[0053] In some embodiments, the invention includes a method for reducing tumor size, and/or increasing survival in a subject having more than one tumor, the method comprising intratumorally administering to a particular tumor in the subject a recombinant modified Vaccinia Ankara (MVA) comprising a first nucleic acid encoding a tumor-associated antigen (TAA), a second nucleic acid encoding IL-12, and a third nucleic acid encoding 4-1BBL, whereby the administration of the recombinant MVA to said tumor decreases the growth rate and/or size of another tumor in the subject that was not injected intratumorally with said recombinant MVA(s). In this manner, the invention provides a method of stimulating an immune response against a tumor and/or decreasing the size or growth rate of a tumor comprising intratumoral injection of a different tumor. In some embodiments of this method, the subject is injected intratumorally with the recombinant MVA more than one time, or at least two times or at least three times. In such embodiments, if the subject is injected with the recombinant MVA more than one time, a second or third injection can be administered within four days or a week of the first injection, or may be administered at least a week or at least 2 or 3 weeks or at least a month after the first injection.
[0054] In yet another embodiment, the present invention includes a method of inducing an enhanced inflammatory response in a cancerous tumor of a subject and/or systemically in the subject, the method comprising intratumorally administering to the subject a recombinant modified Vaccinia Ankara (MVA) comprising a first nucleic acid encoding a first heterologous tumor-associated antigen (TAA) and a second nucleic acid encoding IL-12, wherein the intratumoral administration of the recombinant MVA generates an enhanced inflammatory response in the tumor as compared to an inflammatory response generated by or expected to be generated by injection with MVA alone or by a non-intratumoral injection of a recombinant MVA virus comprising a first and second nucleic acid encoding a heterologous tumor-associated antigen and IL-12.
[0055] In yet another embodiment, the present invention includes a method of inducing an enhanced inflammatory response in a cancerous tumor of a subject, the method comprising intratumorally administering to the subject a recombinant modified Vaccinia Ankara (MVA) encoding IL-12 and a second recombinant MVA encoding 4-1BBL, wherein either or both of said recombinant MVAs further encodes a heterologous TAA, wherein the intratumoral administration of the recombinant MVA generates an enhanced inflammatory response in the tumor as compared to an inflammatory response generated by an injection of MVA alone (i.e., an MVA not encoding heterologous antigens or genes) or a non-intratumoral injection of a recombinant MVA virus comprising a first and second nucleic acid encoding a heterologous tumor-associated antigen and IL-12.
[0056] In yet another embodiment, the present invention includes a method of inducing an increased and/or enhanced inflammatory response in a cancerous tumor of a subject, the method comprising intratumorally administering to the subject a recombinant modified Vaccinia Ankara (MVA) comprising a first nucleic acid encoding a first heterologous tumor-associated antigen (TAA), a second nucleic acid encoding IL-12, and a third nucleic acid encoding a 4-1BBL antigen, wherein the administration of the recombinant MVA generates an enhanced inflammatory response in the tumor as compared to an inflammatory response generated by an intratumoral or non-intratumoral injection of MVA alone or a non-intratumoral injection of a recombinant MVA comprising a first nucleic acid encoding a heterologous tumor-associated antigen, a second nucleic acid encoding IL-12, and a third nucleic acid encoding a 4-1BBL antigen.
[0057] In various additional embodiments, the present invention provides a recombinant modified Vaccinia Ankara (MVA) for use in preparing a medicament to treat cancer or to enhance the immune response in a subject to a cancerous tumor, the recombinant MVA comprising (a) a first nucleic acid encoding a tumor-associated antigen (TAA) and (b) a second nucleic acid encoding IL-12. Optionally, the recombinant MVA further comprises a third nucleic acid encoding 4-1BBL. Alternatively, the recombinant MVA is provided in combination with a second recombinant MVA comprising a nucleic acid encoding 4-1BBL and optionally a TAA that is the same or is different from the TAA encoded by the first nucleic acid.
[0058] In various additional embodiments, the present invention includes a recombinant modified Vaccinia Ankara (MVA) for use in enhancing the immune response of a subject to a tumor, the recombinant MVA comprising (a) a first nucleic acid encoding a tumor-associated antigen (TAA) and (b) a second nucleic acid encoding 4-1BBL. Optionally, the recombinant MVA is provided in a combination further comprising a second recombinant MVA comprising a third nucleic acid encoding IL-12.
[0059] In various additional embodiments, the present invention includes a recombinant modified Vaccinia Ankara (MVA) for use in preparing a medicament to treat cancer or enhance the immune response in a subject having cancer, the recombinant MVA comprising: (a) a first nucleic acid encoding a tumor-associated antigen (TAA); (b) a second nucleic acid encoding IL-12; and (c) a third nucleic acid encoding 4-1BBL.
[0060] In embodiments where more than one recombinant MVA is administered in a combination treatment, the recombinant MVAs can be administered at the same time or at different times so long as they are present in the subject together for some period of time. In these embodiments, unless otherwise specified, the recombinant MVAs can be administered by the same route(s) and/or location of administration or by a different location and/or route or routes of administration. That is, in some embodiments, a first recombinant MVA is administered intratumorally to a particular tumor in the subject and a second or subsequent recombinant MVA is administered intratumorally to a different tumor in the subject, or is administered intravenously, subcutaneously, intraperitoneally, or by some other route of administration. In some embodiments, a first recombinant MVA is administered intraperitoneally to a subject and a second or subsequent recombinant MVA is administered by a different route of administration, e.g., is administered intravenously, subcutaneously, intratumorally, or by some other route of administration
[0061] In some embodiments, the TAA encoded by at least one recombinant MVA is selected from the group consisting of: carcinoembryonic antigen (CEA), mucin 1 cell surface associated (MUC-1), prostatic acid phosphatase (PAP), prostate specific antigen (PSA), human epidermal growth factor receptor 2 (HER-2), survivin, tyrosine related protein 1 (TRP1), tyrosine related protein 2 (TRP2), Brachyury, Preferentially Expressed Antigen in Melanoma (PRAME), Folate receptor 1 (FOLR1), Human endogenous retrovirus-K envelope (HERV-K-env), Human endogenous retrovirus-K-gag (HERV-K-gag), and combinations thereof. In some embodiments, the TAA encoded by a recombinant MVA is expressed by at least one tumor in the subject to be treated, or is likely or is suspected to be expressed by at least one tumor in the subject to be treated.
[0062] The compositions and methods of the present invention enhance multiple aspects of a subject's immune response. In this manner, the invention provides improved treatment of a subject having at least one tumor, including for example a cancer patient. More particularly, the inventors demonstrated that various embodiments of the present invention injected intratumorally caused increased inflammatory responses in the tumor and that may also be detectable in the blood serum of the subject. These indicia of systemic inflammation can include increased production of IL-12 p70, M-CSF, and IL-33; increased antigen-specific CD8+ T cells, increased percentages of CD8+ T cells expressing IFN-gamma and TNF-alpha, decrease in tumor size and/or growth rate, improved survival of treated subjects, and the like, and can be detected by assays known in the art by evaluating the tumor and/or the peripheral blood serum, assessing survival at regular intervals, and the like.
[0063] Intratumoral administration of recombinant MVA encoding IL-12 generates an enhanced antitumor effect. In at least one aspect, the present invention includes a recombinant MVA encoding a TAA and IL-12 (rMVA-TAA-IL-12) that is administered intratumorally, wherein the intratumoral administration enhances an anti-tumor effect, as compared to an intratumoral administration of a recombinant MVA without IL-12, or as compared to a non-intratumoral administration of a recombinant MVA encoding IL-12 (for example, such as a subcutaneous administration of a recombinant MVA encoding IL-12). These enhanced antitumor effects include, for example: an increase in immune response to the tumor and/or a tumor antigen expressed by the tumor; a decrease in tumor size and/or growth rate of injected tumors as well as other, non-injected tumors in a subject; and also include an increase in survival of treated subjects.
[0064] In other embodiments, intraperitoneal administration of recombinant MVA encoding IL-12 generates an enhanced antitumor effect against intraperitoneal tumors. In this manner, the present invention includes a recombinant MVA encoding a TAA and IL-12 (rMVA-TAA-IL-12) that is administered intraperitoneally to a subject with intraperitoneal tumors, wherein the intraperitoneal administration enhances an anti-tumor effect, as compared to an intraperitoneal administration of a recombinant MVA without IL-12, or as compared to a non-intraperitoneal administration of a recombinant MVA encoding IL-12 (for example, such as a subcutaneous administration of a recombinant MVA encoding IL-12). These enhanced antitumor effects include decrease in tumor size and/or growth rate of tumors, and also include an increase in survival of treated subjects. In some embodiments, the recombinant MVA encodes IL-12 (MVA-IL-12) and is administered intraperitoneally to a subject with intraperitoneal tumors. The recombinant MVA encoding IL-12 tends to localize to the omentum and in this manner the invention provides a method of increasing the amount of IL-12 in the omentum, comprising administering a recombinant MVA encoding IL-12 to a subject.
[0065] As part of the present disclosure, a recombinant MVA comprising one or more nucleic acids encoding a TAA and IL-12 was administered intratumorally to a subject. Shown in
Definitions
[0066] As used herein, the singular forms a, an, and the include plural references unless the context clearly indicates otherwise. Thus, for example, reference to a nucleic acid includes one or more of the nucleic acid and reference to the method includes reference to equivalent steps and methods known to those of ordinary skill in the art that could be modified or substituted for the methods described herein.
[0067] Unless otherwise indicated, the term at least preceding a series of elements is to be understood to refer to every element in the series. Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the invention described herein. Such equivalents are intended to be encompassed by the present invention.
[0068] Throughout this specification and the claims which follow, unless the context requires otherwise, the word comprise, and variations such as comprises and comprising, will be understood to imply the inclusion of a stated integer or step or group of integers or steps but not the exclusion of any other integer or step or group of integer or step. When used herein, the term comprising can be substituted with the term containing or including or sometimes with the term having. Any of the aforementioned terms (comprising, containing, including, having), though less preferred, whenever used herein in the context of an aspect or embodiment of the present invention can be substituted with the term consisting of. When used herein, consisting of excludes any element, step, or ingredient not specified in the claim element. When used herein, consisting essentially of does not exclude materials or steps that do not materially affect the basic and novel characteristics of the claim.
[0069] As used herein, the conjunctive term and/or between multiple recited elements is understood as encompassing both individual and combined options. For instance, where two elements are conjoined by and/or, a first option refers to the applicability of the first element without the second. A second option refers to the applicability of the second element without the first. A third option refers to the applicability of the first and second elements together. Any one of these options is understood to fall within the meaning, and therefore satisfy the requirement of the term and/or as used herein. Concurrent applicability of more than one of the options is also understood to fall within the meaning, and therefore satisfy the requirement of the term and/or.
[0070] Mutated or modified protein or antigen as described herein is as defined herein any modification to a nucleic acid or amino acid, such as deletions, additions, insertions, and/or substitutions.
[0071] Percent (%) sequence homology or identity with respect to nucleic acid sequences described herein is defined as the percentage of nucleotides in a candidate sequence that are identical with the nucleotides in the reference sequence (i.e., the nucleic acid sequence from which it is derived), after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent nucleotide sequence identity or homology can be achieved in various ways that are within the skill in the art, for example, using publicly available computer software such as BLAST, ALIGN, or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximum alignment over the full length of the sequences being compared.
[0072] For example, an appropriate alignment for nucleic acid sequences is provided by the local homology algorithm of Smith and Waterman ((1981) Advances in Applied Mathematics 2: 482-489). This algorithm can be applied to amino acid sequences by using the scoring matrix developed by Dayhoff, Atlas of Protein Sequences and Structure, M. O. Dayhoff ed., 5 suppl. 3: 353-358, National Biomedical Research Foundation, Washington, D.C., USA, and normalized by Gribskov ((1986) Nucl. Acids Res. 14(6): 6745-6763). An exemplary implementation of this algorithm to determine percent identity of a sequence is provided by the Genetics Computer Group (Madison, Wisconsin, USA) in the BestFit utility application. The default parameters for this method are described in the Wisconsin Sequence Analysis Package Program Manual, Version 8 (1995) (available from Genetics Computer Group, Madison, Wisconsin, USA). A preferred method of establishing percent identity in the context of the present invention is to use the MPSRCH package of programs copyrighted by the University of Edinburgh, developed by Collins and Sturrok, and distributed by IntelliGenetics, Inc. (Mountain View, California, USA). From this suite of packages the Smith-Waterman algorithm can be employed where default parameters are used for the scoring table (for example, gap open penalty of 12, gap extension penalty of one, and a gap of six). From the data generated the Match value reflects sequence identity. Other suitable programs for calculating the percent identity or similarity between sequences are generally known in the art, for example, another alignment program is BLAST, used with default parameters. For example, BLASTN and BLASTP can be used using the following default parameters: genetic code=standard; filter=none; strand=both; cutoff=60; expect=10; Matrix=BLOSUM62; Descriptions=50 sequences; sort by=HIGH SCORE; Databases=non-redundant, GenBank+EMBL+DDBJ+PDB+GenBank CDS translations+Swiss protein+Spupdate+PIR. Details of these programs can be found at the following internet address: blast.ncbi.nlm.nih.gov/.
[0073] The term prime-boost vaccination or prime-boost regimen refers to a vaccination strategy or regimen using a first priming injection of a vaccine targeting a specific antigen followed at intervals by one or more boosting injections of the same vaccine. Prime-boost vaccination may be homologous or heterologous. A homologous prime-boost vaccination uses a vaccine comprising the same antigen and vector for both the priming injection and the one or more boosting injections. A heterologous prime-boost vaccination uses a vaccine comprising one antigen and/or vector for the priming injection and a different antigen and/or vector for the one or more boosting injections. For example, a homologous prime-boost vaccination uses a recombinant poxvirus comprising nucleic acids expressing one or more antigens for the priming injection and the same recombinant poxvirus expressing one or more antigens for the one or more boosting injections. In contrast, a heterologous prime-boost vaccination uses a recombinant poxvirus comprising nucleic acids expressing one or more antigens for the priming injection and a different recombinant poxvirus expressing one or more different antigens and/or comprising a different vector for the one or more boosting injections.
[0074] The term recombinant means a polynucleotide, virus, or vector of semisynthetic or synthetic origin which either does not occur in nature or is linked to another polynucleotide in an arrangement not found in nature. By recombinant MVA or rMVA as used herein is generally intended a modified vaccinia Ankara (MVA) that comprises at least one polynucleotide encoding a heterologous gene, such as, for example, a tumor associated antigen (TAA). In some embodiments, the recombinant MVA is MVA-BN or a derivative thereof.
[0075] The term subject means an animal having or suspected of having at least one tumor; thus, in some embodiments, a subject is a human cancer patient. A subject can be any animal, particularly a mammal, such as, for example, a cat, a dog, a horse, a cow, a sheep, or any other animal expected to benefit from or treated with the compositions and/or methods of the invention.
