WNT-SURROGATE AGENTS AND METHODS FOR LACRIMAL GLAND REGENERATION
20250051459 ยท 2025-02-13
Inventors
- Yang Li (Mountain View, CA)
- Huy Tuan NGUYEN (Palo Alto, CA, US)
- Yorick POST (Palo Alto, CA, US)
- Wen-Chen Yeh (Belmont, CA)
Cpc classification
C07K16/2863
CHEMISTRY; METALLURGY
C07K16/28
CHEMISTRY; METALLURGY
C12N5/0633
CHEMISTRY; METALLURGY
International classification
Abstract
Methods and compositions for treatment of dry-eye disorders are provided. In particular, the present disclosure provides methods and compositions for modulating WNT (Wingless and lnt-1) signaling in a subject to modulate regeneration of tear-producing acinar cells to treat aqueous-deficient type dry-eye diseases. Further disclosed are WNT signaling modulators used in the methods.
Claims
1. A method of regenerating lacrimal gland cells in a subject, comprising administering a WNT signaling modulator to the subject.
2. The method of claim 1 wherein the lacrimal gland cells are acinar cells, progenitor cells, ductal cells, myoepithelial cells, or immune cells.
3. The method of claim 1, wherein the WNT signaling modulator is an engineered WNT signaling modulator.
4. The method of claim 3, wherein the engineered WNT signaling modulator is a WNT agonist.
5. The method of claim 1, wherein the WNT signaling modulator is an engineered WNT superagonist comprising an E3 Ligase binding domain selected from the group consisting of: a mutant R-spondin (RSPO) protein; and an antibody specific for E3 ligase or functional fragment thereof.
6. The method of claim 1, wherein the WNT signaling modulator comprises at least one engineered bi-specific IgG antibody or antigen binding fragment thereof that directly activates a canonical WNT signaling pathway.
7. The method of claim 6, wherein the bi-specific IgG antibody or antigen binding fragment thereof comprises a binding composition specific for at least one FZD receptor and a binding composition specific for at least one LRP receptor.
8. The method of claim 1, wherein the WNT signaling modulator is selected from: (i) WNT3a; (ii) a WNT mimetic; or (iii) an R-spondin mimetic; a) the FZD binding composition binds to at least one of Fzd1, Fzd2, Fzd5, Fzd7, Fzd8; and b) the LRP binding composition binds to at least one of Lrp6, and/or Lrp5.
9. The method of claim 1, wherein the WNT signaling modulator binds to the group consisting of: Fzd5 and Fzd8, and Lrp6 and/or Lrp5.
10. The method of claim 1, wherein the WNT signaling modulator comprises one or more polypeptides selected from the group consisting of: SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID: NO 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO:15, SEQ ID NO:16, and any isoform or homolog thereof.
11. The method of claim 10 wherein the WNT signaling modulator comprises: a) two polypeptides of SEQ ID NO:1 and two polypeptides of SEQ ID NO:2, or variants thereof having at least 90% identity thereto; b) two polypeptides of SEQ ID NO:3 and two polypeptides of SEQ ID NO:4, or variants thereof having at least 90% identity thereto; c) two polypeptides of SEQ ID NO:5 and two polypeptides of SEQ ID NO:6, or variants thereof having at least 90% identity thereto; d) two polypeptides of SEQ ID NO:7 and two polypeptides of SEQ ID NO:8, or variants thereof having at least 90% identity thereto; or e) two polypeptides of SEQ ID NO:9 and two polypeptides of SEQ ID NO:10, or variants thereof having at least 90% identity thereto; f) two polypeptides of SEQ ID NO:11 and two polypeptides of SEQ ID NO:14, or variants thereof having at least 90% identity thereof; g) two polypeptides of SEQ ID NO:12 and two polypeptides of SEQ ID NO:14, or variants thereof having at least 90% identity thereof; h) two polypeptides of SEQ ID NO:13 and two polypeptides of SEQ ID NO:14, or variants thereof having at least 90% identity thereof; or i) two polypeptides of SEQ ID NO:15 and two polypeptides of SEQ ID NO:16, or variants thereof having at least 90% identity thereof.
12. The method of any of claims 1-11 wherein the method further comprises co-administration of at least one molecule from the group consisting of: RSPO2, RSPO2 fragment, and engineered RSPO2 mimetic.
13. The method of any of claims 1-12 wherein the subject is a mammal.
14. The method of any of claims 1-13 wherein the subject is a human.
15. The method of any of claims 1-14 wherein the subject is in need of lacrimal cell regeneration because of a lacrimal gland disorder.
16. The method of claim 15, wherein the lacrimal gland disorder is a dry eye disease.
17. The method of claim 16, wherein the dry eye disease is caused by Sjgren's syndrome, chronic graft versus host disease (cGHVD), rheumatoid arthritis (RA), Stephen's Johnson syndrome, ocular rosacea, chemotherapy, radiation oncology treatments, diabetes, lupus, or a Meibomian Gland Disorder (MGD).
18. The method of claim 17, wherein the dry eye disease is Sjgren's syndrome.
19. A method of treating a lacrimal gland disorder in a subject, comprising administering a WNT signaling modulator to the subject.
20. The method of claim 19, wherein the WNT signaling modulator is an engineered WNT signaling modulator.
21. The method of claim 19, wherein the WNT signaling modulator is an engineered WNT agonist.
22. The method of claim 19, wherein the WNT signaling modulator comprises at least one engineered bi-specific antibody or antigen binding fragment thereof that directly activates a canonical WNT signaling pathway.
23. The method of claim 19, wherein the engineered WNT agonist is selected from: (i) WNT3a; (ii) a WNT mimetic; or (iii) an R-spondin mimetic.
24. The method of claim 19, wherein the WNT signaling modulator binds to: a) any one or more of the group consisting of: Fzd1, Fzd2, Fzd5, Fzd7, Fzd8; and b) Lrp6, and/or Lrp5.
25. The method of claim 19, wherein the WNT signaling modulator binds to: a) any one or more of the group consisting of: Fzd1, Fzd2, and Fzd7; and b) Lrp6, and/or Lrp5.
26. The method of claim 20, wherein the WNT signaling modulator binds to: a) any one or more of the group consisting of: Fzd5 and Fzd8; and b) Lrp6 and/or, Lrp5.
27. The method of claim 19, wherein the WNT signaling modulator comprises a sequence selected from the group consisting of: SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID: NO 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, and any isoform or homolog thereof of any of the foregoing, optionally wherein the WNT signaling modulator comprises: a) two polypeptides of SEQ ID NO:1 (or variants of one or both having at least 90% identity thereto) and two polypeptides of SEQ ID NO:2 (or variants of one or both having at least 90% identity thereto); b) two polypeptides of SEQ ID NO:3 (or variants of one or both having at least 90% identity thereto) and two polypeptides of SEQ ID NO:4 (or variants of one or both having at least 90% identity thereto); c) two polypeptides of SEQ ID NO:5 (or variants of one or both having at least 90% identity thereto) and two polypeptides of SEQ ID NO:6 (or variants of one or both having at least 90% at least identity thereto); d) two polypeptides of SEQ ID NO:7 (or variants of one or both having at least 90% identity thereto) and two polypeptides of SEQ ID NO:8 (or variants of one or both having at least 90% identity thereto); or e) two polypeptides of SEQ ID NO:9 (or variants of one or both having at least 90% identity thereto) and two polypeptides of SEQ ID NO:10 (or variants of one or both having at least 90% identity thereto); f) two polypeptides of SEQ ID NO:11 (or variants of one or both having at least 90%, at least 95%, or at least 98% identity thereto) and two polypeptides of SEQ ID NO:14 (or variants of one or both having at least 90% identity thereto); g) two polypeptides of SEQ ID NO:12 (or variants of one or both having at least 90% identity thereto) and two polypeptides of SEQ ID NO:14 (or variants of one or both having at least 90%, identity thereto); h) two polypeptides of SEQ ID NO:13 (or variants of one or both having at least 90%, identity thereto) and two polypeptides of SEQ ID NO:14 (or variants of one or both having at least 90%, identity thereto); or i) two polypeptides of SEQ ID NO:15 (or variants of one or both having at least 90%, identity thereto) and two polypeptides of SEQ ID NO:16 (or variants of one or both having at least 90%, identity thereto).
28. The method of any of claims 19-27 wherein the method further comprises administering at least one of the group consisting of: RSPO2, an RSPO2 fragment, and an engineered RSPO2 mimetic.
29. The method of any of claims 19-28 wherein the WNT signaling modulator is administered in a therapeutically effective amount.
30. The method of any of claims 19-29 wherein the subject is a live mammal.
31. The method of any of claims 19-30 wherein the subject is a human patient.
32. The method of any of claims 19-31 wherein the lacrimal gland disorder is dry eye disease.
33. The method of claim 32, wherein the dry eye disease is caused by Sjgren's syndrome, chronic graft versus host disease (cGHVD), rheumatoid arthritis (RA), Stephen's Johnson syndrome, ocular rosacea, chemotherapy, radiation oncology treatments, diabetes, lupus, or a Meibomian Gland Disorder (MGD).
34. The method of claim 33, wherein the dry eye disease is caused by Sjgren's syndrome.
35. A composition for the treatment of a dry-eye disorder in a subject, the composition comprising a WNT signaling modulator.
36. The composition of claim 35, wherein the WNT signaling modulator comprises at least one engineered bi-specific antibody or antigen binding fragment thereof that directly activates a canonical WNT signaling pathway.
37. The composition of claim 35, wherein the at least one engineered bi-specific full-length IgG antibody or antigen binding fragment thereof is specific for or preferentially binds any one of the following combination of Fzds: a) Fzd1, Fzd2, Fzd5, Fzd7, Fzd8; b) Fzd 1, Fzd 2, and Fzd 7; or c) Fzd5 and Fzd8, wherein the engineered bi-specific antibody or antigen binding fragment thereof also binds Lrp 5 and/or Lrp6.
38. The composition of claim 35, further comprising an anti-inflammatory agent.
39. The composition of claims 35-38, wherein the composition comprises therapeutically effective amounts of its components.