[0076] As used herein, a transgene or heterologous gene is understood to be a nucleic acid or amino acid sequence which is not present in the wild-type poxviral genome (e.g., the genome of Vaccinia, Fowlpox, or MVA). The skilled person understands that a transgene or heterologous gene, when present in a poxvirus such as Vaccinia virus, is to be incorporated into the poxviral genome in such a way that, following administration of the recombinant poxvirus to a host cell, it is expressed as the corresponding heterologous gene product, i.e., as the heterologous antigen and/or heterologous protein. Expression is normally achieved by operatively linking the heterologous gene to regulatory elements that allow expression in the poxvirus-infected cell. Preferably, the regulatory elements include a natural or synthetic poxviral promoter.
[0077] A vector refers to a recombinant DNA or RNA plasmid or virus that can comprise a heterologous polynucleotide. The heterologous polynucleotide may comprise a sequence of interest for purposes of prevention or therapy, and may optionally be in the form of an expression cassette. As used herein, a vector is used to transfer genetic material into a cell but is not necessarily capable of replication in the ultimate target cell or subject. The term includes cloning vectors and viral vectors.
[0078] The term polypeptide refers to a polymer of two or more amino acids joined to each other by peptide bonds or modified peptide bonds. The amino acids may be naturally occurring as well as non-naturally occurring, or a chemical analogue of a naturally occurring amino acid. The term also refers to proteins, i.e., functional biomolecules comprising at least one polypeptide; when comprising at least two polypeptides, these may form complexes, be covalently linked, or may be non-covalently linked. The polypeptide(s) in a protein can be glycosylated and/or lipidated and/or comprise prosthetic groups. As used herein, reducing tumor volume or size (or a reduction in tumor volume or size) can be characterized as a reduction in tumor volume and/or size but can also be characterized in terms of related clinical trial endpoints, as is understood in the art. Some exemplary clinical trial endpoints associated with a reduction in tumor volume and/or size can include, but are not limited to, Response Rate (RR), Objective response rate (ORR), and so forth.
[0079] As used herein, an increase in survival rate can be characterized as an increase in survival of a subject (e.g., a human cancer patient), but can also be characterized in terms of clinical trial endpoints understood in the art. Some exemplary clinical trial endpoints associated with an increase in survival rate include, but are not limited to, Overall Survival rate (OS), Progression Free Survival (PFS) and so forth.
Combinations and Methods
[0080] In various embodiments, the present invention comprises a recombinant MVA comprising a first nucleic acid encoding a tumor-associated antigen (TAA) and a second nucleic acid encoding IL-12, that when administered intratumorally induces both an inflammatory response and an enhanced T cell response as compared to an inflammatory response and a T cell response induced by a non-intratumoral administration of MVA alone or non-intratumoral administration of a recombinant MVA comprising a first nucleic acid encoding a TAA and a second nucleic acid encoding IL-12.
[0081] In various additional embodiments, the present invention comprises an MVA comprising a first nucleic acid encoding a tumor-associated antigen (TAA), a second nucleic acid encoding IL-12, and a third nucleic acid encoding 4-1BBL, that when administered intratumorally induces both an enhanced intratumoral inflammatory response and an enhanced T cell response as compared to the responses expected to be induced by administration of MVA alone or a recombinant MVA encoding less than all of the TAA, IL-12, and 4-1BBL components (e.g., a recombinant MVA encoding only IL-12, or only 4-1BBL).
[0082] In other embodiments, the invention provides recombinant-MVA-encoded IL-12 and 4-1BBL that are encoded by separate recombinant MVAs, at least one of which also encodes a Tumor Associated Antigen (TAA). In these embodiments, the recombinant MVAs are administered in combination such that both recombinant MVAs are present together in the subject for a period of time, even though they may be administered to the subject by different routes of administration at different times. In some embodiments, two or more recombinant MVAs are administered to a subject intratumorally together (i.e., in the same medicament or formulation).
[0083] Increased or Enhanced Inflammation Response. In various aspects of the present disclosure it was determined that administration of a recombinant MVA of the invention induces an increased or enhanced inflammatory response, as compared to an administration of MVA alone. This increased or enhanced inflammatory response can be detected, for example, by measuring cytokine levels in the subject's blood and/or plasma, or may be detected at or near the site of administration, such as, for example, in a tumor that was injected intratumorally. Thus, in an aspect of the present invention it was determined that an intratumoral administration of a recombinant MVA of the invention induces an increased or enhanced inflammatory response in a tumor, as compared to an administration of MVA alone.
[0084] In some embodiments, a recombinant MVA encoding IL-12 is injected intraperitoneally to treat a subject and induces an increased or enhanced inflammatory response in at least one peritoneal tumor and/or in the omentum.
[0085] In some embodiments, the subject being treated with the methods of the invention has at least one tumor that is peritoneal carcinomatosis or has malignant ascites or a metastatic tumor of the omentum, preferably derived from an abdominal malignancy, more preferably derived from ovarian or colorectal cancer. In some embodiments, the subject is being treated for a tumor that is an abdominal malignancy, preferably metastasizing into the peritoneal cavity and/or the omentum. In some embodiments, the subject has a tumor that is a tumor of ovarian or colorectal cancer.
[0086] In some embodiments, treatment of a subject with a method of the invention increases the likelihood of survival of the subject. In some embodiments, treatment of a subject with a method of the invention induces an antigen-specific immune or T cell response, or IFN- production in the peritoneal cavity of a subject, and/or in the omentum.
[0087] In some embodiments, intraperitoneal administration is carried out in a prime-boost regimen.
[0088] In another embodiment, the invention provides a pharmaceutical preparation or composition comprising the recombinant MVA of the invention which pharmaceutical preparation or composition is adapted to intraperitoneal administration.
[0089] In yet another embodiment, the invention provides the recombinant MVA of the invention for use in increasing the overall survival of a subject, preferably a human, preferably suffering from peritoneal carcinomatosis or malignant ascites or a metastatic tumor of the omentum, preferably derived from an abdominal malignancy, more preferably derived from ovarian or colorectal cancer, wherein the recombinant MVA is administered intraperitoneally.
[0090] In yet another aspect, the invention provides the recombinant MVA of the invention for use in reducing signs and symptoms of peritoneal carcinomatosis or malignant ascites or a metastatic tumor of the omentum in a subject, preferably a human; in some embodiments, the tumor is derived from an abdominal malignancy, such as, for example, ovarian or colorectal cancer, wherein the recombinant MVA is administered intraperitoneally.
[0091] In yet another aspect, the invention provides the recombinant MVA of the invention for use in inducing an antigen-specific immune or T cell response, or IFN- production in the peritoneal cavity of a subject suffering from peritoneal carcinomatosis or malignant ascites or a metastatic tumor of the omentum, for example, derived from an abdominal malignancy, such as ovarian or colorectal cancer, wherein the recombinant MVA is administered intraperitoneally.
[0092] In at least one aspect, an increased inflammatory response or enhanced inflammation response according to the present disclosure is characterized by one or more of the following: increased production of IL-12 p70, M-CSF, and/or IL-33; increased antigen-specific CD8+ T cells, increased percentages of CD8+ T cells expressing IFN-gamma and TNF-alpha, decrease in tumor size and/or growth rate, improved survival of treated subjects, and the like, which can be detected by assays known in the art. As used herein, increased inflammatory response generally refers to an increase in production of a particular cytokine or cell type associated with inflammation, in comparison to baseline levels prior to treatment according to methods of the invention and/or treatment with compositions of the invention. For example, in an increased inflammatory response, the amount of a cytokine or cell type is increased by at least 10%, 20%, 30%, 50%, 70%, or 100% or more in comparison to baseline levels prior to treatment according to methods of the invention and/or treatment with compositions of the invention.
[0093] As used herein, enhanced inflammatory response generally refers to an inflammatory response in which a new cytokine or new cell population is produced that was not detectable or was only detectable at trace amounts prior to treatment according to methods of the invention and/or treatment with compositions of the invention.
[0094] The compositions and methods of the present invention enhance multiple aspects of a subject's immune response. In this manner, the invention provides improved treatment of a subject having at least one tumor, including for example a cancer patient. More particularly, the inventors demonstrated that various recombinant MVAs and combinations thereof of the present invention when injected intratumorally or intraperitoneally caused increased inflammatory responses in the tumor that may be detectable in the tumor and may also be detectable in the blood serum of the subject. These indicia of systemic inflammation can include increased production of IL-12 p70, M-CSF, and IL-33; increased antigen-specific CD8+ T cells, increased percentages of CD8+ T cells expressing IFN-gamma and TNF-alpha, decrease in tumor size and/or growth rate, improved survival of treated subjects, and the like, and can be detected by assays known in the art by evaluating the tumor and/or the peripheral blood serum, assessing survival at regular intervals, and the like.
[0095] Thus, whether an inflammatory response is enhanced or increased in a tumor and/or tumor cells in accordance with present disclosure can be determined by measuring to determine whether there is an increase in expression of one or more molecules which are indicative of an increased inflammatory response, including the secretion of chemokines and cytokines as is known in the art. Exemplary inflammatory response markers include one or more of IL-12 p70, M-CSF, IL-33, IFN-gamma, and TNF-alpha. These molecules and the measurement thereof are validated assays that are understood in the art and can be carried out according to known techniques. See, e.g., Borrego et al. ((1999) Immunology 7(1): 159-165).
[0096] The increased or enhanced inflammatory response provided by the compositions and methods of the invention can also produce decreases in the volume and/or mean diameter of at least one tumor in the treated subject. In this manner, the invention provides methods of decreasing the volume, size, and/or growth rate of at least one tumor in a subject. In some embodiments, treatment with the compositions and/or methods of the invention produces a decrease in the volume, size, and/or growth rate of at least one tumor of at least 10%, 20%, 30%, 50%, or more in comparison to the volume, size, and/or growth rate of said tumor prior to treatment.
[0097] Enhanced T Cell response. In accordance with the present application, an enhanced T cell response is characterized by one or more of the following: (1) an increase in frequency of CD8.sup.+ T cells; (2) an increase in CD8.sup.+ T cell activation; and (3) an increase in CD8.sup.+ T cell proliferation. Thus, whether a T cell response is enhanced in accordance with the present application can be determined by measuring the expression of one or more molecules which are indicative of: (1) an increase in CD8.sup.+ T cell frequency; (2) an increase in CD8.sup.+ T cell activation; and/or (3) an increase CD8.sup.+ T cell proliferation. Exemplary markers that are useful in measuring CD8.sup.+ T cell frequency, activation, and proliferation include IFN-, TNF-, and/or CD44, as is known in the art. Measuring antigen specific T cell frequency can also be measured by MHC multimers such as pentamers or dextramers; such measurements and assays as well as others suitable for use in evaluating methods and compositions of the invention are validated and understood in the art.
[0098] In one aspect, an increase in CD8.sup.+ T cell frequency is characterized by an increase of at least 2-fold, 3-fold, 5-fold, or 10-fold or more in IFN- and/or dextramer+CD8.sup.+ T cells compared to the pre-treatment/baseline. An increase in CD8.sup.+ T cell activation is characterized, for example, as at least a 2-fold increase in the number of CD8+ T cells and/or at least a 2-fold increase in CD69 and/or CD44 expression compared to pre-treatment/baseline expression. An increase in CD8.sup.+ T cell proliferation is characterized, for example, as at least a 2-fold increase in Ki67 expression compared to pre-treatment/baseline expression.
[0099] In an alternative aspect, an increased or enhanced T cell response is characterized by an increase in CD8.sup.+ T cell expression of effector cytokines and/or an increase of cytotoxic effector functions. An increase in expression of effector cytokines can be measured, for example, by expression of one or more of IFN-, TNF-, and/or IL-2 compared to pre-treatment/baseline. An increase in cytotoxic effector functions, for example, can be measured by expression of one or more of CD107a, granzyme B, and/or perforin and/or antigen-specific killing of target cells. The assays, cytokines, markers, and molecules described herein and the measurement thereof are validated and understood in the art and can be carried out according to known techniques. Additionally, assays for measuring cytokines and T cell responses can be found in the working examples.
[0100] In yet additional embodiments, the combinations and methods described herein are for use in treating a human cancer patient. In preferred embodiments, the cancer patient is suffering from and/or is diagnosed with a cancer selected from the group consisting of: breast cancer, lung cancer, head and neck cancer, thyroid cancer, melanoma, gastric cancer, bladder cancer, kidney cancer, liver cancer, pancreatic cancer, prostate cancer, ovarian cancer, urothelial cancer, cervical cancer, or colorectal cancer. In yet additional embodiments, the combinations and methods described herein are for use in treating a human cancer patient suffering from and/or diagnosed with a breast cancer, colorectal cancer, or melanoma, or peritoneal carcinomatosis.
[0101] Tumor-Associated Antigens for use in the compositions and methods of the invention. In certain embodiments, an immune response is produced in a subject against a cell-associated polypeptide antigen. In certain such embodiments, a cell-associated polypeptide antigen is a tumor-associated antigen (TAA). In various embodiments, the TAA is HER2, PSA, PAP, CEA, MUC-1, survivin, TRP1, TRP2, Brachyury, Preferentially Expressed Antigen in Melanoma (PRAME), Folate receptor 1 (FOLR1), Human endogenous retrovirus-K envelope (HERV-K-env), or Human endogenous retrovirus-K-gag (HERV-K-gag), alone or in any combination thereof.
[0102] In still further embodiments, the TAA may include, but is not limited to, 5 alpha reductase, alpha-fetoprotein, AM-1, APC, April, BAGE, beta-catenin, Bcl12, bcr-abl, CA-125, CASP-8/FLICE, Cathepsins, CD19, CD20, CD21, CD23, CD22, CD33 CD35, CD44, CD45, CD46, CD5, CD52, CD55, CD59, CDC27, CDK4, CEA, c-myc, Cox-2, DCC, DcR3, E6/E7, CGFR, EMBP, Dna78, farnesyl transferase, FGF8b, FGF8a, FLK-1/KDR, folic acid receptor, G250, GAGE-family, gastrin 17, gastrin-releasing hormone, GD2/GD3/GM2, GnRH, GnTV, GP1, gp100/Pmel17, gp-100-in4, gp15, gp75/TRP1, hCG, heparanase, Her2/neu, HMTV, Hsp70, hTERT, IGFR1, IL-13R, iNOS, Ki67, KIAA0205, K-ras, H-ras, N-ras, KSA, LKLR-FUT, MAGE-family, mammaglobin, MAP17, melan-A/MART-1, mesothelin, MIC A/B, MT-MMPs, mucin, NY-ESO-1, osteonectin, p15, P170/MDR1, p53, p97/melanotransferrin, PAI-1, PDGF, uPA, PRAME, probasin, progenipoietin, PSA, PSM, RAGE-1, Rb, RCAS1, SART-1, SSX-family, STAT3, STn, TAG-72, TGF-alpha, TGF-beta, Thymosin-beta-15, TNF-alpha, TRP1, TRP2, tyrosinase, VEGF, ZAG, p16INK4, and glutathione-S-transferase.