40. The composition of claims 35-38, wherein the subject is a live mammal.
41. The composition of claims 35-38, wherein the subject is human patient.
42. The composition of claims 35-38, wherein the aqueous-deficient dry-eye disorder is caused by a Sjgren's syndrome, disorder, chronic graft versus host disease (cGHVD), rheumatoid arthritis (RA), Stephen's Johnson syndrome, ocular rosacea, chemotherapy, radiation oncology treatments, diabetes, lupus, or a Meibomian Gland Disorder (MGD.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
[0058]
[0059]
[0060]
[0061]
[0062]
[0063]
[0064]
[0065]
[0066]
[0067]
[0068] It will be readily apparent to persons having ordinary skill in the art that the above figures are illustrative only and do not limit the scope of the instant disclosure.
DETAILED DESCRIPTION
I. Definitions
[0069] As used herein, including the appended claims, the singular forms of words such as a, an, and the, include their corresponding plural references unless the context clearly dictates otherwise.
[0070] All references cited herein are incorporated by reference to the same extent as if each individual publication, patent application, or patent, was specifically and individually indicated to be incorporated by reference.
[0071] Activity of a molecule may describe or refer to the binding of the molecule to a ligand or to a receptor, to catalytic activity, to the ability to stimulate gene expression, to antigenic activity, to the modulation of activities of other molecules, and the like. Activity of a molecule may also refer to activity in modulating or maintaining cell-to-cell interactions, e.g., adhesion, or activity in maintaining a structure of a cell, e.g., cell membranes or cytoskeleton. Activity may also mean specific activity, e.g., [catalytic activity]/[mg protein], or [immunological activity]/[mg protein], or the like.
[0072] The terms administering or introducing or providing, as used herein, refer to delivery of a composition to a cell, to cells, tissues and/or organs of a subject, or to a subject. Such administering or introducing may take place in vivo, in vitro or ex vivo.
[0073] As used herein, the term antibody means an isolated or recombinant binding agent that comprises the necessary variable region sequences to specifically bind an antigenic epitope. Therefore, an antibody is any form of antibody or fragment thereof that exhibits the desired biological activity, e.g., binding the specific target antigen. Thus, it is used in the broadest sense and specifically covers monoclonal antibodies (including full-length monoclonal antibodies), polyclonal antibodies, human antibodies, humanized antibodies, chimeric antibodies, nanobodies, diabodies, multispecific antibodies (e.g., bispecific antibodies), and antibody fragments including, but not limited to, scFv, Fab, and Fab2, so long as they exhibit the desired biological activity.
[0074] Antibody fragments comprise a portion of an intact antibody, for example, the antigen-binding or variable region of the intact antibody. Examples of antibody fragments include Fab, Fab, F(ab)2, and Fv fragments; diabodies; linear antibodies (e.g., Zapata et al., Protein Eng. 8(10): 1057-1062 (1995)); single-chain antibody molecules (e.g., scFv); and multispecific antibodies formed from antibody fragments. Papain digestion of antibodies produces two identical antigen-binding fragments, called Fab fragments, each with a single antigen-binding site, and a residual Fc fragment, a designation reflecting the ability to crystallize readily. Pepsin treatment yields an F(ab)2 fragment that has two antigen combining sites and is still capable of cross-linking antigen.
[0075] The term antigen refers to a molecule or a portion of a molecule capable of being bound by a selective binding agent, such as an antibody, and 30 additionally capable of being used in an animal to produce antibodies capable of binding to an epitope of that antigen. In certain embodiments, a binding agent (e.g., a WNT surrogate molecule or binding region thereof, or a WNT antagonist) is said to specifically bind an antigen when it preferentially recognizes its target antigen in a complex mixture of proteins and/or macromolecules.
[0076] The term antigen-binding fragment as used herein refers to a polypeptide fragment that contains at least one complementarity-determining region (CDR) of an immunoglobulin heavy and/or light chain, or of a VTHsdAb (single domain antibody) or Nanobody (Nab), that binds to the antigen of interest, in particular to one or more Fzd receptors, or to LRP5 and/or LRP6. In this regard, an antigen-binding fragment of the herein described antibodies may comprise 1, 2, 3, 4, 5, or all 6 CDRs of a VH and VL from antibodies that bind one or more Fzd receptors or LRP5 and/or LRP6.
[0077] As used herein, the terms biological activity and biologically active refer to the activity attributed to a particular biological element in a cell. For example, the biological activity of a WNT agonist, or fragment or variant thereof refers to the ability to mimic or enhance WNT signals. As another example, the biological activity of a polypeptide or functional fragment or variant thereof refers to the ability of the polypeptide or functional fragment or variant thereof to carry out its native functions of, e.g., binding, enzymatic activity, etc. In some embodiments, a functional fragment or variant retains at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 100% of an activity of the corresponding native protein or nucleic acid. As a third example, the biological activity of a gene regulatory element, e.g., promoter, enhancer, Kozak sequence, and the like, refers to the ability of the regulatory element or functional fragment or variant thereof to regulate, i.e., promote, enhance, or activate the translation of, respectively, the expression of the gene to which it is operably linked.
[0078] The term bifunctional antibody, as used herein, refers to an antibody that comprises a first arm having a specificity for one antigenic site and a second arm having a specificity for a different antigenic site, i.e., the bifunctional antibodies have a dual specificity.
[0079] Bispecific antibody is used herein to refer to a full-length antibody that is generated by quadroma technology (see Milstein et al., Nature, 305(5934): 537-540 (1983)), by chemical conjugation of two different monoclonal antibodies (see Staerz et al., Nature, 314(6012): 628-631 (1985)), or by knob-into-hole or similar approaches, which introduce mutations in the Fc region (see Holliger et al., Proc. Natl. Acad. Sci. USA, 90(14): 6444-6448 (1993)), resulting in multiple different immunoglobulin species of which only one is the functional bispecific antibody. A bispecific antibody binds one antigen (or epitope) on one of its two binding arms (one pair of HC/LC), and binds a different antigen (or epitope) on its second arm (a different pair of HC/LC). By this definition, a bispecific antibody has two distinct antigen-binding arms (in both specificity and CDR sequences) and is monovalent for each antigen to which it binds.
[0080] By comprising, it is meant that the recited elements are required in, for example, the composition, method, kit, etc., but other elements may be included to form the, for example, composition, method, kit etc. within the scope of the claim. For example, an expression cassette comprising a gene encoding a therapeutic polypeptide operably linked to a promoter is an expression cassette that may include other elements in addition to the gene and promoter, e.g., poly-adenylation sequence, enhancer elements, other genes, linker domains, etc.
[0081] By consisting essentially of, it is meant a limitation of the scope of the, for example, composition, method, kit, etc., described to the specified materials or steps that do not materially affect the basic and novel characteristic(s) of the, for example, composition, method, kit, etc. For example, an expression cassette consisting essentially of a gene encoding a therapeutic polypeptide operably linked to a promoter and a polyadenylation sequence may include additional sequences, e.g., linker sequences, so long as they do not materially affect the transcription or translation of the gene. As another example, a variant, or mutant, polypeptide fragment consisting essentially of a recited sequence has the amino acid sequence of the recited sequence plus or minus about 10 amino acid residues at the boundaries of the sequence based upon the full length nave polypeptide from which it was derived, e.g., 10, 9, 8, 7, 6, 5, 4, 3, 2 or 1 residue less than the recited bounding amino acid residue, or 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 residues more than the recited bounding amino acid residue.
[0082] By consisting of, it is meant the exclusion from the composition, method, or kit of any element, step, or ingredient not specified in the claim. For example, a polypeptide or polypeptide domain consisting of a recited sequence contains only the recited sequence.
[0083] A control element or control sequence is a nucleotide sequence involved in an interaction of molecules that contributes to the functional regulation of a polynucleotide, including replication, duplication, transcription, splicing, translation, or degradation of the polynucleotide. The regulation may affect the frequency, speed, or specificity of the process, and may be enhancing or inhibitory in nature. Control elements known in the art include, for example, transcriptional regulatory sequences such as promoters and enhancers. A promoter is a DNA region capable under certain conditions of binding RNA polymerase and initiating transcription of a coding region usually located downstream (in the 3 direction) from the promoter.
[0084] An expression vector is a vector, e.g., plasmid, minicircle, viral vector, liposome, and the like as discussed herein or as known in the art, comprising a region which encodes a gene product of interest, and is used for effecting the expression of the gene product in an intended target cell. An expression vector also comprises control elements, e.g., promoters, enhancers, untranslated regions (UTRs), miRNA targeting sequences, etc., operatively linked to the encoding region to facilitate expression of the gene product in the target. The combination of control elements and a gene or genes to which they are operably linked for expression is sometimes referred to as an expression cassette, a large number of which are known and available in the art or can be readily constructed from components that are available in the art.
[0085] As used herein, the term FR set refers to the four flanking amino acid sequences which frame the CDRs of a CDR set of a heavy or light chain V region. Some FR residues may contact bound antigen; however, FRs are primarily responsible for folding the V region into the antigen-binding site, particularly the FR residues directly adjacent to the CDRs. Within FRs, certain amino residues and certain structural features are very highly conserved. In this regard, all V region sequences contain an internal disulfide loop of around 90 amino acid residues. When the V regions fold into a binding-site, the CDRs are displayed as projecting loop motifs which form an antigen-binding surface. It is generally recognized that there are conserved structural regions of FRs which influence the folded shape of the CDR loops into certain canonical structures-regardless of the precise CDR amino acid sequence. Further, certain FR residues are known to participate in non-covalent interdomain contacts which stabilize the interaction of the antibody heavy and light chains.
[0086] The terms individual, host, subject, and patient are used interchangeably herein, and refer to a mammal, including, but not limited to, human and non-human primates, including simians and humans; mammalian sport animals (e.g., horses); mammalian farm animals (e.g., sheep, goats, etc.); mammalian pets (dogs, cats, etc.); and rodents (e.g., mice, rats, etc.).
[0087] Humanized antibodies or fragments thereof refers to antibodies or fragments thereof from non-human species whose protein sequences have been modified to increase their similarity to antibody variants produced naturally in humans. The process of humanization is usually applied to monoclonal antibodies developed for administration to humans.
[0088] A monoclonal antibody refers to a homogeneous antibody population wherein the monoclonal antibody is comprised of amino acids (naturally occurring and non-naturally occurring) that are involved in the selective binding of an epitope. Monoclonal antibodies are highly specific, being directed against a single epitope. The term monoclonal antibody encompasses not only intact monoclonal antibodies and full-length monoclonal antibodies, but also fragments thereof (such as Fab, Fab, F(ab)2, Fv), single chain (scFv), single domain antibodies (sdAbs, also known as Nanobodies), variants thereof, fusion proteins comprising an antigen-binding fragment of a monoclonal antibody, humanized monoclonal antibodies, chimeric monoclonal antibodies, and any other modified configuration of the immunoglobulin molecule that comprises an antigen-binding fragment (epitope recognition site) of the required specificity and the ability to bind to an epitope, including WNT surrogate molecules disclosed herein. It is not intended to be limited as regards the source of the antibody or the manner in which it is made (e.g., by hybridoma, phage selection, recombinant expression, transgenic animals, etc.). The term includes whole immunoglobulins as well as the fragments etc. described above under the definition of antibody.
[0089] The term native or wild-type as used herein refers to a nucleotide sequence, e.g., gene, or gene product, e.g., RNA or protein, that is present in a wild-type cell, tissue, organ, or organism. The term variant as used herein refers to a mutant of a reference polynucleotide or polypeptide sequence, for example a native polynucleotide or polypeptide sequence, i.e., having less than 100% sequence identity with the reference polynucleotide or polypeptide sequence. Put another way, a variant comprises at least one amino acid difference (e.g., amino acid substitution, amino acid insertion, amino acid deletion) relative to a reference polynucleotide sequence, e.g., a native polynucleotide or polypeptide sequence. For example, a variant may be a polynucleotide having a sequence identity of 50% or more, 60% or more, or 70% or more with a full-length native polynucleotide sequence, e.g., an identity of 75% or 80% or more, such as 85%, 90%, or 95% or more, for example, 98% or 99% identity with the full-length native polynucleotide sequence. As another example, a variant may be a polypeptide having a sequence identity of 70% or more with a full-length native polypeptide sequence, e.g., an identity of 75% or 80% or more, such as 85%, 90%, or 95% or more, for example, 98% or 99% identity with the full-length native polypeptide sequence. Variants may also include variant fragments of a reference, e.g., native, sequence sharing a sequence identity of 70% or more with a fragment of the reference, e.g., native, sequence, e.g., an identity of 75% or 80% or more, such as 85%, 90%, or 95% or more, for example, 98% or 99% identity with the native sequence.
[0090] Operatively linked or operably linked refers to a juxtaposition of genetic elements, wherein the elements are in a relationship permitting them to operate in the expected manner. For instance, a promoter is operatively linked to a coding region if the promoter helps initiate transcription of the coding sequence. There may be intervening residues between the promoter and coding region so long as this functional relationship is maintained.
[0091] As used herein, the terms polypeptide, peptide, and protein refer to polymers of amino acids of any length. The terms also encompass an amino acid polymer that has been modified; for example, to include disulfide bond formation, glycosylation, lipidation, phosphorylation, or conjugation with a labeling component.
[0092] The term polynucleotide refers to a polymeric form of nucleotides of any length, including deoxyribonucleotides or ribonucleotides, or analogs thereof. A polynucleotide may comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs, and may be interrupted by non-nucleotide components. If present, modifications to the nucleotide structure may be imparted before or after assembly of the polymer. The term polynucleotide, as used herein, refers interchangeably to double-stranded and single-stranded molecules. Unless otherwise specified or required, any embodiment of the invention described herein that is a polynucleotide encompasses both the double-stranded form and each of two complementary single-stranded forms known or predicted to make up the double-stranded form.
[0093] A polynucleotide or polypeptide has a certain percent sequence identity to another polynucleotide or polypeptide, meaning that, when aligned, that percentage of bases or amino acids are the same when comparing the two sequences. The terms identical or identity when used in the context of two or more nucleic acids or polypeptide sequences, refer to the number or percentage of residues that are the same in a sequence of interest and a reference sequence. The percentage can be calculated by optimally aligning the sequence of interest to the reference sequence; comparing the two sequences over the entire length of the reference sequence; determining the number of positions at which the identical amino acid residue or nucleic acid base occurs in both sequences to yield the number of matched positions; dividing the number of matched positions by the total number of positions in the reference sequence adjusted by adding the number of gap positions introduced into the reference sequence in generating the alignment; and multiplying the result by 100 to yield the percentage of sequence identity. When comparing DNA and RNA, thymine (T) and uracil (U) can be considered equivalent Sequence identity may be determined by using the stand-alone executable BLAST engine program for blasting two sequences (bl2seq), which can be retrieved from the National Center for Biotechnology Information (NCBI) ftp site or over the worldwide web at ncbi.nlm.nih.gov/BLAST/, using the default parameters (Tatusova and Madden, FEMS Microbiol Lett., 1999, 174, 247-250; which is incorporated herein by reference in its entirety).
[0094] A promoter as used herein encompasses a DNA sequence that directs the binding of RNA polymerase and thereby promotes RNA synthesis, i.e., a minimal sequence sufficient to direct transcription. Promoters and corresponding protein or polypeptide expression may be ubiquitous, meaning strongly active in a wide range of cells, tissues and species or cell-type specific, tissue-specific, or species specific. Promoters may be constitutive, meaning continually active, or inducible, meaning the promoter can be activated or deactivated by the presence or absence of biotic or abiotic factors. Also included in the nucleic acid constructs or vectors of the invention are enhancer sequences that may or may not be contiguous with the promoter sequence. Enhancer sequences influence promoter-dependent gene expression and may be located in the 5 or 3 regions of the native gene.
[0095] Recombinant, as applied to a polynucleotide means that the polynucleotide is the product of various combinations of cloning, restriction or ligation steps, and other procedures that result in a construct that is distinct from a polynucleotide found in nature.
[0096] As used herein Sjgren's syndrome or Sjogren's syndrome is a chronic autoimmune disease affecting the lacrimal and salivary glands, defined according to customary international diagnostic criteria such as described in Vitali et al (2002) Ann. Rheum. Dis. 61:554. Sjgren's syndrome is one of two major subclasses of aqueous-deficient dry-eye diseases, distinguished from non-Sjgren's syndrome type.
[0097] As used herein, SWAP (Surrozen WNT-signal activating proteins) refers to WNT mimetic compounds comprising engineered bi-specific full-length immunoglobulin-G (IgG) antibodies that, like WNT proteins, directly activate the canonical WNT-signaling pathway in a target tissue, e.g., lacrimal gland tissue.
[0098] As used herein, SWEETS (Surrozen WNT-signal enhancer engineered for tissue specificity) refers to antibody-based R-spondin mimetic compounds as described in US20200048324.
[0099] The terms treatment, treating and the like are used herein to generally mean obtaining a desired pharmacologic and/or physiologic effect. The effect may be prophylactic in terms of completely or partially preventing a disease or symptom thereof, e.g., reducing the likelihood that the disease or symptom thereof occurs in the subject, and/or may be therapeutic in terms of a partial or complete cure for a disease and/or adverse effect attributable to the disease. Treatment as used herein covers any treatment of a disease in a mammal and includes: (a) inhibiting the disease, i.e., arresting or slowing its development; or (b) relieving the disease, i.e., causing regression or reduction of the disease or reducing the severity of the disease. The therapeutic agent may be administered before, during or after the onset of disease or injury. The treatment of ongoing disease, where the treatment stabilizes or reduces the undesirable clinical symptoms of the patient, is of particular interest. Such treatment is desirably performed prior to complete loss of function in the affected tissues. The subject therapy will desirably be administered during the symptomatic stage of the disease, and in some cases after the symptomatic stage of the disease.
[0100] The practice of the present invention will employ, unless otherwise indicated, conventional techniques of cell biology, molecular biology techniques), microbiology, biochemistry and immunology, which are within the scope of those of skill in the art. Such techniques are explained fully in the literature, such as, Molecular Cloning: A Laboratory Manual, second edition (Sambrook et al., 1989); Oligonucleotide Synthesis (M. J. Gait, ed., 1984); Animal Cell Culture (R. I. Freshney, ed., 1987); Methods in Enzymology (Academic Press, Inc.); Handbook of Experimental Immunology (D. M. Weir & C. C. Blackwell, eds.); Gene Transfer Vectors for Mammalian Cells (J. M. Miller & M. P. Calos, eds., 1987); Current Protocols in Molecular Biology (F. M. Ausubel et al., eds., 1987); PCR: The Polymerase Chain Reaction, (Mullis et al., eds., 1994); and Current Protocols in Immunology (J. E. Coligan et al., eds., 1991), each of which is expressly incorporated by reference herein.
[0101] Several aspects of the invention are described below with reference to example applications for illustration. It should be understood that numerous specific details, relationships, and methods are set forth to provide a full understanding of the invention. One having ordinary skill in the relevant art, however, will readily recognize that the invention can be practiced without one or more of the specific details or with other methods. The present invention is not limited by the illustrated ordering of acts or events, as some acts may occur in different orders and/or concurrently with other acts or events. Furthermore, not all illustrated acts or events are required to implement a methodology in accordance with the present invention.
[0102] The terminology used herein is for the purpose of describing particular embodiments only and is not intended to be limiting of the invention. As used herein, the singular forms a, an and the are intended to include the plural forms as well, unless the context clearly indicates otherwise. Furthermore, to the extent that the terms including, includes, having, has, with, or variants thereof are used in either the detailed description and/or the claims, such terms are intended to be inclusive in a manner similar to the term comprising.
[0103] The term about or approximately means within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, i.e., the limitations of the measurement system. For example, about can mean within 1 or more than 1 standard deviation, per the practice in the art. Alternatively, about can mean a range of up to 20%, preferably up to 10%, more preferably up to 5%, and more preferably still up to 1% of a given value. Alternatively, particularly with respect to biological systems or processes, the term can mean within an order of magnitude, preferably within 5-fold, and more preferably within 2-fold, of a value. Where particular values are described in the application and claims, unless otherwise stated the term about meaning within an acceptable error range for the particular value should be assumed.