[0103] In some embodiments, the TAA is an Endogenous Retroviral Protein (ERV), or derivative thereof. Such an ERV can be an ERV from the Human HERV-K protein family and, for example, can be a HERV-K envelope (env) protein, a HERV-K group specific antigen (gag) protein, and a HERV-K marker of melanoma risk (mel) protein (see, e.g., Cegolon et al. (2013) BMC Cancer 13:4).
[0104] Any TAA may be used so long as it accomplishes at least one objective or desired end of the invention, such as, for example, stimulating an immune response following administration of the MVA containing it. In some embodiments, the TAA encoded by the one or more recombinant MVAs is known to be expressed by at least one tumor in the subject, for example, based on previous testing of a sample of the tumor. Exemplary sequences of TAAs, including TAAs mentioned herein, are known in the art and are suitable for use in the compositions and methods of the invention. Sequences of TAAs for use in the compositions and methods of the invention may be identical to sequences known in the art or disclosed herein, or they may share less than 100% identity, such as at least 90%, 91%, 92%, 95%, 97%, 98%, or 99% or more sequence identity to either a nucleotide or amino acid sequence known in the art or disclosed herein. Thus, a sequence of a TAA for use in a composition or method of the invention may differ from a reference sequence known in the art and/or disclosed herein by less than 20, or less than 19, 18, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 nucleotides or amino acids, so long as it accomplishes at least one objective or desired end of the invention (for example, to help stimulate an immune response when administered to a subject as a component of a recombinant MVA). One of skill in the art is familiar with techniques and assays for evaluating TAAs to ensure their suitability for use in a recombinant MVA or method of the invention.
[0105] In certain embodiments, modifications to one or more of the TAAs, such as, but not limited to, HERV-K env, HERV-K gag, HERV-K mel, CEA, MUC-1, PAP, PSA, PRAME, FOLR1, HER2, survivin, TRP1, TRP2, or Brachyury, are made such that, after administration to a subject, polyclonal antibodies are elicited that predominantly react with the one or more of the TAAs described herein. Such antibodies could attack and eliminate tumor cells as well as prevent metastatic cells from developing into metastases. The effector mechanism of this anti-tumor effect would be mediated via complement and Antibody-Dependent Cellular Cytotoxicity (ADCC). In addition, the induced antibodies could also inhibit cancer cell growth through inhibition of growth-factor-dependent oligo-dimerization and internalization of the receptors. In certain embodiments, such modified TAAs could induce CTL responses directed against known and/or predicted TAA epitopes displayed by the tumor cells.
[0106] In certain embodiments, a modified TAA polypeptide antigen comprises a CTL epitope of the cell-associated polypeptide antigen and a variation, wherein the variation comprises at least one CTL epitope or a foreign TH epitope. Certain such modified TAAs can include (in one non-limiting example) one or more HER2 polypeptide antigens comprising at least one CTL epitope and a variation comprising at least one CTL epitope of a foreign TH epitope; these HER2 antigens and methods of producing the same are described in U.S. Pat. No. 7,005,498 and U.S. Patent Pub. Nos. 2004/0141958 and 2006/0008465, herein incorporated by reference.
[0107] IL-12. Structurally, IL-12 is a type I cytokine, heterodimeric protein consisting of two p35 and p40 subunits that are covalently linked. The heterodimer form is also referred to as IL-12-p70 or IL-12-p35/p40. IL-12 has many effects that promote an immune response, but some clinical studies with IL-12 had unacceptable levels of adverse events (see Lasek et al. (2014) Cancer Immunol. Immunother. 63: 419-35). IL-12 has been demonstrated to induce production of IFN-gamma, to induce T.sub.H1 cell differentiation, and also to increase activation and cytotoxic function of T and NK cells (see Nguyen et al. (2020) Front. Immunol. 11: 575597). A variety of modified forms of IL-12 are known in the art and are useful in embodiments of the invention so long as they retain IL-12 function, such as, for example, increasing secretion of IFN-gamma (IFN-), etc. For example, a modified form of IL-12 known in the art is single chain Interleukin-12, also referred to as IL-12 sc or sc IL-12. This IL-12 sc provides the advantage of automatically having the correct stoichiometry of the p35 and p40 subunits, so that there is not excess p40 subunit produced that might exert an inhibitory effect on the full length IL-12 (see, e.g., Anderson et al. (1997) Hum. Gene Ther. 8: 1125-35). A homodimer of the p40 subunits has been shown to suppress the activity of the heterodimer form and thus would not be useful in embodiments of the invention.
[0108] In some embodiments of the invention, IL-12 is encoded by a recombinant MVA along with a tumor-associated antigen (TAA). In some embodiments of the invention, IL-12 is encoded by a recombinant MVA along with 4-1BBL and a TAA; alternatively, in some embodiments of the invention, 4-1BBL is encoded by a recombinant MVA separately from IL-12 and used in combination with a recombinant MVA encoding IL-12, wherein at least one of such MVAs also encodes a TAA. In some embodiments, a recombinant MVA encodes IL-12 and, optionally, also encodes a TAA. In some embodiments, the IL-12 sequence is a human IL-12 sequence. In some embodiments, the IL-12 has an amino acid sequence with at least 90%, 95%, 97% 98%, or 99% identity to SEQ ID NO: 10 or 12, or has an amino acid sequence that differs from the amino acid sequence set forth in SEQ ID NO: 10 or 12 by less than 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acids, or is identical to the sequence set forth in SEQ ID NO: 10 or 12. In additional embodiments, a nucleic acid encoding IL-12 comprises a nucleic acid sequence having at least 90%, 95%, 97% 98%, or 99% identity to SEQ ID NO: 9 or 11, i.e., differing from the nucleic acid sequence set forth in SEQ ID NO: 9 or 11 by less than 20, 10, 5, 4, 3, 2, or 1 nucleic acid in the sequence, or is identical to the sequence set forth in SEQ ID NO: 9 or 11. IL-12 is well studied, so it is expected that one of skill in the art would be able to introduce sequence modifications in more variable or less conserved regions to avoid affecting gene function. It is contemplated that any IL-12 sequence is suitable for use in embodiments of the invention so long as it provides at least one function of IL-12 in an assay, such as any of the assays for IL-12 used in the working examples or otherwise known in the art.
[0109] 4-1BBL (also referred to herein as 41BBL or 4-1BB ligand). As illustrated by the present disclosure, the inclusion of 4-1BBL along with IL-12 in one or more recombinant MVAs and related methods induces increased and enhanced anti-tumor effects following intratumoral administration to a subject. Thus, in various embodiments, in addition to encoding a TAA and IL-12, a recombinant MVA encodes a 4-1BBL antigen, either in the same or in more than one recombinant MVAs. That is, in some embodiments, a separate recombinant MVA encoding a 4-1BBL antigen is administered in combination with a recombinant MVA encoding IL-12, wherein at least one of said recombinant MVAs also encodes a TAA. In such embodiments, the inclusion of 4-1BBL as part of the combination and related methods further enhances the immune response and decrease in tumor volume as well as prolonging progression-free survival and increasing survival rate.
[0110] 4-1BB/4-1BBL is a member of the TNFR/TNF superfamily. 4-1BBL is a costimulatory ligand expressed in activated B cells, monocytes and DCs, and 4-1BB is constitutively expressed by natural killer (NK) and natural killer T (NKT) cells, Tregs and several innate immune cell populations, including DCs, monocytes and neutrophils. Interestingly, 4-1BB is expressed on activated, but not resting, T cells (Wang et al. (2009) Immunol. Rev. 229: 192-215). 4-1BB ligation induces proliferation and production of interferon gamma (IFN-) and interleukin 2 (IL-2), as well as enhances T cell survival through the upregulation of antiapoptotic molecules such as Bcl-xL (Snell et al. (2011) Immunol. Rev. 244: 197-217). 4-1BB stimulation has been shown to enhance NK cell proliferation, IFN- production and cytolytic activity through enhancement of Antibody-Dependent Cell Cytotoxicity (ADCC) (Kohrt et al. (2011) Blood 117: 2423-32).
[0111] In some embodiments of the invention, 4-1BBL is encoded by a recombinant MVA along with IL-12 and a TAA; alternatively, in some embodiments of the invention, 4-1BBL is encoded by a recombinant MVA separately from IL-12 and used in combination with a recombinant MVA encoding IL-12, wherein at least one of such MVAs also encodes a TAA. In some embodiments, the 4-1BBL sequence is a human 4-1BBL sequence. In some embodiments, the 4-1BBL has an amino acid sequence with at least 90%, 95%, 97% 98%, or 99% identity to SEQ ID NO: 14; or has an amino acid sequence that differs from the amino acid sequence set forth in SEQ ID NO: 14 by less than 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acids, or is identical to the sequence set forth in SEQ ID NO: 14. In additional embodiments, a nucleic acid encoding 4-1BBL comprises a nucleic acid sequence having at least 90%, 95%, 97% 98%, or 99% identity to SEQ ID NO: 13, i.e., differing from the nucleic acid sequence set forth in SEQ ID NO: 13 by less than 20, 10, 5, 4, 3, 2, or 1 nucleic acid in the sequence, or is identical to the sequence set forth in SEQ ID NO: 13. 4-1BBL is well studied, so it is expected that one of skill in the art would be able to introduce sequence modifications in more variable or less conserved regions to avoid affecting gene function. It is contemplated that any 4-1BBL sequence is suitable for use in embodiments of the invention so long as it provides at least one function of 4-1BBL in an assay, such as any of the assays for 4-1BBL used in the working examples or otherwise known in the art.
[0112] Recombinant MVAs. In some embodiments of the present invention, IL-12, 4-1BBL, and a TAA are encoded by the same recombinant MVA, and in some embodiments, the IL-12 and 4-1BBL are encoded by different recombinant MVAs, at least one of which also encodes a TAA, and are administered to a subject in combination. As described and illustrated by the present disclosure, the intratumoral administration of the recombinant MVAs of the present disclosure induces in various aspects an enhanced immune response in cancer patients. In other embodiments, a recombinant MVA encoding a TAA and IL-12 is administered intraperitoneally to a subject having at least one intraperitoneal tumor, and in some embodiments a recombinant MVA encoding IL-12 (and not a heterologous TAA) is administered intraperitoneally to a subject having at least one intraperitoneal tumor.
[0113] Examples of MVA strains that are useful in the practice of the present invention and that have been deposited in compliance with the requirements of the Budapest Treaty are strains MVA 572, deposited at the European Collection of Animal Cell Cultures (ECACC), Vaccine Research and Production Laboratory, Public Health Laboratory Service, Centre for Applied Microbiology and Research, Porton Down, Salisbury, Wiltshire SP4 0JG, United Kingdom, with the deposition number ECACC 94012707 on Jan. 27, 1994; and MVA 575, deposited under ECACC 00120707 on Dec. 7, 2000; and MVA-BN, deposited on Aug. 30, 2000 at the European Collection of Cell Cultures (ECACC) under number V00083008, and their derivatives.
[0114] Derivatives of MVA-BN refer to viruses exhibiting essentially the same replication characteristics as MVA-BN, as described herein, but exhibiting differences in one or more parts of their genomes. MVA-BN, as well as derivatives thereof, are replication incompetent, meaning a failure to reproductively replicate in vivo and in vitro. More specifically, in vitro, MVA-BN or derivatives thereof have been described as being capable of reproductive replication in chicken embryo fibroblasts (CEF), but not capable of reproductive replication in the human keratinocyte cell line HaCat (Boukamp et al. (1988) J. Cell Biol. 106: 761-771), the human bone osteosarcoma cell line 143B (ECACC Deposit No. 91112502), the human embryo kidney cell line 293 (ECACC Deposit No. 85120602), and/or the human cervix adenocarcinoma cell line HeLa (ATCC Deposit No. CCL-2). Additionally, MVA-BN or derivatives thereof have a virus amplification ratio at least two-fold less, more preferably three-fold less, than MVA-575 in HeLa cells and HaCaT cell lines. Tests and assay for these properties of MVA-BN and derivatives thereof are described in WO 02/42480 (U.S. Pub. No. 2003/0206926) and WO 03/048184 (U.S. Pub. No. 2006/0159699).
[0115] The term not capable of reproductive replication or no capability of reproductive replication in human cell lines in vitro as described in the previous paragraphs is, for example, described in WO 02/42480, which also teaches how to obtain MVA having the desired properties as mentioned above. In some instances, the term applies to a virus that has a virus amplification ratio in vitro at 4 days after infection of less than 1 using the assays described in WO 02/42480 or in U.S. Pat. No. 6,761,893, herein incorporated by reference. The term failure to reproductively replicate refers to a virus that has a virus amplification ratio in human cell lines in vitro as described in the previous paragraphs at 4 days after infection of less than 1. Assays described in WO 02/42480 or in U.S. Pat. No. 6,761,893 are applicable for the determination of the virus amplification ratio.
[0116] The amplification or replication of a virus in human cell lines in vitro as described in the previous paragraphs is normally expressed as the ratio of virus produced from an infected cell (output) to the amount originally used to infect the cell in the first place (input) referred to as the amplification ratio. An amplification ratio of 1 defines an amplification status where the amount of virus produced from the infected cells is the same as the amount initially used to infect the cells, meaning that the infected cells are permissive for virus infection and reproduction. In contrast, an amplification ratio of less than 1, i.e., a decrease in output compared to the input level, indicates a lack of reproductive replication and therefore attenuation of the virus.
[0117] By adjuvantation herein is intended that a particular encoded protein or component of a recombinant MVA increases the immune response produced by the other encoded protein(s) or component(s) of the recombinant MVA.
[0118] In some embodiments, the compositions, methods, and combinations of the invention increase overall survival of a treated subject. By increase overall survival as used herein is intended that there is a statistically significant improvement in the survival rate of treated subjects as compared to untreated subjects.
[0119] Expression Cassettes/Control Sequences. In various aspects, the one or more nucleic acids described herein are embodied in in one or more expression cassettes in which the one or more nucleic acids are operably linked to expression control sequences. Operatively linked or operably linked means that the components described are in relationship permitting them to function in their intended manner e.g., a promoter to transcribe the nucleic acid to be expressed. An expression control sequence operatively linked to a coding sequence is joined such that expression of the coding sequence is achieved under conditions compatible with the expression control sequences. The expression control sequences include, but are not limited to, appropriate promoters, enhancers, transcription terminators, a start codon at the beginning of a protein-encoding open reading frame, splicing signals for introns, and in-frame stop codons. Suitable promoters include, but are not limited to, the SV40 early promoter, an RSV promoter, the retrovirus LTR, the adenovirus major late promoter, the human CMV immediate early I promoter, and various poxvirus promoters, including but not limited to the following vaccinia virus or MVA-derived and FPV-derived promoters: the 30K promoter, the 13 promoter, the PrS promoter, the PrS5E promoter, the Pr7.5K, the PrHyb promoter, the Pr13.5 long promoter, the 40K promoter, the MVA-40K promoter, the FPV 40K promoter, 30 k promoter, the PrSynIIm promoter, the PrLE1 promoter, and the PR1238 promoter. Additional promoters are further described in WO 2010/060632, WO 2010/102822, WO 2013/189611,WO 2014/063832, and WO 2017/021776, which are incorporated fully by reference herein.