[0104] All publications mentioned herein are incorporated herein by reference to disclose and describe the methods and/or materials in connection with which the publications are cited. It is understood that the present disclosure supersedes any disclosure of an incorporated publication to the extent there is a contradiction.
[0105] It is further noted that the claims may be drafted to exclude any optional element. As such, this statement is intended to serve as antecedent basis for use of such exclusive terminology as solely, only and the like in connection with the recitation of claim elements, or the use of a negative limitation.
[0106] Unless otherwise indicated, all terms used herein have the same meaning as they would to one skilled in the art and the practice of the present invention will employ, conventional techniques of microbiology and recombinant DNA technology, which are within the knowledge of those of skill of the art.
II. General
[0107] The present invention provides methods of modulating WNT signals to treat lacrimal gland disorders due to, including but not limited to, Sjgren's syndrome disorder, chronic graft versus host disease (cGHVD), rheumatoid arthritis (RA), Stephen's Johnson syndrome, Ocular Rosacea, chemotherapy, radiation oncology treatments, diabetes, roasacea, lupus, etc.
[0108] WNT (Wingless-related integration site or Wingless and Int-1 or Wingless-Int) ligands and their signals play key roles in the control of development, homeostasis and regeneration of many essential organs and tissues, including bone, liver, skin, stomach, intestine, kidney, central nervous system, mammary gland, taste bud, ovary, cochlea, lung, and many other tissues (reviewed, e.g., by Clevers, Loh, and Nusse, 2014; 346:1248012). Modulation of WNT signaling pathways has potential for treatment of degenerative diseases and tissue injuries.
[0109] One of the challenges for modulating WNT signaling as a therapeutic is the existence of multiple WNT ligands and WNT receptors, Frizzled 1-10 (Fzd1-10), with many tissues expressing multiple and overlapping Fzds. Canonical WNT signals also involve Low-density lipoprotein (LDL) receptor-related protein 5 (LRP5) or Low-density lipoprotein (LDL) receptor-related protein 6 (LRP6) as co-receptors, which are broadly expressed in various tissues, in addition to Fzds. R-spondins 1-4 are a family of ligands that amplify WNT signals. Each of the R-spondins work through a receptor complex that contains Zinc and Ring Finger 3 (ZNRF3) or Ring Finger Protein 43 (RNF43) on one end and a Leucine-rich repeat-containing G-protein coupled receptor 4-6 (LGR4-6) on the other (reviewed, e.g., by Knight & Hankenson 2014, Matrix Biol.; 37: 157-161). R-spondins might also work through additional mechanisms of action. ZNRF3 and RNF43 are two membrane-bound E3 ligases specifically targeting WNT receptors (Fzd1-10 and LRP5 or LRP6) for degradation. Binding of an R-spondin to ZNRF3/RNF43 and LGR4-6 causes clearance or sequestration of the ternary complex, which removes E3 ligases from WNT receptors and stabilizes WNT receptors, resulting in enhanced WNT signals. Each R-spondin contains two Furin domains (1 and 2), with Furin domain 1 binding to ZNRF3/RNF43, and Furin domain 2 binding to LGR4-6. Fragments of R-spondins containing Furin domains 1 and 2 are sufficient for amplifying WNT signaling. While R-spondin effects depend on WNT signals, since both LGR4-6 and ZNRF3/RNF43 are widely expressed in various tissues, the effects of R-spondins are not tissue-specific.
[0110] Activating WNT signaling by a WNT agonist may be used for the treatment of a variety of lacrimal gland diseases and disorders, including dry-eye diseases. Similarly, amplifying WNT signaling by RSPO or an RSPO mimetic may be used for the treatment of a variety of lacrimal gland diseases and disorders, including various dry eye and salivary gland diseases. A WNT agonist molecule may also be used for the treatment of dry eye and salivary gland disorders. In particular, active WNT signaling can provide a major stem cell maintenance signal and plays a key role in regulating regeneration of the acinar cells, e.g., in salivary glands.
III. Engineered WNT Agonists
[0111] The present disclosure provides engineered WNT agonists and contemplates the use of engineered WNT agonists to stimulate, agonize, or promote WNT signaling, e.g., through the canonical WNT/-catenin signaling pathway. Such engineered WNT agonists may also be referred to as WNT/-catenin signaling agonists or Wnt mimetics.
[0112] The disclosure provides engineered Wnt mimetics with drug-like properties, particularly in the form of recombinant, bi-specific antibodies that bring together Fzd and Lrp to stimulate signaling, mimicking endogenous Wnt ligands. The Wnt mimetics of the disclosure may freely diffuse, access damaged tissues and guide tissue repair where Wnt signals are needed. The disclosure also provides Wnt mimetics that are capable of repairing damaged lacrimal or salivary gland tissue without being combined with RSPO.
[0113] In some embodiments, the WNT/-catenin signaling antagonist or agonist can include binding agents or epitope binding domains that bind one or more Fzd receptors and inhibit or enhance WNT signaling. In certain embodiments, the agent or antibody specifically binds to the cysteine-rich domain (CRD) within the human frizzled receptor(s) to which it binds. Additionally, antagonistic binding agents containing epitope binding domains against LRP can also be used. In some embodiments, the WNT/-catenin antagonist possesses binding agents or epitope binding domains that bind E3 ligases ZNRF3/RNF43 and one or more FZD receptors or one or more LRP co-receptors to promote the degradation of FZD or LRP receptors, and this molecule can also contain a binding domain that binds a cell type specific epitope for targeting. The E3 ligase agonist antibodies or fragments thereof can be single molecules or combined with other WNT antagonists, e.g., Fzd receptor antagonists, LRP receptor antagonists, etc.
[0114] As is well known in the art, an antibody is an immunoglobulin molecule capable of specific binding to a target such as a carbohydrate, polynucleotide, lipid, polypeptide, etc., through at least on epitope binding domain, located on the variable region of the immunoglobulin molecule. As used herein, the term encompasses not only intact polyclonal or monoclonal antibodies, but also fragments thereof containing epitope binding domains (e.g., dAb, Fab, Fab, (F(ab)2, Fv, single chain (scFv), VHH (i.e., Nanobodies) or single domain antibodies (sdAb), DVD-Igs (also known as Fv-Igs), synthetic variants thereof, naturally occurring variants, fusion proteins comprising and epitope binding domain, humanized antibodies, chimeric antibodies, and any other modified configuration of the immunoglobulin molecule that comprises an antigen-binding site or fragment (epitope recognition site) of the required specificity. Diabodies, multivalent or multispecific fragments constructed by gene fusion (WO94/13804; P. Holliger et al., Proc. Natl. Acad. Sci. USA 90 6444-6448, 1993) are also a particular form of antibody contemplated herein. Minibodies comprising a scFv joined to a CH3 domain are also included herein (S. Hu et al., Cancer Res., 56, 3055-3061, 1996). See e.g., Ward, E. S. et al., Nature 341, 544-546 (1989); Bird et al., Science, 242, 423-426, 1988; Huston et al., Proc. Natl. Acad. Sci. USA, 85, 5879-5883, 1988); PCT/US92/09965; WO94/13804; P. Holliger et al., Proc. Natl. Acad. Sci. USA 90 6444-6448, 1993; Y. Reiter et al., Nature Biotech, 14, 1239-1245, 1996; S. Hu et al., Cancer Res., 56, 3055-3061, 1996; C. Bever et al., Anal Bioanal Chem. 2016 September; 408(22); 5985-6002.
[0115] The proteolytic enzyme papain preferentially cleaves IgG molecules to yield several fragments, two of which (the F(ab) fragments) each comprise a covalent heterodimer that includes an intact antigen-binding site. The enzyme pepsin is able to cleave IgG molecules to provide several fragments, including the F(ab)2 fragment which comprises both antigen-binding sites. An Fv fragment for use according to certain embodiments of the present disclosure can be produced by preferential proteolytic cleavage of an IgM, and on rare occasions of an IgG or IgA immunoglobulin molecule. Fv fragments are, however, more commonly derived using recombinant techniques known in the art. The Fv fragment includes a non-covalent VH::VL heterodimer including an antigen-binding site which retains much of the antigen recognition and binding capabilities of the native antibody molecule. Inbar et al. (1972) Proc. Nat. Acad. Sci. USA 69:2659-2662; Hochman et al. (1976) Biochem 15:2706-2710; and Ehrlich et al. (1980) Biochem 19:4091-4096.
[0116] In certain embodiments, single chain Fv or scFV antibodies are contemplated. For example, Kappa bodies (Ill et al., Prot. Eng. 10: 949-57 (1997)); minibodies (Martin et al., EMBO J 13: 5305-9 (1994)); diabodies (Holliger et al., Proc. Nat. Acad. Sci. 90: 6444-8 (1993)); or Janusins (Traunecker et al., EMBO J 10: 3655-59 (1991) and Traunecker et al., Int. J. Cancer Suppl. 7: 51-52 (1992)), may be prepared using standard molecular biology techniques following the teachings of the present application with regard to selecting antibodies having the desired specificity. In still other embodiments, bispecific or chimeric antibodies may be made that encompass the ligands of the present disclosure. For example, a chimeric antibody may comprise CDRs and framework regions from different antibodies, while bispecific antibodies may be generated that bind specifically to one or more Fzd receptors through one binding domain and to a second molecule through a second binding domain. These antibodies may be produced through recombinant molecular biological techniques or may be physically conjugated together.
[0117] A single chain Fv (scFv) polypeptide is a covalently linked VH:VL heterodimer which is expressed from a gene fusion including VH- and VL-encoding genes linked by a peptide-encoding linker. Huston et al. (1988) Proc. Nat. Acad. Sci. USA 85(16):5879-5883. A number of methods have been described to discern chemical structures for converting the naturally aggregatedbut chemically separatedlight and heavy polypeptide chains from an antibody V region into an scFv molecule which will fold into a three-dimensional structure substantially similar to the structure of an antigen-binding site. See, e.g., U.S. Pat. Nos. 5,091,513 and 5,132,405, to Huston et al.; and U.S. Pat. No. 4,946,778, to Ladner et al.
[0118] In certain embodiments, an antibody as described herein is in the form of a diabody. Diabodies are multimers of polypeptides, each polypeptide comprising a first domain comprising a binding region of an immunoglobulin light chain and a second domain comprising a binding region of an immunoglobulin heavy chain, the two domains being linked (e.g., by a peptide linker) but unable to associate with each other to form an antigen binding site: antigen binding sites are formed by the association of the first domain of one polypeptide within the multimer with the second domain of another polypeptide within the multimer (WO94/13804).
[0119] A dAb fragment of an antibody consists of a VH domain (Ward, E. S. et al., (1989) Nature 341:544-546).
[0120] Where bispecific antibodies are to be used, these may be conventional bispecific antibodies, which can be manufactured in a variety of ways (Holliger, P. & Winter G., Curr. Opin. Biotech. 4, 446-449 (1993)), e.g., prepared chemically or from hybrid hybridomas, or may be any of the bispecific antibody fragments mentioned above. Diabodies and scFv can be constructed without an Fc region, using only variable domains, potentially reducing the effects of anti-idiotypic reaction.
[0121] Bispecific diabodies, as opposed to bispecific whole antibodies, may also be particularly useful because they can be readily constructed and expressed in E. coli. Diabodies (and many other polypeptides such as antibody fragments) of appropriate binding specificities can be readily selected using phage display (WO94/13804) from libraries. If one arm of the diabody is to be kept constant, for instance, with a specificity directed against antigen X, then a library can be made where the other arm is varied and an antibody of appropriate specificity selected. Bispecific whole antibodies may be made by knobs-into-holes engineering (J. B. B. Ridgeway et al., Protein Eng., 9, 616-621 (1996)).
[0122] In certain embodiments, the antibodies described herein may be provided in the form of a UniBody. A UniBody is an IgG4 antibody with the hinge region removed (see GenMab Utrecht, The Netherlands; see also, e.g., US2009/0226421). This proprietary antibody technology creates a stable, smaller antibody format with an anticipated longer therapeutic window than current small antibody formats. IgG4 antibodies are considered inert and thus do not interact with the immune system. Fully human IgG4 antibodies may be modified by eliminating the hinge region of the antibody to obtain half-molecule fragments having distinct stability properties relative to the corresponding intact IgG4 (GenMab, Utrecht). Halving the IgG4 molecule leaves only one area on the UniBody that can bind to cognate antigens (e.g., disease targets) and the UniBody therefore binds univalently to only one site on target cells.
[0123] In certain embodiments, antibodies and antigen-binding fragments thereof as described herein include a heavy chain and a light chain CDR set, respectively interposed between a heavy chain and a light chain framework region (FR) set which provide support to the CDRs and define the spatial relationship of the CDRs relative to each other. As used herein, the term CDR set refers to the three hypervariable regions of a heavy or light chain V region. Proceeding from the N-terminus of a heavy or light chain, these regions aredenoted as CDR1, CDR2, and CDR3 respectively. An antigen-binding site, therefore, includes six CDRs, comprising the CDR set from each of a heavy and a light chain V region. A polypeptide comprising a single CDR, (e.g., a CDR1, CDR2 or CDR3) is referred to herein as a molecular recognition unit. Crystallographic analysis of a number of antigen-antibody complexes has demonstrated that the amino acid residues of CDRs form extensive contact with bound antigen, wherein the most extensive antigen contact is with the heavy chain CDR3. Thus, the molecular recognition units are primarily responsible for the specificity of an antigen-binding site.
[0124] As used herein, the term FR set refers to the four flanking amino acid sequences which frame the CDRs of a CDR set of a heavy or light chain V region. Some FR residues may contact bound antigen; however, FRs are primarily responsible for folding the V region into the antigen-binding site, particularly the FR residues directly adjacent to the CDRs. Within FRs, certain amino residues and certain structural features are very highly conserved. In this regard, all V region sequences contain an internal disulfide loop of around 90 amino acid residues. When the V regions fold into a binding-site, the CDRs are displayed as projecting loop motifs which form an antigen-binding surface. It is generally recognized that there are conserved structural regions of FRs which influence the folded shape of the CDR loops into certain canonical structures-regardless of the precise CDR amino acid sequence. Further, certain FR residues are known to participate in non-covalent interdomain contacts which stabilize the interaction of the antibody heavy and light chains.
[0125] A monoclonal antibody refers to a homogeneous antibody population wherein the monoclonal antibody is comprised of amino acids (naturally occurring and non-naturally occurring) that are involved in the selective binding of an epitope. Monoclonal antibodies are highly specific, being directed against a single epitope. The term monoclonal antibody encompasses not only intact monoclonal antibodies and full-length monoclonal antibodies, but also fragments thereof (such as Fab, Fab, F(ab)2, Fv), single chain (scFv), Nanobodies, variants thereof, fusion proteins comprising an antigen-binding fragment of a monoclonal antibody, humanized monoclonal antibodies, chimeric monoclonal antibodies, and any other modified configuration of the immunoglobulin molecule that comprises an antigen-binding fragment (epitope recognition site) of the required specificity and the ability to bind to an epitope, including WNT surrogate molecules disclosed herein. It is not intended to be limited as regards the source of the antibody or the manner in which it is made (e.g., by hybridoma, phage selection, recombinant expression, transgenic animals, etc.). The term includes whole immunoglobulins as well as the fragments etc. described above under the definition of antibody.
[0126] In certain embodiments, the antibodies of the present disclosure may take the form of a single domain antibody (sdAb). SdAb technology was originally developed following the discovery and identification that camelidae (e.g., camels, alpacas, and llamas) possess fully functional antibodies that consist of heavy chains only and therefore lack light chains. These heavy-chain only antibodies contain a single variable domain (VHH) and two constant domains (CH2, CH3). The cloned and isolated single variable domains have full antigen binding capacity and are very stable. These single variable domains, with their unique structural and functional properties, form the basis of sdAbs. SdAb are encoded by single genes and are efficiently produced in almost all prokaryotic and eukaryotic hosts, e.g., E. coli (see, e.g., U.S. Pat. No. 6,765,087), molds (for example Aspergillus or Trichoderma) and yeast (for example Saccharomyces, Kluyvermyces, Hansenula, or Pichia (see, e.g., U.S. Pat. No. 6,838,254). The production process is scalable and multi-kilogram quantities of sdAbs have been produced. SdAbs may be formulated as a ready-to-use solution having a long shelf life. The Nanoclone method (see, e.g., WO 06/079372) is a proprietary method for generating sdAbs against a desired target, based on automated high-throughput selection of B-cells. SdAb are single-domain antigen-binding fragments of camelid-specific heavy-chain only antibodies. sdAb, also referred to as VHH antibodies, typically have a small size of around 15 kDa. See C. Bever et al., Anal Bioanal Chem. 2016 September; 408(22); 5985-6002.
[0127] Another antibody fragment contemplated is a dual-variable domain-immunoglobulin (DVD-Ig or Fv-Ig) is an engineered protein that combines the function and specificity of two monoclonal antibodies in one molecular entity. An Fv-Igis designed as an IgG-like molecule, except that each light chain and heavy chain contains two variable domains in tandem through a short peptide linkage, instead of one variable domain in IgG. The fusion orientation of the two variable domains and the choice of linker sequence are critical to functional activity and efficient expression of the molecule. An Fv-Ig can be produced by conventional mammalian expression systems as a single species for manufacturing and purification. An Fv-Ig has the specificity of the parental antibodies, is stable in vivo, and exhibits IgG-like physicochemical and pharmacokinetic properties. Fv-Igs and methods for making them are described in Wu, C., et al., Nat Biotech, 25:1290-1297 (2007)).
[0128] In certain embodiments, the antibodies or antigen-binding fragments thereof as disclosed herein are humanized. This refers to a chimeric molecule, generally prepared using recombinant techniques, having an antigen-binding site derived from an immunoglobulin from a non-human species and the remaining immunoglobulin structure of the molecule based upon the structure and/or sequence of a human immunoglobulin. The antigen-binding site may comprise either complete variable domains fused onto constant domains or only the CDRs grafted onto appropriate framework regions in the variable domains. Epitope binding sites may be wild type or modified by one or more amino acid substitutions. This eliminates the constant region as an immunogen in human individuals, but the possibility of an immune response to the foreign variable region remains (LoBuglio, A. F. et al., (1989) Proc Natl Acad Sci USA 86:4220-4224; Queen et al., PNAS (1988) 86:10029-10033; Riechmann et al., Nature (1988) 332:323-327). Illustrative methods for humanization of the anti-Fzd or LRP antibodies disclosed herein include the methods described in U.S. Pat. No. 7,462,697.
[0129] Another approach focuses not only on providing human-derived constant regions but modifying the variable regions as well so as to reshape them as closely as possible to human form. It is known that the variable regions of both heavy and light chains contain three complementarity-determining regions (CDRs) which vary in response to the epitopes in question and determine binding capability, flanked by four framework regions (FRs) which are relatively conserved in a given species and which putatively provide a scaffolding for the CDRs. When nonhuman antibodies are prepared with respect to a particular epitope, the variable regions can be reshaped or humanized by grafting CDRs derived from nonhuman antibody on the FRs present in the human antibody to be modified. Application of this approach to various antibodies has been reported by Sato, K., et al., (1993) Cancer Res 53:851-856; Riechmann, L., et al., (1988) Nature 332:323-327; Verhoeyen, M., et al., (1988) Science 239:1534-1536; Kettleborough, C. A., et al., (1991) Protein Engineering 4:773-3783; Maeda, H., et al., (1991) Human Antibodies Hybridoma 2:124-134; Gorman, S. D., et al., (1991) Proc Natl Acad Sci USA 88:4181-4185; Tempest, P. R., et al., (1991) Bio Technology 9:266-271; Co, M. S., et al., (1991) Proc Natl Acad Sci USA 88:2869-2873; Carter, P., et al., (1992) Proc Natl Acad Sci USA 89:4285-4289; and Co, M. S. et al., (1992) J Immunol 148:1149-1154. In some embodiments, humanized antibodies preserve all CDR sequences (for example, a humanized mouse antibody which contains all six CDRs from the mouse antibodies). In other embodiments, humanized antibodies have one or more CDRs (one, two, three, four, five, six) which are altered with respect to the original antibody, which are also termed one or more CDRs derived from one or more CDRs from the original antibody.