[0120] Additional expression control sequences include, but are not limited to, leader sequences, termination codons, polyadenylation signals, and any other sequences necessary for the appropriate transcription and subsequent translation of the nucleic acid sequence encoding the desired heterologous protein (e.g., a TAA, IL-12, and/or 4-1BBL) in the desired host system. The poxvirus vector may also contain additional elements necessary for the transfer and subsequent replication of the expression vector containing the nucleic acid sequence in the desired host system. It will further be understood by one skilled in the art that such vectors are easily constructed using conventional methods (Ausubel et al., (1987) in Current Protocols in Molecular Biology, John Wiley and Sons, New York, N.Y.) and are commercially available.
[0121] Methods and dosing regimens for administering the combination. In one or more aspects, the combinations of the present invention can be administered as part of a homologous and/or heterologous prime-boost regimen. As shown by the working examples, a homologous prime boost regimen increases a subject's specific T cell responses. Thus, in one or more embodiments there is a combination and/or method for stimulating the immune response, reducing tumor size and/or increasing survival in a subject comprising administering to the subject a combination of the instant invention, wherein the combination is administered as part of a homologous or heterologous prime-boost regimen.
Generation of Recombinant MVA Viruses Comprising Transgenes
[0122] The recombinant MVA viruses provided herein can be generated by routine methods known in the art. Methods to obtain recombinant poxviruses or to insert exogenous coding sequences into a poxviral genome are well known to the person skilled in the art. For example, methods for standard molecular biology techniques such as cloning of DNA, DNA and RNA isolation, Western blot analysis, RT-PCR and PCR amplification techniques are described in Molecular Cloning, A Laboratory Manual (2nd ed., Sambrook et al., Cold Spring Harbor Laboratory Press (1989)), and techniques for the handling and manipulation of viruses are described in Virology Methods Manual (Mahy et al. (eds.), Academic Press (1996)). Similarly, techniques and know-how for the handling, manipulation and genetic engineering of MVA are described in Molecular Virology: A Practical Approach (Davison & Elliott (eds.), The Practical Approach Series, IRL Press at Oxford University Press, Oxford, UK (1993)(see, e.g., Chapter 9: Expression of genes by Vaccinia virus vectors)) and Current Protocols in Molecular Biology (John Wiley & Son, Inc. (1998) (see, e.g., Chapter 16, Section IV: Expression of proteins in mammalian cells using vaccinia viral vector)).
[0123] For the generation of the various recombinant MVA viruses disclosed herein, different methods may be applicable. The DNA sequence to be inserted into the virus can be placed into an E. coli plasmid construct into which DNA homologous to a section of DNA of the poxvirus has been inserted. Separately, the DNA sequence to be inserted can be ligated to a promoter. The promoter-gene linkage can be positioned in the plasmid construct so that the promoter-gene linkage is flanked on both ends by DNA homologous to a DNA sequence flanking a region of poxviral DNA containing a non-essential locus. The resulting plasmid construct can be amplified by propagation within E. coli bacteria and isolated. The isolated plasmid containing the DNA gene sequence to be inserted can be transfected into a cell culture, e.g., of chicken embryo fibroblasts (CEFs), at the same time the culture is infected with MVA virus. Recombination between homologous MVA viral DNA in the plasmid and the viral genome, respectively, can generate a poxvirus modified by the presence of foreign DNA sequences.
[0124] According to a preferred embodiment, a cell of a suitable cell culture such as, e.g., CEF cells, can be infected with an MVA virus. The infected cell can be subsequently transfected with a first plasmid vector comprising a foreign or heterologous gene or genes, such as one or more of the nucleic acids provided in the present disclosure, preferably under the transcriptional control of a poxvirus expression control element. As explained above, the plasmid vector also comprises sequences capable of directing the insertion of the exogenous sequence into a selected part of the MVA viral genome. Optionally, the plasmid vector also contains a cassette comprising a marker and/or selection gene operably linked to a poxviral promoter. Suitable marker or selection genes are, e.g., the genes encoding the green fluorescent protein, -galactosidase, neomycin-phosphoribosyltransferase, or other markers. The use of selection or marker cassettes simplifies the identification and isolation of the generated recombinant poxvirus. However, a recombinant poxvirus can also be identified by PCR technology. Subsequently, a further cell can be infected with the recombinant poxvirus obtained as described above and transfected with a second vector comprising a second foreign or heterologous gene or genes. If this gene should be introduced into a different insertion site of the poxviral genome, the second vector will also differ in the poxvirus-homologous sequences directing the integration of the second foreign gene or genes into the genome of the poxvirus. After homologous recombination has occurred, the recombinant virus comprising two or more foreign or heterologous genes can be isolated. For introducing additional foreign genes into the recombinant virus, the steps of infection and transfection can be repeated by using the recombinant virus isolated in previous steps for infection and by using a further vector comprising a further foreign gene or genes for transfection.
[0125] Alternatively, the steps of infection and transfection as described above are interchangeable, i.e., a suitable cell can at first be transfected by the plasmid vector comprising the foreign gene and then infected with the poxvirus. As a further alternative, it is also possible to introduce each foreign gene into different viruses, co-infect a cell with all the obtained recombinant viruses, and screen for a recombinant including all the desired foreign genes. A third alternative is ligation of the DNA genome and foreign sequences in vitro followed by reconstitution of the recombined vaccinia virus DNA genome using a helper virus. A fourth alternative is homologous recombination in E. coli or other host cell between a MVA virus genome cloned as a bacterial artificial chromosome (BAC) and a linear foreign sequence flanked with DNA sequences homologous to sequences flanking the desired site of integration in the MVA virus genome.
[0126] The one or more nucleic acids of the present disclosure may be inserted into any suitable part of the MVA virus or MVA viral vector to produce a recombinant MVA of the invention. Suitable parts of the MVA virus are non-essential parts of the MVA genome. Non-essential parts of the MVA genome may be intergenic regions or known deletion sites in the MVA genome. Alternatively, or additionally, non-essential parts of the recombinant MVA can be a coding region of the MVA genome which is non-essential for viral growth. Insertion sites are not restricted to these preferred insertion sites in the MVA genome, since it is within the scope of the present invention that the nucleic acids of the present invention (e.g., encoding a TAA, IL-12, and/or 4-1BBL) and any accompanying promoters as described herein may be inserted anywhere in the viral genome as long as it is possible to obtain recombinants that can be amplified and propagated in at least one cell culture system, such as Chicken Embryo Fibroblasts (CEF cells).
[0127] Preferably, the nucleic acids of the present invention may be inserted into one or more intergenic regions (IGR) of the MVA virus. The term intergenic region refers to those parts of the viral genome located between two adjacent open reading frames (ORF) of the MVA virus genome, preferably between two essential ORFs of the MVA virus genome. For recombinant MVAs of the invention, in certain embodiments, the IGR is selected from IGR 07/08, IGR 44/45, IGR 64/65, IGR 88/89, IGR 136/137, and IGR 148/149. For recombinant MVAs, the nucleotide sequences may, additionally or alternatively, be inserted into one or more of the known deletion sites, i.e., deletion sites I, II, III, IV, V, or VI of the MVA genome. The term known deletion site refers to those parts of the MVA genome that were deleted through continuous passaging on CEF cells characterized at passage 516 with respect to the genome of the parental virus from which the MVA is derived from, in particular the parental chorioallantois vaccinia virus Ankara (CVA), e.g., as described in Meisinger-Henschel et al. ((2007) J. Gen. Virol. 88: 3249-3259).
Vaccines
[0128] In certain embodiments, the recombinant MVA of the present disclosure can be formulated as part of a vaccine, or used to prepare a medicament that is a vaccine. For the preparation of vaccines, the MVA virus can be converted into a physiologically acceptable form.
[0129] An exemplary preparation follows. Purified virus is stored at 80 C. with a titer of 510.sup.8 TCID.sub.50/ml formulated in 10 mM Tris, 140 mM NaCl, pH 7.4. For the preparation of vaccine doses, e.g., 110.sup.8-110.sup.9 particles of the virus can be lyophilized in phosphate-buffered saline (PBS) in the presence of 2% peptone and 1% human albumin in an ampoule, preferably a glass ampoule. Alternatively, the vaccine doses or shots can be prepared by stepwise freeze-drying of the virus in a formulation. In certain embodiments, the formulation contains additional additives such as, for example, mannitol, dextran, sugar, glycine, lactose, polyvinylpyrrolidone, and optionally other additives, such as antioxidants or inert gas, stabilizers, or recombinant proteins (e.g. human serum albumin) suitable for in vivo administration. The ampoule is then sealed and can be stored at a suitable temperature, for example, between 4 C. and room temperature for several months. However, for long-term storage, the ampoule is stored preferably at temperatures below 20 C., most preferably at about 80 C.
[0130] In various embodiments involving vaccination or therapy, the lyophilisate is dissolved in 0.1 to 0.5 ml of an aqueous solution, preferably physiological saline or Tris buffer such as 10 mM Tris, 140 mM NaCl pH 7.7. It is contemplated that the recombinant MVA vaccine or pharmaceutical composition of the present disclosure can be formulated in solution in a concentration range of 10.sup.4 to 10.sup.10 TCID.sub.50/ml, 10.sup.5 to 510.sup.9 TCID.sub.50/ml, 10.sup.6 to 510.sup.9 TCID.sub.50/ml, or 10.sup.7 to 510.sup.9 TCID.sub.50/ml. A preferred dose for humans comprises between 10.sup.6 to 10.sup.10 TCID.sub.50, including a dose of 10.sup.6 TCID.sub.50, 10.sup.7 TCID.sub.50, 10.sup.8 TCID.sub.50, 510.sup.8 TCID.sub.50, 10.sup.9 TCID.sub.50, 510.sup.9 TCID.sub.50, or 10.sup.10 TCID.sub.50. Optimization of dose and number of administrations is within the ability and knowledge of one skilled in the art.
[0131] In one or more preferred embodiments, as set forth herein, the recombinant MVA or MVAs are administered to a cancer patient intratumorally. In other embodiments, the recombinant MVA or MVAs are administered to a cancer patient intraperitoneally. In other embodiments, the recombinant MVA or MVAs are administered to a cancer patient either intratumorally, intravenously, subcutaneously, and/or intraperitoneally at the same time or at different times.
[0132] Kits, Compositions, and Methods of Use. In various embodiments, the invention encompasses kits, pharmaceutical combinations, pharmaceutical compositions, and/or immunogenic combinations comprising one or more recombinant MVAs that include the nucleic acids described herein.
[0133] It is contemplated that a kit and/or composition of the invention can comprise one or multiple containers or vials of one or more recombinant poxviruses of the present disclosure together with instructions for the administration of the recombinant MVA or MVAs. It is contemplated that in a more particular embodiment, the kit can include instructions for administering the recombinant MVA(s) in a first priming administration and then administering one or more subsequent boosting administrations of the recombinant MVA(s) in a homologous or heterologous prime-boost regimen, as appropriate.
[0134] The kits and/or compositions provided herein may generally include one or more pharmaceutically acceptable and/or approved carriers, additives, antibiotics, preservatives, diluents and/or stabilizers. Such auxiliary substances can include water, saline solution, glycerol, ethanol, wetting or emulsifying agents, pH buffering substances, and the like. Suitable carriers are typically large, slowly-metabolized molecules such as proteins, polysaccharides, polylactic acids, polyglycolic acids, polymeric amino acids, amino acid copolymers, lipid aggregates, and the like.
[0135] Certain Exemplary Embodiments. Embodiment 1 is a recombinant modified Vaccinia Ankara (MVA) for use in stimulating an immune response to a Tumor Associated Antigen (TAA) in a subject, comprising: (a) a first nucleic acid encoding a tumor-associated antigen (TAA); and (b) a second nucleic acid encoding IL-12; wherein the intratumoral administration of the recombinant MVA increases and/or enhances an inflammatory response in a tumor, reduces the growth rate and/or size of the tumor, and/or increases overall survival of the subject as compared to a non-intratumoral injection of said recombinant MVA or an injection of a recombinant MVA that does not comprise a nucleic acid encoding IL-12, wherein the MVA is administered intratumorally.
[0136] Embodiment 2 is a recombinant MVA for use according to embodiment 1, further comprising (c) a third nucleic acid encoding 4-1BBL.
[0137] Embodiment 3 is a recombinant MVA for use according to embodiment 1, wherein said TAA is an endogenous retroviral (ERV) protein.
[0138] Embodiment 4 is a recombinant MVA for use according to embodiment 1, wherein said TAA is selected from the group consisting of carcinoembryonic antigen (CEA), mucin 1 cell surface associated (MUC-1), prostatic acid phosphatase (PAP), prostate specific antigen (PSA), human epidermal growth factor receptor 2 (HER-2), survivin, tyrosine related protein 1 (TRP1), tyrosine related protein 1 (TRP2), Brachyury, FOLR1, PRAME, HERV-K-env, HERV-K-gag, and combinations thereof.
[0139] Embodiment 5 is a recombinant MVA for use in the treatment of tumors, comprising: (a) a first nucleic acid encoding a tumor-associated antigen (TAA); and (b) a second nucleic acid encoding IL-12; wherein the intratumoral administration of the recombinant MVA enhances an inflammatory response in a tumor, reduces the growth rate and/or size of the tumor, and/or increases overall survival of the subject as compared to a non-intratumoral injection of said recombinant MVA or an injection of a recombinant MVA that does not comprise a nucleic acid encoding IL-12; wherein the TAA is an endogenous retroviral (ERV) protein; and wherein the MVA is administered intratumorally.
[0140] Embodiment 6 is a recombinant MVA for use according to embodiment 5, wherein the TAA is selected from the group consisting of carcinoembryonic antigen (CEA), mucin 1 cell surface associated (MUC-1), prostatic acid phosphatase (PAP), prostate specific antigen (PSA), human epidermal growth factor receptor 2 (HER-2), survivin, tyrosine related protein 1 (TRP1), tyrosine related protein 2 (TRP2), Brachyury, FOLR1, PRAME, HERV-K-env, HERV-K-gag, and combinations thereof.
[0141] Embodiment 7 is a pharmaceutical combination comprising: (i) a recombinant modified Vaccinia Ankara (MVA), comprising: (a) a first nucleic acid encoding a tumor-associated antigen (TAA); and (b) a second nucleic acid encoding IL-12; wherein the intratumoral administration of the recombinant MVA enhances an inflammatory response in a tumor, reduces the growth rate and/or size of the tumor, and/or increases overall survival of the subject as compared to a non-intratumoral injection of said recombinant MVA or an injection of a recombinant MVA that does not comprise a nucleic acid encoding IL-12; and (ii) a pharmaceutically acceptable carrier.