[0130] In certain embodiments, the antibodies of the present disclosure may be chimeric antibodies. In this regard, a chimeric antibody is comprised of an antigen-binding fragment of an antibody operably linked or otherwise fused to a heterologous Fc portion of a different antibody. In certain embodiments, the heterologous Fc domain is of human origin. In other embodiments, the heterologous Fc domain may be from a different Ig class from the parent antibody, including IgA (including subclasses IgA1 and IgA2), IgD, IgE, IgG (including subclasses IgG1, IgG2, IgG3, and IgG4), and IgM. In further embodiments, the heterologous Fc domain may be comprised of CH2 and CH3 domains from one or more of the different Ig classes. As noted above with regard to humanized antibodies, the antigen-binding fragment of a chimeric antibody may comprise only one or more of the CDRs of the antibodies described herein (e.g., 1, 2, 3, 4, 5, or 6 CDRs of the antibodies described herein), or may comprise an entire variable domain (VL, VH or both).
[0131] The structures and locations of immunoglobulin CDRs and variable domains may be determined by reference to Kabat, E. A. et al., S
[0132] In certain embodiments, the antagonist or agonist binding agent binds with a dissociation constant (KD) of about 1 M or less, about 100 nM or less, about 40 nM or less, about 20 nM or less, or about 10 nM or less. For example, in certain embodiments, a FZD binding agent or antibody described herein that binds to more than one FZD, binds to those FZDs with a KD of about 100 nM or less, about 20 nM or less, or about 10 nM or less. In certain embodiments, the binding agent binds to one or more its target antigen with an EC50 of about 1 M or less, about 100 nM or less, about 40 nM or less, about 20 nM or less, about 10 nM or less, or about 1 nM 20 or less.
[0133] The antibodies or other agents of the present invention can be assayed for specific binding by any method known in the art. The immunoassays which can be used include, but are not limited to, competitive and non-competitive assay systems using techniques such as biolayer interferometry (BLI) analysis, FACS analysis, immunofluorescence, immunocytochemistry, Western blots, radioimmunoassays, ELISA, sandwich immunoassays, immunoprecipitation assays, precipitation reactions, gel diffusion precipitin reactions, immunodiffusion assays, agglutination assays, complement-fixation assays, immunoradiometric assays, fluorescent immunoassays, and protein A immunoassays. Such assays are routine and well known in the art (see, e.g., Ausubel et al, eds, 1994, C
[0134] For example, the specific binding of an antibody to a target antigen may be determined using ELISA. An ELISA assay comprises preparing antigen, coating wells of a 96 well microtiter plate with antigen, adding the antibody or other binding agent conjugated to a detectable compound such as an enzymatic substrate (e.g., horse-radish peroxidase or alkaline phosphatase) to the well, incubating for a period of time and detecting the presence of the antigen. In some embodiments, the antibody or agent is not conjugated to a detectable compound, but instead a second conjugated antibody that recognizes the first antibody or agent is added to the well. In some embodiments, instead of coating the well with the antigen, the antibody or agent can be coated to the well and a second antibody conjugated to a detectable compound can be added following the addition of the antigen to the coated well. One of skill in the art would be knowledgeable as to the parameters that can be modified to increase the signal detected as well as other variations of ELISAs known in the art (see, e.g., Ausubel et al, eds, 1994, C
[0135] The binding affinity of an antibody or other agent to a target antigen and the off-rate of the antibody-antigen interaction can be determined by competitive binding assays. One example of a competitive binding assay is a radioimmunoassay comprising the incubation of labeled antigen (e.g., Fzd, LRP), or fragment or variant thereof, with the antibody of interest in the presence of increasing amounts of unlabeled antigen followed by the detection of the antibody bound to the labeled antigen. The affinity of the antibody and the binding off-rates can be determined from the data by scattered plot analysis. In some embodiments, BLI analysis is used to determine the binding on and off rates of antibodies or agents. BLI kinetic analysis comprises analyzing the binding and dissociation of antibodies from chips with immobilized antigens on their surface.
IV. Compositions of Methods of Use of Wnt Agonists
[0136] The present description provides methods of treating lacrimal gland diseases and disorders, including but not limited to dry-eye disorders, e.g., by activation and/or regeneration of lacrimal gland acinar cells, and compositions therefor.
[0137] It will be readily understood to persons skilled in the art that lacrimal gland is homologous to Meibomian gland and accessory lacrimal glands, and the methods and compositions described herein may be applied for treatment of the Meibomian glands and/or accessory lacrimal glands in aqueous-deficient or evaporative dry eye. Meibomian glands are oil glands which line the margin of eyelids. These glands cause the eyelids to secrete oils that blend with natural tears, preventing excessive evaporation of the natural tears. Patients suffering from ocular rosacea often have Meibomian gland dysfunction (MGD) where the eyelids secrete fewer oils resulting dry eyes. MGD is thought to be the leading cause of dry eye disease. A WNT agonist molecule may also be used for the treatment of Meibomian gland disorders. In particular, active WNT signaling can potentially provide a maintenance signal to basal progenitor cells and plays a key role in regulating regeneration of the meibocytes (see, e.g., Parfitt et al (2016) Stem Cell Rep. 7:399-410). In one aspect, the present invention comprises a method of regenerating lacrimal gland acinar cells in a subject, comprising administering a WNT signaling modulator to the subject. In an embodiment, the WNT signaling modulator may be an engineered WNT signaling modulator such as a SWAP compound. In another embodiment, the WNT signaling modulator is an engineered WNT agonist or an engineered WNT antagonist. In yet a further embodiment, the WNT signaling modulator is a tissue-specific WNT signal enhancing molecule, such as a SWEETS molecule. A WNT signaling modulator may also be a combination of a WNT agonist and a tissue-specific WNT signal enhancer.
[0138] In particular embodiments of any of the methods disclosed herein, the WNT agonist is selected from those disclosed in any of the following: PCT Application Publication No. WO 2016/040895; US Application Publication No. US 2017-0306029; US Application Publication No. US 2017-0349659; PCT Application Publication No. WO 2019/126398; PCT Application Publication No. WO 2020/01030, PCT Application Publication No. WO 2021/173726, or U.S. application Ser. No. 17/806,624, all of which are herein incorporated by reference in their entireties. In particular embodiments of any of the methods disclosed herein, the tissue-specific WNT signal enhancing molecule is selected from those disclosed in any of the following: PCT Application Publication No. WO 2018/140821; US Application Publication No. US 2020-0048324; or PCT Application Publication No. WO 2020/14271, all of which are herein incorporated by reference in their entireties.
[0139] In an embodiment of the method of regenerating lacrimal gland acinar cells, the WNT signaling modulator may comprise at least one engineered bi-specific full-length IgG antibody that directly activates a canonical WNT signaling pathway. In any embodiment, the engineered WNT agonist may be selected from: (i) WNT3a; (ii) a WNT mimetic; or (iii) an -spondin mimetic. The WNT mimetic may be a SWAP compound. The R-spondin mimetic may be a SWEETS compound. The WNT mimetics may comprise one or more polypeptides comprising or having a polypeptide sequence set forth in any of SEQ ID Nos: 1-14 isoforms and homologs thereof, and suitable expression vectors therefor. The WNT mimetics may comprise one or more polypeptides having 80% to 100% homology with any of the polypeptide sequences set forth in SEQ ID Nos 1-14. In certain embodiments, the WNT mimetic comprises two polypeptide sequences having 80% to 100% homology with any of the polypeptide sequences set forth in SEQ ID Nos 1-14. In certain embodiments, the WNT mimetic comprises two heavy chain and two light chain polypeptide sequences, each having 80% to 100% homology with any of the polypeptide sequences set forth in SEQ ID Nos 1-14. In particular embodiments, the heavy chain and light chain polypeptides present in the WNT mimetic have at least 80%, at least 90%, at least 95%, at least 98%, or 100% identity to any of following combinations: SEQ ID NOs 1 and 2; SEQ ID NOs: 3 and 4; SEQ ID NOs: 5 and 6; SEQ ID NOs: 7 and 8; or SEQ ID NOs: 9 and 10, or SEQ ID NOs: 11 and 14, or SEQ ID NOs: 12 and 14, or SEQ ID NOs: 13 and 14. In particular embodiments, the WNT mimetic has an IgG antibody structure comprising two heavy and two light chains, wherein the two heavy chains are bound to each other, and each of the light chains is bound to a different one of the two heavy chains.
[0140] In an embodiment of the method of regenerating lacrimal gland acinar cells, the WNT signaling modulator may affect expression of any one or more of: Fzd1, Fzd2, Fzd5, Fzd7, Fzd8, and Lrp6, and/or Lrp5. For example, the WNT signaling modulator may target any one or more of the group consisting of: Fzd1, Fzd2, and Fzd7; or any one or more of the group consisting of: Fzd5 and Fzd8, while also targeting Lrp6 and/or Lrp5. For another example, the WNT signaling modulator may affect expression of any one or more of: Fzd1, Fzd2, and Fzd7.
[0141] In one embodiment of the method of regenerating lacrimal gland acinar cells, the method further comprises the step of administering at least one of the group consisting of: RSPO2, RSPO2 fragment, and engineered RSPO2 mimetic.
[0142] In some embodiment the WNT signaling modulator may be a superagonist of WNT platform. This superagonist activity was observed with LRP, FZD, and RSPO fused WNT molecule acting as a robust activator of WNT signaling pathway. the WNT superagonist is selected from those disclosed in following: PCT Application Publication No. WO 2021/173726.
[0143] In any embodiment, the WNT signaling modulator may be in a concentration 1 nM. For example, the WNT signaling modulator may be in a concentration of 1 nM, 1.1 nM, 1.5 nM, 2.0 nM, 2.5 nM, 3.0 nM, 3.5 nM, 4.0 nM, 4.5 nM, 5.0 nM. In certain embodiments, the concentration of WNT signaling modulator may be 5 nM. In any embodiment, the WNT signaling modulator may be administered in a therapeutically effective amount.
[0144] In any embodiment, the subject may be a live mammal. For example, the subject may be mouse, rat, dog, cat, horse, or cow. In any embodiment, the subject may be a human patient.