[0142] Embodiment 8 is a pharmaceutical combination comprising embodiment 7 and a recombinant MVA comprising: (a) a first nucleic acid encoding a tumor-associated antigen (TAA); and (b) a second nucleic acid encoding 4-1BBL, wherein said TAA can be the same TAA as recited in embodiment 7 or can be a different TAA.
[0143] Embodiment 9 is a pharmaceutical combination according to embodiment 8, wherein said second recombinant MVA comprises a first nucleic acid encoding a TAA that is a different TAA than the one encoded by the recombinant MVA of claim 1.
[0144] Embodiment 10 is a method for reducing tumor growth and/or increasing survival in a subject having a cancerous tumor, the method comprising intratumorally administering to the subject a recombinant modified Vaccinia virus Ankara (MVA) comprising a first nucleic acid encoding a tumor-associated antigen (TAA) and a second nucleic acid encoding IL-12 and optionally a third nucleic acid encoding 4-1BBL, wherein the intratumoral administration of the recombinant MVA enhances an inflammatory response in the tumor, decreases tumor growth and/or size, and/or increases overall survival of the subject as compared to injection of a recombinant MVA that does not comprise a nucleic acid encoding IL-12 or MVA alone.
[0145] Embodiment 11 is a method according to embodiment 10, wherein the TAA is selected from the group consisting of carcinoembryonic antigen (CEA), mucin 1 cell surface associated (MUC-1), prostatic acid phosphatase (PAP), prostate specific antigen (PSA), human epidermal growth factor receptor 2 (HER-2), survivin, tyrosine related protein 1 (TRP1), tyrosine related protein 1 (TRP2), Brachyury, PRAME, FOLR1, HERV-K-env, HERV-K-gag, and combinations thereof.
[0146] Embodiment 12 is a method according to embodiment 10, wherein said MVA comprises a first nucleic acid encoding a tumor-associated antigen (TAA) and a second nucleic acid encoding IL-12, and wherein the method further comprises intratumorally administering to said subject a recombinant MVA comprising a first nucleic acid encoding a tumor-associated antigen (TAA) and a second nucleic acid encoding 4-1BBL, wherein said TAA may be the same TAA recited in claim 10 or may be a different TAA.
[0147] Embodiment 13 is a method according to embodiment 10, wherein the subject is a human cancer patient.
[0148] Embodiment 14 is a method for reducing tumor size or growth and/or increasing survival in a subject having an tumor, the method comprising intraperitoneally administering to the subject a recombinant modified Vaccinia Ankara (MVA) comprising a first nucleic acid encoding IL-12 and optionally a second nucleic acid encoding a tumor-associated antigen (TAA), wherein the administration of the recombinant MVA enhances Natural Killer (NK) cell response and enhances CD8 T cell responses specific to the TAA as compared to baseline levels prior to treatment or as compared to the expected result of injection with MVA alone.
[0149] Embodiment 15 is the method is according to embodiment 14, wherein the TAA is selected from the group consisting of carcinoembryonic antigen (CEA), mucin 1 cell surface associated (MUC-1), prostatic acid phosphatase (PAP), prostate specific antigen (PSA), human epidermal growth factor receptor 2 (HER-2), survivin, tyrosine related protein 1 (TRP1), tyrosine related protein 1 (TRP2), Brachyury, PRAME, FOLR1, HERV-K-env, HERV-K-gag, and combinations thereof.
[0150] Embodiment 16 is a method according to embodiment 14, wherein the subject is human and the tumor is intraperitoneal.
[0151] Embodiment 17 is a method according to embodiment 14, further comprising intratumorally administering to said subject a recombinant MVA comprising a first nucleic acid encoding a tumor-associated antigen (TAA) and a second nucleic acid encoding 4-1BBL, wherein said TAA may be the same TAA as embodiment 14 or may be a different TAA.
[0152] Embodiment 18 is a method of inducing an enhanced inflammatory response in a peritoneal tumor of a subject, the method comprising intraperitoneally administering to the subject a recombinant modified Vaccinia Ankara (MVA) comprising a first nucleic acid encoding IL-12 or IL-12sc and optionally a second nucleic acid encoding a heterologous tumor-associated antigen (TAA), wherein the intraperitoneal administration of the recombinant MVA generates an enhanced inflammatory response in the tumor as compared to an inflammatory response that would be generated by a non-intraperitoneal injection of a recombinant MVA virus alone.
[0153] Embodiment 19 is a method according to embodiment 18, further comprising administering to the subject a recombinant MVA comprising a first nucleic acid encoding a first heterologous tumor-associated antigen (TAA) and a second nucleic acid encoding 4-1BBL.
[0154] Embodiment 20 is a method according to embodiment 18, further comprising intraperitoneally administering to the subject a boosting dose of the same recombinant modified Vaccinia Ankara (MVA).
[0155] Embodiment 21 is a vaccine comprising any of embodiments 1-6 and a pharmaceutically acceptable carrier.
[0156] Embodiment 22 is a recombinant MVA according to any one of embodiments 1-6, a vaccine according to embodiment 21, or a pharmaceutical combination according to any one of embodiments 7-9, for use in reducing tumor size and/or increasing survival in a subject having a cancerous tumor.
[0157] Embodiment 23 is a recombinant MVA according to any one of embodiments 1-6, a vaccine according to embodiment 21, or a pharmaceutical combination according to any one of embodiments 7-9, for use in a method for reducing tumor size and/or increasing survival in a subject having a cancerous tumor, the method comprising intratumorally or intraperitoneally administering to the subject said recombinant MVA, vaccine, or pharmaceutical combination, wherein the intratumoral or intraperitoneal administration enhances an inflammatory response in the cancerous tumor, decreases tumor growth rate, increases tumor reduction, and/or increases overall survival of the subject as compared to injection of MVA alone.
[0158] Embodiment 24 is a recombinant MVA according to any one of embodiments 1-6, a vaccine according to embodiment 21, or a pharmaceutical combination according to any one of embodiments 7-9, for use in a method for stimulating an immune response in a subject, the method comprising intratumorally or intraperitoneally administering to the subject said recombinant MVA, vaccine, or pharmaceutical combination, wherein the intratumoral or intraperitoneal administration enhances an inflammatory response in the cancerous tumor that is detectable by analysis of the tumor or by analysis of blood or sera of the subject as compared to administration of MVA alone or as compared to a non-intratumoral or non-intraperitoneal administration of said recombinant MVA, or as compared to an intratumoral or intraperitoneal administration of a recombinant MVA lacking one or more of the components encoded by said recombinant MVA.
[0159] Embodiment 25 is a recombinant MVA according to any one embodiments 1-6, a vaccine according to embodiment 21, or a pharmaceutical combination according to any one of embodiments 7-9 for use in a method for treating cancer in subject.
[0160] Embodiment 26 is a recombinant MVA according to any one of embodiments 1-6, a vaccine according to embodiment 21, or a pharmaceutical combination according to any one of embodiments 7-9 for use in a method for treating cancer, wherein the cancer is selected from the group consisting of: breast cancer, lung cancer, head and neck cancer, thyroid, melanoma, gastric cancer, bladder cancer, kidney cancer, liver cancer, melanoma, pancreatic cancer, prostate cancer, ovarian cancer, urothelial, cervical, or colorectal cancer.
[0161] Embodiment 27 is a recombinant MVA according to any one of embodiments 1-6, wherein the enhanced inflammatory response is localized to the tumor.
[0162] Embodiment 28 is a method of inducing an enhanced inflammatory response in a peritoneal tumor of a subject, the method comprising intratumorally administering to the subject a recombinant modified Vaccinia Ankara (MVA) comprising a first nucleic acid encoding a first heterologous tumor-associated antigen (TAA) and a second nucleic acid encoding IL-12 or IL-12sc, wherein the intratumoral administration of the recombinant MVA generates an enhanced inflammatory response in the tumor as compared to an inflammatory response that would be generated by or would be expected to result from intratumoral injection of MVA virus alone.
[0163] Embodiment 29 is a method according to embodiment 28, wherein the MVA further comprises a nucleic acid encoding 4-1BBL.
[0164] Embodiment 30 is a recombinant modified Vaccinia Ankara (MVA), comprising: (a) a first nucleic acid encoding a tumor-associated antigen (TAA); and (b) a second nucleic acid encoding IL-12; wherein the intratumoral administration of the recombinant MVA enhances an inflammatory response in a tumor, reduces the growth rate and/or size of the tumor, and/or increases overall survival of the subject as compared to a non-intratumoral injection of said recombinant MVA or an injection of a recombinant MVA that does not comprise a nucleic acid encoding IL-12.
[0165] Embodiment 31 is the recombinant MVA of embodiment 30, further comprising (c) a third nucleic acid encoding 4-1BBL.
[0166] Embodiment 32 is the recombinant MVA of embodiment 30, wherein said TAA is an endogenous retroviral (ERV) protein.
[0167] Embodiment 33 is the recombinant MVA of embodiment 30, wherein said TAA is selected from the group consisting of carcinoembryonic antigen (CEA), mucin 1 cell surface associated (MUC-1), prostatic acid phosphatase (PAP), prostate specific antigen (PSA), human epidermal growth factor receptor 2 (HER-2), survivin, tyrosine related protein 1 (TRP1), tyrosine related protein 1 (TRP2), Brachyury, FOLR1, PRAME, HERV-K-env, HERV-K-gag, p15, and combinations thereof.
[0168] Embodiment 34 is a pharmaceutical combination comprising the recombinant MVA according to embodiment 30 and a pharmaceutically acceptable carrier.
[0169] Embodiment 35 is a pharmaceutical combination comprising the recombinant MVA according to embodiment 30 and a recombinant MVA comprising: (a) a first nucleic acid encoding a tumor-associated antigen (TAA); and (b) a second nucleic acid encoding 4-1BBL, wherein said TAA can be the same TAA as recited in claim 1 or can be a different TAA.
[0170] Embodiment 36 is a pharmaceutical combination according to embodiment 30, wherein said second recombinant MVA comprises a first nucleic acid encoding a TAA that is a different TAA than the one encoded by the recombinant MVA of embodiment 30.
[0171] Embodiment 37 is a method of stimulating an immune response in a subject having a plurality of tumors, comprising a step of locally (intratumorally) administering to fewer than all of the tumors in said subject a recombinant MVA comprising at least one first nucleic acid encoding a TAA and a second nucleic acid encoding IL-12, wherein an immune response to the TAA is stimulated in the subject.
[0172] Embodiment 38 is a method of treating a subject having at least one inaccessible tumor and at least one accessible tumor, comprising locally (intratumorally) administering to at least one accessible tumor in the subject a recombinant MVA comprising at least one first nucleic acid encoding a TAA and a second nucleic acid encoding 4-1-BBL, whereby the growth of the inaccessible tumor is decreased or stopped.
[0173] Embodiment 39 is a method of preventing or decreasing the extent of tumor recurrence or metastasis in a subject having at least one tumor, comprising intratumorally or intraperitoneally administering to at least one tumor in the subject a recombinant MVA comprising at least one first nucleic acid encoding IL-12 and optionally a second nucleic acid encoding a TAA, whereby the growth of the inaccessible tumor is decreased or stopped.
[0174] Embodiment 40 is the method of embodiment 37, 38, or 39, wherein said recombinant MVA further comprises a nucleic acid encoding 4-1BBL.
[0175] Embodiment 41 is a recombinant modified Vaccinia Ankara (MVA) for use in stimulating an immune response to a Tumor Associated Antigen (TAA) in a subject, comprising: (a) a first nucleic acid encoding IL-12, for example, scIL-12; and (b) a second nucleic acid encoding a TAA; wherein the intraperitoneal administration of the recombinant MVA enhances or increases an inflammatory response in a tumor, reduces the growth rate and/or size of the tumor, and/or increases overall survival of the subject as compared to a non-intraperitoneal injection of said recombinant MVA or an injection of a recombinant MVA that does not comprise a nucleic acid encoding IL-12, wherein the MVA is administered intraperitoneally.
[0176] Embodiment 42 is a recombinant MVA for use according to embodiment 41, further comprising (c) a third nucleic acid encoding 4-1BBL.
[0177] Embodiment 43 is a recombinant MVA for use according to embodiment 41, wherein said TAA is an endogenous retroviral (ERV) protein.
[0178] Embodiment 44 is a recombinant MVA for use according to embodiment 41, wherein said TAA is selected from the group consisting of carcinoembryonic antigen (CEA), mucin 1 cell surface associated (MUC-1), prostatic acid phosphatase (PAP), prostate specific antigen (PSA), human epidermal growth factor receptor 2 (HER-2), survivin, tyrosine related protein 1 (TRP1), tyrosine related protein 1 (TRP2), Brachyury, FOLR1, PRAME, HERV-K-env, HERV-K-gag, and combinations thereof.
[0179] Embodiment 45 is a recombinant MVA for use in the treatment of tumors, comprising: (a) a first nucleic acid encoding a tumor-associated antigen (TAA); and (b) a second nucleic acid encoding IL-12; wherein the intratumoral administration of the recombinant MVA enhances and/or increases an inflammatory response in a tumor, reduces the growth rate and/or size of the tumor, and/or increases overall survival of the subject as compared to a non-intratumoral injection of said recombinant MVA or an injection of a recombinant MVA that does not comprise a nucleic acid encoding IL-12; wherein the TAA is an endogenous retroviral (ERV) protein; and wherein the MVA is administered intratumorally.
[0180] Embodiment 46 is a recombinant MVA for use according to embodiment 45, wherein the TAA is selected from the group consisting of carcinoembryonic antigen (CEA), mucin 1 cell surface associated (MUC-1), prostatic acid phosphatase (PAP), prostate specific antigen (PSA), human epidermal growth factor receptor 2 (HER-2), survivin, tyrosine related protein 1 (TRP1), tyrosine related protein 2 (TRP2), Brachyury, FOLR1, PRAME, HERV-K-env, HERV-K-gag, and combinations thereof.
[0181] Embodiment 47 is a pharmaceutical combination comprising: (i) a recombinant modified Vaccinia Ankara (MVA), comprising: (a) a first nucleic acid encoding a tumor-associated antigen (TAA); and (b) a second nucleic acid encoding IL-12; wherein the intratumoral administration of the recombinant MVA enhances and/or increases an inflammatory response in a tumor, reduces the growth rate and/or size of the tumor, and/or increases overall survival of the subject as compared to a non-intratumoral injection of said recombinant MVA or an injection of a recombinant MVA that does not comprise a nucleic acid encoding IL-12; and (ii) a pharmaceutically acceptable carrier.
[0182] Embodiment 48 is a pharmaceutical combination comprising embodiment 7 and a recombinant MVA comprising: (a) a first nucleic acid encoding a tumor-associated antigen (TAA); and (b) a second nucleic acid encoding 4-1BBL, wherein said TAA can be the same TAA as recited in embodiment 47 or can be a different TAA.
[0183] Embodiment 49 is a pharmaceutical combination according to embodiment 48, wherein said second recombinant MVA comprises a first nucleic acid encoding a TAA that is a different TAA than the one encoded by the recombinant MVA of claim 41.
[0184] Embodiment 50 is a recombinant modified Vaccinia Ankara (MVA) for use in stimulating an immune response to a Tumor Associated Antigen (TAA) in a subject, comprising a nucleic acid encoding IL-12; wherein the intraperitoneal administration of the recombinant MVA increases an inflammatory response in a tumor, optionally a peritoneal tumor, and/or in the omentum, reduces the growth rate and/or size of the tumor, and/or increases overall survival of the subject as compared to a non-intraperitoneal injection of said recombinant MVA or an injection of a recombinant MVA that does not comprise a nucleic acid encoding IL-12, wherein the MVA is administered intraperitoneally.
EXAMPLES
[0185] The following examples illustrate the invention but should not be construed as in any way limiting the scope of the claims.
Example 1: Construction of Recombinant MVAs
[0186] Schematic diagrams of the recombinant MVAs used in the experiments described herein are shown in
[0187] Recombinant MVAs encoding IL-12 (e.g., MVA-mIL12sc, encoding murine single chain IL-12), the model antigen OVA and IL-12 (MVA-OVA-mIL12sc) or the endogenous retroviral antigen Gp70 and IL12 (MVA-Gp70-mIL12sc) were produced (schematic diagrams of exemplary recombinant MVAs shown in
[0188] Generation of recombinant MVA viruses that embody elements of the present disclosure was done by insertion of the indicated transgenes with their promoters into the vector MVA-BN, essentially as described previously.
[0189] MVA-mBNbc449 is a non-replicative, recombinant MVA encoding IL-12 without a tumor-associated antigen (diagrammed in
Example 2: Systemic Inflammation Induced by Intratumoral Injection of Recombinant MVA Encoding IL-12
[0190] Local MVA-Gp70-IL12 injection results in systemic inflammation (see
[0191] MVA-Gp70-IL12 response was titered in vivo by assessing the results of these intratumoral injections into the established B16.F10 melanomas. In contrast to membrane bound 4-1BBL, IL12sc is a soluble cytokine that is secreted upon expression. Mice were bled 6 hours after the first IT immunization and sera was analyzed for cytokine and chemokine expression (data shown in
Example 3: Recombinant MVAs Expressing IL-12 Control Tumor Growth Following Intratumoral Injection
[0192] Mice were injected with recombinant MVAs encoding the model antigen gp70 or recombinant MVAs encoding both the model antigen gp70 and IL-12 (
[0193] Notably, two of the five mice that received 510.sup.7 TCID.sub.50 MVA-Gp70-IL12 by IT injection cleared the B16.F10 tumors (
Example 4: Combined Treatment with Recombinant MVAs Expressing IL-12 and 4-1BBL Provide Improved Control of Tumor Growth Following Intratumoral Injection
[0194] C57BL/6 mice were inoculated subcutaneously with 510.sup.5 B16.F10 cells. When tumors were above 60 mm.sup.3 in volume, mice were grouped and injected intratumorally (IT) with either saline, MVA-Gp70, MVA-Gp70-IL12, or both MVA-Gp70-IL12 and MVA-Gp70-4-1BBL at a dose of 510.sup.7 TCID.sub.5O (i.e., a combination treatment; day of injection=Day 0). For the combination treatment, the injections comprised a 1:1 mix of MVA-Gp70-IL12sc with MVA-Gp70-4-1BBL. Mice received subsequent (boost) IT immunizations at days 5 and 8 (
[0195] As observed in earlier experiments, repeated injection IT with MVA-Gp70-IL12 induced tumor growth control and rejection of 2 out of 5 B16.F10 melanomas (
Example 5: Treatment with Recombinant MVAs Expressing IL-12 or Combined with Recombinant MVAs Expressing 4-1BBL Induced Rejection of Colon Carcinomas
[0196] Results presented in
[0197] As shown in
Example 6: Recombinant MVAs Encoding IL-12 Alone or in Combination with Recombinant MVAs Encoding 4-1BBL can Control Growth of Injected Tumors and Uninjected Tumors in the Same Subject
[0198] C57BL/6 mice were inoculated subcutaneously with 510.sup.5 MC38 cells on the right flank and 210.sup.5 on the left flank to produce mice with bilateral tumors. When right flank tumors were above 60 mm.sup.3 in volume, mice were grouped and injected intratumorally (IT) with either saline, MVA-Gp70, MVA-Gp70-4-1BBL, MVA-Gp70-IL12 or a combination of recombinant MVAs encoding 4-1BBL and recombinant MVAs encoding IL-12. All viruses and combinations were used at a TCID.sub.50 of 510.sup.7. Mice received boost IT immunizations at days 5 and 8 (
[0199] Results (presented in
Example 7: Recombinant MVAs Encoding IL-12 Alone or in Combination with Recombinant MVAs Produced Rejection of Tumors on Rechallenge of Cured Mice
[0200] Nave C57BL/6 mice and C57BL/6 mice that were cured of MC38 tumors following treatment with MVA-gp70-IL-12 alone or in combination with MVA-gp70-4-1BBL were rechallenged with MC38 tumor cells in the flank opposite to the one in which the primary tumor was placed. Tumor growth was measured at regular intervals. Results presented in
[0201] Interestingly, no differences in efficacy with regard to tumor occurrence were found between recombinant MVA encoding IL-12 and the combination of recombinant MVAs expressing IL-12 and 4-1BBL (
Example 8: Treatment with MVA-IL12 Induces Adaptive-Specific Immune Responses Against MC38 Colorectal Peritoneal Carcinomatosis
[0202] C57BL/6 mice (n=4) were challenged intraperitoneally (i.p.) with 510.sup.5 MC38 tumor cells. After seven days, subjects were treated i.p. with a single dose of 510.sup.7 TCID.sub.50 (200 l volume) of MVA alone (MVA-BN) as a control or recombinant MVA encoding IL-12 (MVA-IL-12). Seven days after injection, specific immune responses against MC38 tumor were analyzed. Mice were sacrificed humanely and the spleens were processed to isolate cells. An ELISpot assay was used to determine the number of T lymphocytes that produced IFN- in response to the endogenous retroviral p15E antigen expressed by the tumor cells and also against the MC38 tumor cells themselves. 510.sup.5 cells were incubated for 24 hours with either tumor-associated peptide KSPWFTTL (for stimulation of mouse MC38-specific CD8.sup.+ T cells), irradiated MC38 tumor cells (510.sup.4 cells, treated with 20,000 rads), or without antigen as a non-specific response. The frequency of number of IFN- specific spot forming cells (SFC) per 510.sup.5 cells was determined (
[0203] Although treatment with MVA alone did not increase the number of tumor-specific lymphocytes, administration of the MVA-IL-12 induced a high number of T lymphocytes specific to the tumor-associated antigen or against MC38 cells (
Example 9: Intraperitoneal Treatment with Recombinant MVA Encoding IL-12 Cured all Tested Mice Bearing MC38 Peritoneal Carcinomatosis and Provided Complete Protection after Tumor Rechallenge
[0204] C57BL/6 mice (6 per group) were challenged i.p. with 510.sup.5 MC38 tumor cells as described above in Example 8. After seven days, mice were treated by intraperitoneal injection with a single dose of MVA alone (510.sup.7 TCID.sub.50 in 200 l volume) or recombinant MVA encoding IL-12; a third group was an untreated control. Survival was monitored daily The potent immune responses demonstrated in Example 8 were associated with strong antitumor responses that could be observed on Day 14 by the absence of hemorrhagic ascites and the lack of macroscopical tumor nodules in the peritoneum of mice treated with MVA-IL-12. Long-term follow-up of mice revealed large differences in survival as a function of treatment. PBS-treated mice (control group) died on day 30, control MVA-treated mice treated with MVA had a slight delay that was not significant, while all mice treated with the therapeutic vector eliminated tumor cells and survived 100% (
[0205] To evaluate whether locoregional treatment elicited a systemic memory response, surviving mice that rejected MC38 peritoneal carcinomatosis after treatment with MVA.scIL-12 (i.e., MVA-IL-12) treatment (survivors, n=6) were rechallenged intraperitoneally (i.p.) with 510.sup.5 MC38 tumor cells. A nave group was included as control group (n=5), and survival was monitored daily. All mice that had previously rejected the MC38 cell line rejected the rechallenge and survived until the end of the experiment. In contrast, the untreated control animals succumbed due to intraperitoneal tumor progression on day 40 (
[0206] To interrogate immune cells involved in the antitumor effect, depleting monoclonal antibodies against CD8 T lymphocytes or NK cells were used concomitantly with MVA-IL-12 (
Example 10: Injection of MVA-scIL12 Intraperitoneally is More Effective and Less Toxic than Intravenous Injection for Treating Peritoneal Carcinomatosis
[0207] Locoregional (i.p.) administration has different drawbacks, and its use must be clearly beneficial to the patient. Therefore, we compared this route of administration with the most common route of virus administration: intravenous (i.v.) injection.
[0208] C57BL/6 mice (6 per group) were challenged intraperitoneally (i.p.) with 510.sup.5 MC38 tumor cells. After seven days, subjects were treated with a single dose of MVA alone by i.p. injection (510.sup.7 TC.sub.ID50 in 200 d volume), MVA-scIL-12 by i.p. injection, or MVA-scIL-12 by i.v. injection. Weight (in grams) was measured daily for up to 10 days following MVA administration (
[0209] Other effects of i.v. administration of MVA included hematologic toxicity, as reflected by reduced numbers 24 h and 72 h after administration in comparison to i.p. administration (
Example 11: MVA.scIL-12 Dose Escalation Improves Antitumor Effectiveness in Aggressive Models of Peritoneal Carcinomatosis
[0210] To confirm our results in other models of peritoneal carcinomatosis, mice were implanted intraperitoneally with CT26 colon cancer cells (210.sup.5 cells) or ID8.Vegf/GFP ovarian cancer cells (110.sup.6 cells) (=Day 0). In the group implanted with CT26 cells, mice were then intraperitoneally inoculated on Day 7 with 510.sup.7 TCID.sub.50 of MVA or MVA-IL-12. In the group implanted with ID8.Vegf/GFP cells, mice were then intraperitoneally inoculated on Day 5 with 510.sup.7 TCID.sub.50 of MVA or MVA-IL-12. Survival was then monitored and is shown in
[0211] Additional experiments were then conducted in which groups of mice were inoculated with CT26 and ID8.Vegf/GFP cells as above, but each group was then inoculated 3 times with doses of MVA or MVA-IL-12 (on days 7, 10, and 13 for the CT26 group and on days 5, 8, and 11 for the ID8.Vegf/GFP group; survival was monitored and is shown in
Example 12: Locoregional (i.p.) Administration of MVA.scIL-12 Provides a Superior Antitumor Effect Over Intratumoral Administration
[0212] Experiments were conducted to compare the intraperitoneal (i.p.) and intravenous (i.v.) routes to the intratumoral (i.t.) route. Mice were injected subcutaneously (s.c.) with MC38 cells (510.sup.5 cells); 7 days later, MVA-IL-12 was administered to subjects intratumorally. This treatment had a significant effect on tumor growth, delaying the death of all mice and achieving a cure rate of approximately 30% (
[0213] To further compare these routes of administration, experiments were designed to compare their local and systemic effects (
[0214] As previously described, mice that eradicated the tumor in the peritoneum after i.p. treatment with MVA-IL-12 were able to eliminate MC38 cells injected subcutaneously in a rechallenge (
[0215] To investigate the ability of a tumor in the peritoneum to initiate a systemic immune response, we generated an MVA vector that encoded both scIL-12 and the tumor-associated antigen gp70 (MVA-gp70-IL-12, e.g., the recombinant MVA-mBNbc447 diagrammed in
Example 13: Intraperitoneally Administered MVA Localizes in the Omentum
[0216] To further understand the reason for the superiority of the i.p. route of administration, we characterized the main transduced organs using an MVA encoding luciferase (Luc) after i.v. or i.p. administration in mice. The expression kinetics of MVA expressing luciferase (MVA-Luc) were similar to those of MVA-IL-12. Maximum luciferase expression was detected 6 h after i.p. administration and returned to baseline levels 72 h later (
[0217] These luminescence results were confirmed and extended using intravital microscopy to assess the effects of i.p. injection of MVA-IL-12 on the omenta of mice bearing ID8.Vegf/GFP tumors. hCD2RFP transgenic mice injected with ID8.Vegf/GFP tumor cells were examined by intravitral microscopy, which showed that the tumor cells localized in the omentum, mostly in the vicinity of fat-associated lymphoid clusters (FALCs), and increased in number and size over time.
[0218] The capacity of MVA to infect the omentum was also assessed using transcriptomic analysis of omenta from mice treated with MVA or MVA-IL-12. No significant differences were observed between mice infected with MVA and MVA-IL-12, suggesting that IL-12 expression does not affect virus infection. However, the expression of this proinflammatory cytokine impacted multiple cellular processes and modulated the expression of genes involved in immune responses. Administration of MVA-IL-12 induced a different transcriptomic profile than MVA (
Example 14: Dose-Dependent Effects of Intratumoral Administration of MVA-Gp70-4-1BBL-IL12 in B16.F10 Melanoma-Bearing Mice
[0219] Treatment with recombinant MVA expressing a tumor-associated antigen (TAA) together with IL-12 and 4-1BBL (MVA-mBNbc491 (see
[0220] Data showed that multiple i.t. administrations of MVA-Gp70-4-1BBL-IL12 were effective in inducing an anti-tumorigenic response, even at decreased doses. Low and medium doses of this recombinant MVA produced temporary tumor growth control and/or elimination of tumors. The strongest anti-tumorigenic effect was observed with the highest dose level, which resulted in complete elimination of tumors in four out of five mice and enhanced survival rate (
[0221] Peripheral blood CD8+ T cell responses were examined four days after the last i.t. injection. Since all PBS-treated control mice were sacrificed at this time point due to aggressive tumor growth, no PBS control group was available for this analysis. No significant difference was observed between groups for total CD8+ T cell percentage. Importantly, MVA-Gp70-4-1BBL-IL12 induced CD44+ IFN expressing CD8+ T cells upon p15E peptide restimulation in a dose dependent manner (
Example 15: Intratumoral (i.t.) Administration of MVA-Gp70-4-1BBL-1L12 Induces a Systemic Tumor-Specific Immune Response in B16.F10 Bilateral-Tumor-Bearing Mice
[0222] Experiments demonstrated that intratumoral injection of MVA-Gp70-4-1BBL-IL-12 induced a systemic anti-tumorigenic immune response in B16.F10 tumor bearing mice, which resulted in the control of both injected and uninjected distant tumors in the same animal.