[0145] In any embodiment, the WNT signaling modulator may be administered systemically or locally. For example, the WNT signaling modulator may be administered locally via aqueous eyedrop solution or local intra-lacrimal gland injection.
[0146] In another aspect, the present invention comprises a method of treating a lacrimal gland disorder in a subject, comprising administering a WNT signaling modulator to the subject. In an embodiment, the WNT signaling modulator may be an engineered WNT signaling modulator. In another embodiment, the WNT signaling modulator is an engineered WNT agonist or an engineered WNT antagonist.
[0147] In an embodiment of the method of treating a lacrimal gland disorder, the WNT signaling modulator may comprise at least one engineered bi-specific full-length IgG antibody that directly activates a canonical WNT signaling pathway. In any embodiment, the engineered WNT agonist may be selected from: (i) WNT3a; (ii) a WNT mimetic; or (iii) an R-spondin mimetic. The WNT mimetic may be a SWAP compound. The R-spondin mimetic may be a SWEETS compound.
[0148] In an embodiment of the method of treating a lacrimal gland disorder, the WNT signaling modulator may affect expression of any one or more of: Fzd1, Fzd2, Fzd5, Fzd7, Fzd8, and Lrp6 and/or Lrp5. For example, the WNT signaling modulator may target any one or more of the group consisting of: Fzd1, Fzd2, and Fzd7; or any one or more of the group consisting of: Fzd5 and Fzd8, while also targeting Lrp6 and/or Lrp5. For another example, the WNT signaling modulator may affect expression of any one or more of: Fzd1, Fzd2, and Fzd7.
[0149] In one embodiment of the method of treating a lacrimal gland disorder, the method further comprises the step of administering at least one of the group consisting of: RSPO2, RSPO2 fragment, and engineered RSPO2 mimetic.
[0150] In any embodiment of the method of treating a lacrimal gland disorder, the WNT signaling modulator may be in a concentration 1 nM. For example, the WNT signaling modulator may be in a concentration of 1 nM, 1.1 nM, 1.5 nM, 2.0 nM, 2.5 nM, 3.0 nM, 3.5 nM, 4.0 nM, 4.5 nM, 5.0 nM. In certain embodiments, the concentration of WNT signaling modulator may be 5 nM. In any embodiment, the WNT signaling modulator may be administered in a therapeutically effective amount.
[0151] In any embodiment, the subject may be a live mammal. For example, the subject may be mouse, rat, dog, cat, horse, or cow. In any embodiment, the subject may be a human patient.
[0152] In any embodiment, the WNT signaling modulator may be administered systemically or locally. For example, the WNT signaling modulator may be administered locally via aqueous eyedrop solution or local intra-lacrimal gland injection.
[0153] In still another aspect, the present invention comprises a composition for the treatment of a dry-eye disorder in a subject, the composition comprising a WNT signaling modulator. In any embodiment of the composition, the dry-eye disorder may be a Sjgren's syndrome disorder.
[0154] In an embodiment of the composition, the WNT signaling modulator may comprise at least one engineered bi-specific full-length IgG antibody that directly activates a canonical WNT signaling pathway. The at least one engineered bi-specific full-length IgG antibody may be specific for any one or more of Fzd1, Fzd,2, Fzd5, Fzd7, Fzd8, and Lrp6 or Lrp5.
[0155] In an embodiment, the composition may further comprise an at least one additional agent, including an anti-inflammatory agent, an artificial tear agent, or an lacrimal gland secretagogue. In particular, the anti-inflammatory agent may be antibiotics or steroids including cyclosporine A (e.g., Restasis) and lifitegrast ophthalmic solution (e.g., Xiidra). Artificial tears agent may include non-prescription eye drops that simulate tears, e.g., hydroxypropyl cellulose (Lacrisert) inserts. Lacrimal gland secretagogue agents may include varenicline nasal spray, which selectively agonizes nicotinic acetylcholine receptors. Also, contemplated are autologous blood serum eye drops.
[0156] In any embodiment of the composition, the composition may comprise therapeutically effective amounts of each of its components.
[0157] In any embodiment of the composition, the subject may be a live mammal. For example, the subject may be mouse, rat, dog, cat, horse, or cow. In any embodiment of the composition, the subject may be a human patient.
[0158] In further embodiments, pharmaceutical compositions comprising an expression vector, e.g., a viral vector, comprising a polynucleotide comprising a nucleic acid sequence encoding a WNT antagonist/agonist molecule described herein and one or more pharmaceutically acceptable diluent, carrier, or excipient are also disclosed. In certain embodiments, the nucleic acid sequence encoding the WNT antagonist molecule and the nucleic acid sequence encoding the WNT agonist are in the same polynucleotide, e.g., expression cassette.
[0159] The present disclosure further contemplates a pharmaceutical composition comprising a cell comprising an expression vector comprising a polynucleotide comprising a promoter operatively linked to a nucleic acid encoding a WNT antagonist/agonist molecule and one or more pharmaceutically acceptable diluent, carrier, or excipient. In particular embodiments, the pharmaceutical composition further comprises a cell comprising an expression vector comprising a polynucleotide comprising a promoter operatively linked to a nucleic acid sequence encoding a WNT antagonist and a WNT agonist. In certain embodiments, the nucleic acid sequence encoding the WNT antagonist molecule and the nucleic acid sequence encoding the WNT agonist molecule are present in the same polynucleotide, e.g., expression cassette and/or in the same cell. In particular embodiments, the cell is a heterologous cell or an autologous cell obtained from the subject to be treated.
[0160] In particular embodiments, the cell is a stem cell, e.g., an adipose-derived stem cell or a hematopoietic stem cell. The present disclosure contemplates pharmaceutical compositions comprising a first molecule for delivery of a WNT antagonist molecule as a first active agent, and a WNT agonist as a second molecule. The first and second molecule may be the same type of molecule or different types of molecules. For example, in certain embodiments, the first and second molecule may each be independently selected from the following types of molecules: polypeptides, small organic molecules, nucleic acids encoding the first or second active agent (optionally DNA or mRNA, optionally modified RNA), vectors comprising a nucleic acid sequence encoding the first or second active agent (optionally expression vectors or viral vectors), and cells comprising a nucleic acid sequence encoding the first or second active agent (optionally an expression cassette).
[0161] The subject molecules, alone or in combination, can be combined with pharmaceutically acceptable carriers, diluents, excipients and reagents useful in preparing a formulation that is generally safe, non-toxic, and desirable, and includes excipients that are acceptable for mammalian, e.g., human or primate, use. Such excipients can be solid, liquid, semisolid, or, in the case of an aerosol composition, gaseous. Examples of such carriers, diluents and excipients include, but are not limited to, water, saline, Ringer's solutions, dextrose solution, and 5% human serum albumin. Supplementary active compounds can also be incorporated into the formulations. Solutions or suspensions used for the formulations can include a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents; antibacterial compounds such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating compounds such as ethylenediaminetetraacetic acid (EDTA); buffers such as acetates, citrates or phosphates; detergents such as Tween 20 to prevent aggregation; and compounds for the adjustment of tonicity such as sodium chloride or dextrose. The pH can be adjusted with acids or bases, such as hydrochloric acid or sodium hydroxide. In particular embodiments, the pharmaceutical compositions are sterile.
[0162] Pharmaceutical compositions may further include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion. For intravenous administration, suitable carriers include physiological saline, bacteriostatic water, or phosphate buffered saline (PBS). In some cases, the composition is sterile and should be fluid such that it can be drawn into a syringe or delivered to a subject from a syringe. In certain embodiments, it is stable under the conditions of manufacture and storage and is preserved against the contaminating action of microorganisms such as bacteria and fungi. The carrier can be, e.g., a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof. The proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants. Prevention of the action of microorganisms can be achieved by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, ascorbic acid, thimerosal, and the like. In many cases, it will be preferable to include isotonic agents, for example, sugars, polyalcohols such as mannitol, sorbitol, sodium chloride in the composition. Prolonged absorption of the internal compositions can be brought about by including in the composition an agent which delays absorption, for example, aluminum monostearate and gelatin.
[0163] Sterile solutions can be prepared by incorporating the WNT antagonist/agonist antibody or antigen-binding fragment thereof (or encoding polynucleotide or cell comprising the same) in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization. Generally, dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above. In the case of sterile powders for the preparation of sterile injectable solutions, methods of preparation are vacuum drying and freeze-drying that yields a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
[0164] In one embodiment, the pharmaceutical compositions are prepared with carriers that will protect the antibody or antigen-binding fragment thereof against rapid elimination from the body, such as a controlled release formulation, including implants and microencapsulated delivery systems. Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Methods for preparation of such formulations will be apparent to those skilled in the art. The materials can also be obtained commercially. Liposomal suspensions can also be used as pharmaceutically acceptable carriers. These can be prepared according to methods known to those skilled in the art.
[0165] It may be advantageous to formulate the pharmaceutical compositions in dosage unit form for ease of administration and uniformity of dosage. Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the subject to be treated; each unit containing a predetermined quantity of active antibody or antigen-binding fragment thereof calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier. The specification for the dosage unit forms is dictated by and directly dependent on the unique characteristics of the antibody or antigen-binding fragment thereof and the particular therapeutic effect to be achieved, and the limitations inherent in the art of compounding such an active antibody or antigen-binding fragment thereof for the treatment of individuals.
[0166] The pharmaceutical compositions can be included in a container, pack, or dispenser, e.g., eye dropper, e.g., a prefilled eye dropper, together with instructions for administration.
[0167] The pharmaceutical compositions of the present disclosure may be delivered to a subject in the form of a pill, capsule, cream, salve, syrup, dermal patch, suppository, intravenous drip, local injection aqueous solution, non-aqueous solution, eye wash solution, or any combination of thereof.
[0168] The pharmaceutical compositions of the present disclosure may be delivered to a subject by direct ophthalmic application, muscular injection, intra-lacrimal gland injection, subconjunctival injection, meibomian gland injection, intravenous injection, peritoneal injection, nasally, orally, rectally, or any combination thereof.
[0169] The pharmaceutical compositions of the present disclosure encompass any pharmaceutically acceptable salts, esters, or salts of such esters, or any other compound which, upon administration to an animal comprising a human, is capable of providing (directly or indirectly) the biologically active antibody or antigen-binding fragment thereof.