[0223] C57BL/6 mice were inoculated subcutaneously with 510.sup.5 and 210.sup.5 B16.F10 cells into the right and left flank, respectively (
[0224] Injection of PBS intratumorally did not result in tumor growth control on either of the treated or the untreated tumor, as expected, (
Example 16: Systemic Anti-Tumor Effect is Induced by Intratumoral Administration of MVA-Gp70-4-1BBL-1L12 and does not Depend on NK Cells
[0225] C57BL/6 mice were inoculated subcutaneously (s.c.) with 510.sup.5 and 210.sup.5 MC38 tumor cells into the right and left flank, respectively (
[0226] Injection of PBS i.t. did not result in tumor growth control of either treated nor untreated tumors, whereas NK cell depletion accelerated tumor growth (
Example 17: Repetitive Local Administration of MVA-Gp70-4-1BBL-1L12 Induced a Strong Tumor-Specific Immune Response, which is Partly Dependent on CD8.SUP.+ Cells
[0227] Anti-tumor effect induced by intratumoral MVA-Gp70-4-1BBL-IL12 administration is partly dependent on CD8+ T cells in the MC38 colon cancer tumor model. 510.sup.5 MC38 cells were subcutaneously (s.c.) injected into the right flank of mice. Mice were grouped when tumors were around 50 mm.sup.3 in volume, and they received i.p. injections of either anti-CD8 antibody or its isotype control IgG2b. After one day, mice received either PBS or 510.sup.7 TCID.sub.50 of MVA-Gp70-4-1BBL-IL12 via i.t. injection of the tumor; this day was designated Day 0. Mice received additional (boost) i.t. immunizations on Days 6 and 10 (vertical dotted lines on the graphs). Antibody or isotype injections were performed in every 3-4 days for in total 35 days. Tumors were measured at regular intervals and the number of cured mice is shown (lower right corner of panels). The efficacy of CD8.sup.+ T cell depletion was shown five days after the first 1.sup.4 i.p. injection (
[0228] Results showed that injection of PBS did not induce tumor growth control either in CD8.sup.+ T cell sufficient or in depleted mice (
Example 18: MVA-TAA-4-1BBL-IL12 Cured Mice are Resistant to Systemic Tumor Rechallenge
[0229] C57BL/6 mice that were cured of MC38 tumors following repetitive i.t. injection of MVA-Gp70-4-1BBL-IL12 were rechallenged with the same tumor cell line. Mice were subcutaneously (s.c.) injected with 510.sup.5 MC38 cells, and tumor growth was measured at regular intervals. Nave C57BL/6 mice were used as control for tumor growth. While all nave mice grew tumors, previously cured mice showed sporadic tumor growth but eventually eliminated all of these tumors, showing that previous i.t. injection of MVA-TAA-4-1BBL-IL12 was effective to induce tumor-specific memory response in treated mice (
[0230] It will be apparent that the precise details of the methods or compositions described herein may be varied or modified without departing from the spirit of the described invention. We claim all such modifications and variations that fall within the scope and spirit of the claims below.
SEQUENCE LISTING
[0231] The nucleic and amino acid sequences listed below are shown using standard letter abbreviations for nucleotide bases, and either one letter code or three letter code for amino acids, as defined in 37 C.F.R. 1.822. Only one strand of each nucleic acid sequence is shown, but the complementary strand is understood as included by any reference to the displayed strand.
TABLE-US-00001 Relevantsequences: SEQIDNO:1,mousesinglechainIL-12nucleotidesequence ((sc)-mIL-12p40p35)=recombinantmurinesingle-chain IL-12withp40andp35subunitsencoded) ATGTGCCCTCAGAAGCTGACCATCAGTTGGTTCGCCATCGTGCTGCTGGTGTCCCCA CTGATGGCTATGTGGGAACTCGAGAAGGACGTGTACGTGGTGGAAGTGGACTGGAC CCCTGATGCTCCTGGCGAGACAGTGAACCTGACCTGCGACACACCTGAAGAGGACG ACATCACCTGGACCAGCGATCAGAGACACGGCGTGATCGGCTCTGGCAAGACCCTG ACAATTACCGTGAAAGAGTTCCTGGACGCCGGCCAGTACACCTGTCACAAAGGCGG AGAGACACTGAGCCACTCTCATCTGCTGCTGCACAAGAAAGAGAACGGCATCTGGT CCACCGAGATCCTGAAGAACTTCAAGAACAAGACCTTCCTGAAGTGCGAGGCCCCT AACTACAGCGGCAGATTCACCTGTAGCTGGCTGGTGCAGAGAAACATGGACCTGAA GTTCAACATCAAGTCCTCCAGCAGCAGCCCCGACAGCAGAGCTGTGACATGTGGCA TGGCTAGCCTGAGCGCCGAGAAAGTGACACTGGACCAGAGAGACTACGAGAAGTAC AGCGTGTCCTGCCAAGAGGACGTGACCTGTCCTACCGCCGAGGAAACACTGCCTAT CGAGCTGGCCCTGGAAGCCAGACAGCAGAACAAATACGAGAACTACTCTACCAGCT TCTTCATCCGGGACATCATCAAGCCCGATCCTCCAAAGAACCTGCAGATGAAGCCTC TGAAGAACAGCCAGGTCGAGGTGTCCTGGGAGTACCCTGACAGCTGGTCTACCCCT CACAGCTACTTCAGCCTGAAATTCTTCGTGCGGATCCAGCGCAAGAAAGAAAAGAT GAAGGAAACCGAGGAAGGCTGCAACCAGAAAGGCGCTTTCCTGGTGGAAAAGACC AGCACCGAGGTGCAGTGCAAAGGCGGCAATGTCTGTGTGCAGGCCCAGGACCGGTA CTACAACAGCAGCTGTAGCAAGTGGGCCTGCGTGCCATGCAGAGTCAGATCTGGTG GCGGAGGATCTGGCGGAGGTGGAAGCGGCGGAGGCGGATCTAGAGTGATTCCTGTG TCTGGCCCTGCCAGATGCCTGAGCCAGTCTAGAAACCTGCTGAAAACCACCGACGA CATGGTCAAGACCGCCAGAGAGAAGCTGAAGCACTACTCCTGCACAGCCGAGGACA TCGATCACGAGGATATCACCAGGGACCAGACAAGCACCCTGAAAACCTGCCTGCCT CTGGAACTGCATAAGAACGAGAGCTGCCTGGCCACCAGAGAAACCAGCTCTACCAC AAGAGGCAGCTGTCTGCCTCCTCAGAAAACCAGCCTGATGATGACCCTGTGCCTGG GCAGCATCTACGAGGATCTGAAGATGTACCAGACCGAGTTCCAGGCCATCAACGCC GCTCTGCAGAACCACAACCACCAGCAGATCATCCTGGACAAGGGCATGCTGGTGGC TATCGACGAGCTGATGCAGAGCCTGAACCATAACGGCGAGACACTGCGGCAGAAGC CTCCAGTTGGAGAGGCCGATCCTTACAGAGTGAAGATGAAGCTGTGCATCCTGCTGC ACGCCTTCAGCACCAGAGTGGTCACCATCAACAGAGTGATGGGCTACCTGAGCAGC GCCTGA SEQIDNO:2,mousesinglechainIL-12aminoacidsequence ((sc)-mIL-12p40p35)=recombinantmurinesingle-chain IL-12withp40andp35subunitsencoded MCPQKLTISWFAIVLLVSPLMAMWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDI TWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILK NFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKV TLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKN LQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLV EKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRSGGGGSGGGGSGGGGSRVI PVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLE LHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNH NHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRVV TINRVMGYLSSA SEQIDNO:3:mouse4-1BBLnucleotidesequence ATGGACCAGCACACACTGGACGTGGAAGATACCGCCGACGCCAGACACCCTGCCGG CACAAGCTGTCCATCTGATGCCGCCCTGCTGAGAGACACAGGCCTGCTGGCTGATGC TGCTCTGCTGTCTGACACCGTGCGGCCTACAAACGCCGCTCTGCCTACAGATGCCGC CTACCCTGCTGTGAACGTGCGGGATAGAGAGGCCGCTTGGCCTCCCGCCCTGAACTT CTGCAGCAGACACCCCAAGCTGTACGGCCTGGTGGCTCTGGTGCTCCTGCTGCTGAT TGCCGCCTGCGTGCCCATCTTCACCAGAACCGAGCCTAGACCTGCCCTGACCATCAC CACCAGCCCTAACCTGGGCACCAGAGAGAACAACGCCGACCAAGTGACCCCCGTGT CCCACATCGGCTGCCCTAACACAACCCAGCAGGGCAGCCCTGTGTTCGCCAAGCTGC TGGCCAAGAACCAGGCCAGCCTGTGCAACACCACCCTGAACTGGCACAGCCAGGAC GGCGCTGGCAGCAGCTATCTGAGCCAGGGCCTGAGATACGAAGAGGACAAGAAAG AACTGGTGGTGGACAGCCCTGGCCTGTACTACGTGTTCCTGGAACTGAAGCTGAGCC CCACCTTCACCAACACCGGCCACAAGGTGCAGGGCTGGGTGTCACTGGTGCTGCAG GCTAAGCCTCAGGTGGACGACTTCGACAACCTGGCCCTGACAGTGGAACTGTTCCCC TGCAGCATGGAAAACAAGCTGGTGGATAGAAGCTGGTCCCAGCTGCTGCTGCTGAA GGCCGGCCATAGACTGAGCGTGGGCCTGAGGGCTTATCTGCACGGCGCCCAGGACG CCTACAGAGACTGGGAGCTGAGCTACCCCAACACAACCAGCTTCGGCCTGTTCCTCG TGAAGCCCGACAACCCCTGGGAGTGA SEQIDNO:4,mouse4-1BBLaminoacidsequence MDQHTLDVEDTADARHPAGTSCPSDAALLRDTGLLADAALLSDTVRPTNAALPTDAAY PAVNVRDREAAWPPALNFCSRHPKLYGLVALVLLLLIAACVPIFTRTEPRPALTITTSPNL GTRENNADQVTPVSHIGCPNTTQQGSPVFAKLLAKNQASLCNTTLNWHSQDGAGSSYL SQGLRYEEDKKELVVDSPGLYYVFLELKLSPTFTNTGHKVQGWVSLVLQAKPQVDDFD NLALTVELFPCSMENKLVDRSWSQLLLLKAGHRLSVGLRAYLHGAQDAYRDWELSYP NTTSFGLFLVKPDNPWE- SEQIDNO:5,mousegp70nucleotidesequence ATGGAAACCGACACACTGCTGCTGTGGGTGCTGCTTCTTTGGGTGCCCGGATCTACA GGCGACGTGGCACTTGGAAACAGCCCTCACCAGGTGTTCAACCTGAGCTGGGAAGT GACAAACGGCGACCGCGAAACAGTGTGGGCCATCACAGGCAATCACCCTCTGTGGA CCTGGTGGCCTGACCTGACACCTGACCTGTGTATGCTGGCTCTGCACGGCCCATCTT ACTGGGGCCTCGAGTACAGAGCCCCTTTCTCTCCTCCACCTGGACCTCCATGTTGTA GCGGCAGCAGCGACAGCACAAGCGGCTGTTCTAGAGACTGCGAGGAACCCCTGACC AGCTACACCCCTAGATGTAACACCGCCTGGAACAGACTGAAGCTGAGCAAAGTGAC ACACGCCCACAACGAGGGCTTCTACGTGTGTCCTGGACCACACAGACCCAGATGGG CCAGATCTTGTGGCGGCCCTGAGAGCTTCTACTGTGCTAGCTGGGGCTGCGAGACAA CCGGCAGAGCTTCTTGGAAGCCTAGCAGCAGCTGGGACTACATCACCGTGTCCAAC AACCTGACCTCCGACCAGGCTACCCCTGTGTGCAAGGGCAACAAGTGGTGCAACAG CCTGACCATCAGATTCACCAGCTTCGGCAAGCAGGCCACCTCTTGGGTCACAGGACA TTGGTGGGGCCTGAGACTGTATGTGTCCGGCCATGATCCTGGCCTGATCTTCGGCAT CAGGCTGAAGATCACAGACAGCGGCCCCAGAGTGCCTATCGGCCCTAATCCTGTGC TGAGCGACAGAAGGCCTCCTAGCAGACCCAGGCCTACAAGATCTCCACCTCCAAGC AACAGCACCCCTACCGAGACACCTCTGACACTGCCTGAACCTCCACCAGCCGGCGT GGAAAACAGACTGCTGAATCTGGTCAAGGGCGCCTACCAGGCTCTGAACCTGACCA GCCCTGATAAGACACAAGAGTGCTGGCTGTGCCTGGTGTCTGGCCCTCCTTACTATG AAGGCGTGGCCGTGCTGGGCACCTACAGCAATCATACAAGCGCCCCTGCCAACTGC AGCGTGGCCTCTCAGCATAAGCTGACCCTGTCTGAAGTGACCGGCCAGGGCCTGTGT ATTGGCGCTGTGCCTAAGACACACCAGGTGCTGTGCAACACAACCCAGAAAACCAG CGACGGCAGCTACTACCTGGCTGCTCCTACAGGCACAACCTGGGCCTGTAGCACAG GACTGACCCCTTGTATCAGCACCACCATCCTGAATCTGACCACCGACTACTGCGTGC TGGTGGAACTGTGGCCTAGAGTGACCTACCACTCTCCTAGCTACGTGTACCACCAGT TCGAGAGAAGGGCCAAGTACAAGCGCGAGCCCGTGTCTCTTACACTGGCCTTGCTTC TCGGCGGCCTGACAATGGGAGGAATCGCTGCTGGTGTCGGCACCGGAACAACAGCT CTGGTTGCCACACAGCAGTTCCAGCAGCTGCAGGCCGCTATGCACGACGACCTGAA AGAGGTGGAAAAGAGCATCACCAACCTGGAAAAGTCTCTGACCAGCCTGAGCGAAG TGGTGCTGCAGAACAGAAGAGGCCTGGACCTGCTGTTCCTGAAGCGCGGAGGACTG TGCGCCTTCCTGAAAGAAGAGTGTTGCCTGTACGCCGACCACACCGGCCTCGTCAGA GATTCTATGGCCAAGCTGAGAGAGAGACTGAGCCAGAGACAGAAGCTGTTCGAGTC CCAGCAAGGATGGTTCGAGGGCCTGTTCAACAAGAGCCCCTGGTTCACCACACTGA TCAGCACAATCATGGGCCCTCTGATCATTCTGCTGCTGATCCTCCTGTTTGGCCCCTG CATCCTGAACAGGCTGGTGCAGTTCATCAAGGACAGAATCAGCGTGGTGCAGGCTC TGGTGCTGACCCAGCAGTATCACCAGCTGAAAACCATCGGCGACTGCAAGAGCAGA GAGTGA SEQIDNO:6,mousegp70aminoacidsequence METDTLLLWVLLLWVPGSTGDVALGNSPHQVFNLSWEVTNGDRETVWAITGNHPLWT WWPDLTPDLCMLALHGPSYWGLEYRAPFSPPPGPPCCSGSSDSTSGCSRDCEEPLTSYTP RCNTAWNRLKLSKVTHAHNEGFYVCPGPHRPRWARSCGGPESFYCASWGCETTGRAS WKPSSSWDYITVSNNLTSDQATPVCKGNKWCNSLTIRFTSFGKQATSWVTGHWWGLRL YVSGHDPGLIFGIRLKITDSGPRVPIGPNPVLSDRRPPSRPRPTRSPPPSNSTPTETPLTLPEP PPAGVENRLLNLVKGAYQALNLTSPDKTQECWLCLVSGPPYYEGVAVLGTYSNHTSAP ANCSVASQHKLTLSEVTGQGLCIGAVPKTHQVLCNTTQKTSDGSYYLAAPTGTTWACS TGLTPCISTTILNLTTDYCVLVELWPRVTYHSPSYVYHQFERRAKYKREPVSLTLALLLG GLTMGGIAAGVGTGTTALVATQQFQQLQAAMHDDLKEVEKSITNLEKSLTSLSEVVLQ NRRGLDLLFLKRGGLCAFLKEECCLYADHTGLVRDSMAKLRERLSQRQKLFESQQGWF EGLFNKSPWFTTLISTIMGPLIILLLILLFGPCILNRLVQFIKDRISVVQALVLTQQYHQLKT IGDCKSRE- SEQIDNO:7,ovalbuminnucleotidesequence ATGGGCTCCATCGGTGCAGCAAGCATGGAATTTTGTTTTGATGTATTCAAGGAGCTC AAAGTCCACCATGCCAATGAGAACATCTTCTACTGCCCCATTGCCATCATGTCAGCT CTAGCCATGGTATACCTGGGTGCAAAAGACAGCACCAGGACACAAATAAATAAGGT TGTTCGCTTTGATAAACTTCCAGGATTCGGAGACAGTATTGAAGCTCAGTGTGGCAC ATCTGTAAACGTTCACTCTTCACTTAGAGACATCCTCAACCAAATCACCAAACCAAA TGATGTTTATTCGTTCAGCCTTGCCAGTAGACTTTATGCTGAAGAGAGATACCCAAT CCTGCCAGAATACTTGCAGTGTGTGAAGGAACTGTATAGAGGAGGCTTGGAACCTA TCAACTTTCAAACAGCTGCAGATCAAGCCAGAGAGCTCATCAATTCCTGGGTAGAA AGTCAGACAAATGGGATTATCAGAAATGTCCTTCAGCCAAGCTCCGTGGATTCTCAA ACTGCAATGGTTCTGGTTAATGCCATTGTCTTCAAAGGACTGTGGGAGAAAGCATTT AAGGATGAAGACACACAAGCAATGCCTTTCAGAGTGACTGAGCAAGAAAGCAAACC TGTGCAGATGATGTACCAGATTGGTTTATTTAGAGTGGCATCAATGGCTTCTGAGAA AATGAAGATCCTGGAGCTTCCATTTGCCAGTGGGACAATGAGCATGTTGGTGCTGTT GCCTGATGAAGTCTCAGGCCTTGAGCAGCTTGAGAGTATAATCAACTTTGAAAAACT GACTGAATGGACCAGTTCTAATGTTATGGAAGAGAGGAAGATCAAAGTGTACTTAC CTCGCATGAAGATGGAGGAAAAATACAACCTCACATCTGTCTTAATGGCTATGGGC ATTACTGACGTGTTTAGCTCTTCAGCCAATCTGTCTGGCATCTCCTCAGCAGAGAGC CTGAAGATATCTCAAGCTGTCCATGCAGCACATGCAGAAATCAATGAAGCAGGCAG AGAGGTGGTAGGGTCAGCAGAGGCTGGAGTGGATGCTGCAAGCGTCTCTGAAGAAT TTAGGGCTGACCATCCATTCCTCTTCTGTATCAAGCACATCGCAACCAACGCCGTTC TCTTCTTTGGCAGATGTGTTTCCCCTTAA SEQIDNO:8,ovalbuminaminoacidsequence MGSIGAASMEFCFDVFKELKVHHANENIFYCPIAIMSALAMVYLGAKDSTRTQINKVVR FDKLPGFGDSIEAQCGTSVNVHSSLRDILNQITKPNDVYSFSLASRLYAEERYPILPEYLQ CVKELYRGGLEPINFQTAADQARELINSWVESQTNGIIRNVLQPSSVDSQTAMVLVNAIV FKGLWEKAFKDEDTQAMPFRVTEQESKPVQMMYQIGLFRVASMASEKMKILELPFASG TMSMLVLLPDEVSGLEQLESIINFEKLTEWTSSNVMEERKIKVYLPRMKMEEKYNLTSV LMAMGITDVFSSSANLSGISSAESLKISQAVHAAHAEINEAGREVVGSAEAGVDAASVSE EFRADHPFLFCIKHIATNAVLFFGRCVSP- SEQIDNO:9,humansingle-chainIL-12nucleotidesequence ATGTGTCACCAACAGCTGGTCATCAGCTGGTTCTCCCTGGTGTTCCTGGCCTCTCCTC TGGTGGCCATCTGGGAGCTGAAGAAAGACGTGTACGTGGTGGAACTGGACTGGTAT CCCGATGCTCCTGGCGAGATGGTGGTGCTAACCTGCGATACACCTGAAGAGGACGG CATCACCTGGACACTGGATCAGTCTAGCGAGGTGCTCGGCTCTGGCAAGACCCTGAC CATCCAAGTGAAAGAGTTTGGCGACGCAGGTCAGTACACCTGTCACAAAGGTGGAG AAGTGCTGAGCCACAGCCTGCTGCTGCTCCACAAGAAAGAGGATGGCATTTGGAGT ACCGACATCCTGAAGGATCAGAAGGAGCCTAAGAACAAGACCTTCCTGAGATGCGA GGCCAAGAACTATAGTGGACGGTTCACATGTTGGTGGCTGACCACCATCAGCACCG ACCTTACCTTCAGCGTGAAGAGCAGCAGAGGCAGCAGTGATCCTCAGGGAGTTACA TGTGGTGCTGCTACACTGTCTGCCGAAAGAGTGAGAGGTGACAACAAGGAATACGA GTACAGCGTGGAATGCCAAGAGGACAGCGCTTGTCCAGCTGCAGAAGAGTCTCTGC CTATCGAAGTGATGGTGGACGCAGTGCACAAGCTGAAGTACGAGAACTACACCTCC AGCTTCTTCATCAGAGACATCATCAAGCCTGATCCACCCAAGAACCTGCAGCTGAAG CCTCTGAAGAACAGCAGACAGGTTGAAGTGTCCTGGGAGTACCCTGACACCTGGTCT ACACCACACAGCTACTTCAGCCTGACCTTTTGCGTGCAAGTGCAGGGCAAGTCCAAG CGAGAGAAGAAGGACCGTGTGTTCACCGACAAGACAAGCGCAACCGTGATCTGCAG AAAGAACGCCAGCATCAGCGTCAGAGCCCAGGACCGGTACTACAGCAGCTCTTGGA GCGAATGGGCAAGCGTGCCATGTTCTGGTGGTGGAGGATCTGGTGGAGGTGGAAGC GGAGGAGGTGGATCTAGAAATCTGCCTGTGGCCACTCCTGATCCTGGCATGTTCCCT TGTCTGCACCACAGCCAGAACCTTCTGAGAGCAGTGTCCAACATGCTCCAGAAGGC CAGACAGACCCTGGAATTCTACCCATGCACCAGCGAGGAAATCGACCACGAGGACA TCACTAAGGATAAGACCAGCACCGTGGAAGCCTGCCTGCCTCTGGAACTGACCAAG AACGAGAGCTGCCTGAACAGCCGTGAAACCAGCTTCATCACCAACGGCTCTTGCCT GGCAAGCAGGAAGACCTCCTTCATGATGGCTCTGTGCCTGAGCAGCATCTACGAGG ACCTCAAGATGTACCAGGTGGAGTTCAAGACCATGAACGCCAAGCTGCTGATGGAC CCTAAGCGGCAGATCTTCCTGGACCAGAATATGCTGGCAGTCATCGACGAGCTGATG CAGGCACTGAACTTCAACAGCGAGACAGTGCCTCAGAAGTCTAGCCTGGAGGAACC CGACTTCTACAAGACCAAGATCAAGCTGTGCATCCTGCTGCACGCCTTCCGTATCAG AGCCGTGACCATCGACAGAGTGATGAGCTACCTGAACGCCTCCTGA SEQIDNO:10,humansingle-chainIL-12aminoacidsequence MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGI TWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDIL KDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLS AERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPD PPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKT SATVICRKNASISVRAQDRYYSSSWSEWASVPCSGGGGSGGGGSGGGGSRNLPVATPDP GMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTK NESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKR QIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRV MSYLNAS* SEQIDNO:11,humansingle-chainIL-12nucleotidesequence (withlinkagetothepre-maturep35,withshortsignal peptideremovedfromthefusionprotein) ATGTGTCACCAGCAGCTGGTCATCAGCTGGTTCAGCCTGGTGTTCCTGGCCTCTCCTC TGGTGGCCATCTGGGAGCTGAAGAAAGACGTGTACGTGGTGGAACTGGACTGGTAT CCCGATGCACCTGGCGAGATGGTGGTGCTGACCTGCGATACACCTGAAGAGGACGG CATCACCTGGACACTGGACCAGTCTAGCGAGGTGCTCGGCTCTGGCAAGACCCTGA CCATCCAAGTGAAAGAGTTTGGCGACGCTGGACAGTACACCTGTCACAAAGGTGGA GAAGTGCTGAGCCACAGCCTGCTGCTGCTCCACAAGAAAGAGGATGGCATTTGGTC CACCGACATCCTGAAGGACCAGAAAGAGCCCAAGAACAAGACCTTCCTGAGATGCG AGGCCAAGAACTACTCCGGACGGTTCACATGTTGGTGGCTGACCACCATCAGCACC GACCTGACATTCAGCGTGAAGAGTAGCAGAGGCAGCAGTGATCCTCAGGGAGTTAC ATGTGGAGCAGCTACACTGTCTGCCGAAAGAGTGAGAGGTGACAACAAAGAATACG AGTACAGCGTGGAATGCCAAGAGGATAGTGCCTGTCCAGCAGCAGAAGAGTCTCTG CCTATCGAAGTGATGGTGGACGCTGTGCACAAGCTGAAGTACGAGAACTACACATC CAGCTTCTTCATCCGAGACATCATCAAACCAGATCCTCCCAAGAATCTGCAGCTGAA GCCTCTGAAGAACAGCAGACAAGTGGAAGTGTCCTGGGAGTACCCAGACACCTGGT CTACACCTCACAGCTACTTCTCCCTGACCTTTTGCGTGCAAGTGCAGGGCAAGTCCA AGAGAGAGAAGAAGGACAGAGTCTTCACCGACAAGACATCTGCCACCGTGATCTGC AGAAAGAACGCCAGCATCAGCGTCAGAGCCCAGGACCGGTACTACAGCAGCTCTTG GAGCGAATGGGCAAGCGTGCCATGTTCTGGTGGTGGAGGATCTGGAGGAGGTGGAA GCGGTGGAGGAGGATCTAGACCTGTTAGCCTGCAGTGCAGACTGAGCATGTGCCCA GCTAGATCTCTCCTGCTGGTTGCCACACTGGTGCTCCTGGATCATCTGAGCCTGGCC AGAAACCTGCCAGTGGCCACGCCTGATCCTGGCATGTTTCCTTGTCTGCACCACAGC CAGAACCTGCTGAGAGCCGTTTCCAACATGCTGCAGAAGGCCAGACAGACCCTGGA ATTCTACCCATGCACCAGCGAGGAAATCGACCACGAGGACATTACCAAGGATAAGA CCAGCACCGTGGAAGCCTGCCTGCCTCTGGAACTGACCAAGAACGAGAGCTGCCTG AACAGCCGTGAAACCAGCTTCATCACCAACGGCTCTTGCCTTGCCTCCAGGAAGACC TCCTTCATGATGGCACTGTGCCTGAGCAGCATCTACGAGGACCTCAAGATGTACCAA GTGGAGTTCAAGACCATGAACGCCAAGCTGCTGATGGATCCCAAGAGACAGATCTT CCTTGATCAGAACATGCTGGCTGTGATCGACGAGCTGATGCAGGCACTGAACTTCAA CAGCGAGACAGTGCCTCAGAAGTCTAGCCTGGAAGAACCCGACTTCTACAAGACCA AGATCAAGCTGTGCATCCTGCTGCACGCCTTCCGTATCAGAGCCGTGACCATCGACA GAGTGATGAGCTACCTGAACGCCTCCTGA SEQIDNO:12,humansingle-chainIL-12aminoacidsequence (withlinkagetothepre-maturep35,withshortsignal peptideremovedfromthefusionprotein) MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGI TWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDIL KDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLS AERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPD PPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKT SATVICRKNASISVRAQDRYYSSSWSEWASVPCSGGGGSGGGGSGGGGSRPVSLQCRLS MCPARSLLLVATLVLLDHLSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQT LEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFM MALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETV PQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS SEQIDNO:13,human4-1BBLnucleotidesequenceofNCBI RefSeqNP_003802.1 ATGGAATACGCCAGCGACGCCTCTCTGGACCCTGAAGCTCCTTGGCCTCCAGCTCCT AGAGCCAGGGCTTGTAGAGTGCTGCCTTGGGCTCTTGTGGCTGGACTTCTGCTTCTG TTGCTCCTGGCTGCTGCCTGCGCAGTGTTTCTTGCTTGTCCATGGGCTGTGTCAGGAG CCAGAGCATCTCCTGGATCTGCCGCTTCTCCCAGACTGAGAGAGGGACCTGAACTGA GCCCTGATGATCCTGCTGGACTGCTCGACCTGAGACAGGGCATGTTTGCCCAGCTGG TGGCCCAGAATGTGCTGCTGATTGATGGCCCTCTGAGCTGGTACAGCGATCCTGGAC TTGCTGGCGTTAGCCTGACTGGAGGCCTGAGCTACAAGGAGGACACCAAAGAACTG GTGGTGGCCAAGGCTGGCGTGTACTACGTGTTCTTTCAGCTGGAACTGCGGAGAGTG GTGGCAGGCGAAGGATCTGGATCCGTGTCTCTGGCACTGCATCTGCAGCCTCTGAGA TCTGCTGCTGGTGCAGCTGCCCTGGCTCTGACAGTTGATCTGCCTCCTGCCTCCAGCG AAGCCAGAAACAGCGCCTTTGGCTTCCAAGGCAGACTGCTGCACCTGTCTGCTGGCC AGAGACTGGGAGTGCACCTCCACACAGAAGCAAGAGCAAGACACGCCTGGCAGCTT ACACAAGGCGCTACAGTGCTGGGCCTGTTCAGAGTGACACCTGAGATTCCAGCTGG CTTGCCATCTCCTCGCAGCGAGTAATGA SEQIDNO:14,human4-1BBLaminoacidsequenceofNCBI RefSeqNP_003802.1 MEYASDASLDPEAPWPPAPRARACRVLPWALVAGLLLLLLLAAACAVFLACPWAVSG ARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLA GVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAA GAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGA TVLGLFRVTPEIPAGLPSPRSE