[0170] The present disclosure includes pharmaceutically acceptable salts of a WNT antagonist/agonist molecule described herein. The term pharmaceutically acceptable salt refers to physiologically and pharmaceutically acceptable salts of the compounds of the present disclosure: i.e., salts that retain the desired biological activity of the parent compound and do not impart undesired toxicological effects thereto. A variety of pharmaceutically acceptable salts are known in the art and described, e.g., in Remington's Pharmaceutical Sciences, 17th edition, Alfonso R. Gennaro (Ed.), Mark Publishing Company, Easton, PA, USA, 1985 (and more recent editions thereof), in the Encyclopedia of Pharmaceutical Technology, 3rd edition, James Swarbrick (Ed.), Informa Healthcare USA (Inc.), NY, USA, 2007, and in J. Pharm. Sci. 66:2 (1977). Also, for a review on suitable salts, see Handbook of Pharmaceutical Salts: Properties, Selection, and Use by Stahl and Wermuth (Wiley-VCH, 2002). Pharmaceutically acceptable base addition salts are formed with metals or amines, such as alkali and alkaline earth metals or organic amines.
[0171] Metals used as cations comprise sodium, potassium, magnesium, calcium, and the like. Amines comprise NN-dibenzylethylenediamine, chloroprocaine, choline, diethanolamine, dicyclohexylamine, ethylenediamine, N-methylglucamine, and procaine (see, for example, Berge et al., Pharmaceutical Salts, J. Pharma Sci., 1977, 66, 119). The base addition salts of said acidic compounds are prepared by contacting the free acid form with a sufficient amount of the desired base to produce the salt in the conventional manner. The free acid form may be regenerated by contacting the salt form with an acid and isolating the free acid in the conventional manner. The free acid forms differ from their respective salt forms somewhat in certain physical properties such as solubility in polar solvents, but otherwise the salts are equivalent to their respective free acid for purposes of the present disclosure.
[0172] In some embodiments, the pharmaceutical composition provided herein comprise a therapeutically effective amount of a WNT antagonist/agonist molecule or pharmaceutically acceptable salt thereof in admixture with a pharmaceutically acceptable carrier, diluent and/or excipient, for example saline, phosphate buffered saline, phosphate and amino acids, polymers, polyols, sugar, buffers, preservatives and other proteins. Exemplary amino acids, polymers and sugars and the like are octylphenoxy polyethoxy ethanol compounds, polyethylene glycol monostearate compounds, polyoxyethylene sorbitan fatty acid esters, sucrose, fructose, dextrose, maltose, glucose, mannitol, dextran, sorbitol, inositol, galactitol, xylitol, lactose, trehalose, bovine or human serum albumin, citrate, acetate, Ringer's and Hank's solutions, cysteine, arginine, carnitine, alanine, glycine, lysine, valine, leucine, polyvinylpyrrolidone, polyethylene and glycol. Preferably, this formulation is stable for at least six months at 4 C.
[0173] In some embodiments, the pharmaceutical composition provided herein comprises a buffer, such as phosphate buffered saline (PBS) or sodium phosphate/sodium sulfate, tris buffer, glycine buffer, sterile water and other buffers known to the ordinarily skilled artisan such as those described by Good et al. (1966) Biochemistry 5:467. The pH of the buffer may be in the range of 6.5 to 7.75, preferably 7 to 7.5, and most preferably 7.2 to 7.4.
[0174] From the foregoing it will be appreciated that, although specific embodiments of the present disclosure have been described herein for purposes of illustration, various modifications may be made without deviating from the spirit and scope of the present disclosure. Accordingly, the present disclosure is not limited except as by the appended claims.
[0175] The broad scope of this invention is best understood with reference to the following example, which is not intended to limit the inventions to the specific embodiments.
Examples
I. Methods
[0176] Standard methods in molecular biology were used, including methods described, e.g., in Maniatis et al. (1982) Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.; Sambrook and Russell (2001) Molecular Cloning, 3.sup.rd ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.; Wu (1993) Recombinant DNA, Vol. 217, Academic Press, San Diego, Calif Standard methods also appear in Ausbel et al. (2001) Current Protocols in Molecular Biology, Vols. 1-4, John Wiley and Sons, Inc. New York, N.Y., which describes cloning in bacterial cells and DNA mutagenesis (Vol. 1), cloning in mammalian cells and yeast (Vol. 2), glycoconjugates and protein expression (Vol. 3), and bioinformatics (Vol. 4).
[0177] Methods for protein purification including immunoprecipitation, chromatography, electrophoresis, centrifugation, and crystallization are described, e.g., in Coligan et al. (2000) Current Protocols in Protein Science, Vol. 1, John Wiley and Sons, Inc., New York. Chemical analysis, chemical modification, post-translational modification, production of fusion proteins, glycosylation of proteins are described in, e.g., Coligan et al. (2000) Current Protocols in Protein Science, Vol. 2, John Wiley and Sons, Inc., New York; Ausubel et al. (2001) Current Protocols in Molecular Biology, Vol. 3, John Wiley and Sons, Inc., NY, N.Y., pp. 16.0.5-16.22.17; Sigma-Aldrich, Co. (2001) Products for Life Science Research, St. Louis, Mo.; pp. 45-89; Amersham Pharmacia Biotech (2001) BioDirectory, Piscataway, N.J., pp. 384-391. Production, purification, and fragmentation of polyclonal and monoclonal antibodies are described, e.g., in Coligan et al. (2001) Current Protocols in Immunology, Vol. 1, John Wiley and Sons, Inc., New York; Harlow and Lane (1999) Using Antibodies, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.; Harlow and Lane, supra. Standard techniques for characterizing ligand/receptor interactions are available in, e.g., Coligan et al. (2001) Current Protocols in Immunology, Vol. 4, John Wiley, Inc., New York.
[0178] Methods for flow cytometry, including fluorescence activated cell sorting detection systems (FACS), are available in, e.g., Owens et al. (1994) Flow Cytometry Principles for Clinical Laboratory Practice, John Wiley and Sons, Hoboken, N.J.; Givan (2001) Flow Cytometry, 2.sup.nd ed.; Wiley-Liss, Hoboken, N.J.; Shapiro (2003) Practical Flow Cytometry, John Wiley and Sons, Hoboken, N.J. Fluorescent reagents suitable for modifying nucleic acids, including nucleic acid primers and probes, polypeptides, and antibodies, for use, e.g., as diagnostic reagents, are available In, e.g., Molecular Probes (2003) Catalogue, Molecular Probes, Inc., Eugene, Oreg.; Sigma-Aldrich (2003) Catalogue, St. Louis, Mo.
[0179] Standard methods of histology of the immune system are described in, e.g., Muller-Harmelink (ed.) (1986) Human Thymus: Histopathology and Pathology, Springer Verlag, New York, N.Y.; Hiatt, et al. (2000) Color Atlas of Histology, Lippincott, Williams, and Wilkins, Phila, Pa.; Louis, et al. (2002) Basic Histology: Text and Atlas, McGraw-Hill, New York, N.Y.
[0180] Software packages and databases for determining, e.g., antigenic fragments, leader sequences, protein folding, functional domains, glycosylation sites, and sequence alignments, are available, in, e.g., GenBank, Vector NTI Suite (Informax, Inc, Bethesda, Md.); GCG Wisconsin Package (Accelrys, Inc., San Diego, Calif); DeCypher (TimeLogic Corp., Crystal Bay, Nev.); Menne et al. (2000) Bioinformatics 16: 741-742; Menne et al. (2000) Bioinformatics Applications Note 16:741-742; Wren et al. (2002) Comput. Methods Programs Biomed. 68:177-181; von Heijne (1983) Eur. J. Biochem. 133:17-21; von Heijne (1986) Nucleic Acids Res. 14:4683-4690.
II. Organoid Establishment and Expansion
[0181] Lacrimal glands and salivary glands from wildtype C57BL/6 mice were dissected and stored in Advanced DMEM/F12 (GIBCO) on ice. Multiple murine lacrimal glands or salivary glands were pooled in a petri dish and muscle, ducts and connective tissue were removed and discarded as much as possible. The remaining glandular epithelium was chopped into approximately 1 mm pieces using a scalpel. The tissue pieces were enzymatically digested in collagenase (Sigma-Aldrich, C9407, 1 mg/mL) solution containing 10 M ROCK inhibitor Y-27632 (Abmole, M1817) in Advanced DMEM/F12 (GIBCO) for about 15 minutes shaking at 37 C. The homogeneous cell suspension was pelleted (1200 rpm for 5 minutes) and washed twice with Advanced DMEM/F12 prior to plating. The same protocol was applied to human post-mortem lacrimal gland material. Cells were plated in 20 L droplets of Cultrex Pathclear Reduced Growth Factor Basement Membrane Extract (BME) (3533-001, Amsbio) or Matrigel GFR Membrane Matrix (Corning CB40230C). After a 15-minute solidification, expansion medium containing various mammalian growth factors and cytokines, RSPO1, and a surrogate WNT (L-F12578; L-F127; L-F58; L-F4; or L-F10 at 5 nM) was added. As shown in
III. Surrogate WNT Screening in Acinar Cells
[0182] For outgrowth activity screening of surrogate WNTs, i.e., WNT mimetics, mouse lacrimal gland or salivary gland primary cells or organoid cells (<passage 5) were digested into a near single-cell suspension using TrypLE (Thermo Fisher) for 10 minutes at 37 C. The base medium for activity assays consisted of expansion medium without RSPO1 or any surrogate WNT and supplemented with 1 M porcupine inhibitor Wnt-C59 (#5148 Tocris) and 10 M Y-27632 (#5092280001 MilliporeSigma). Experimental conditions consisted of one or a combination of 500 ng/mL recombinant RSPO1 and 5 nM surrogate WNT (L-F12578, L-F127, L-F58, L-F4, or L-F10), unless otherwise stated. All cells for all conditions were plated in 15 L Matrigel droplets in 96-well plates and submerged in 120 L of the experimental medium in round bottom 96-well plate. Cells were grown out as organoids for 7 days prior to quantification. Outgrowth efficiency was quantified using cell viability assay CellTiter-Glo (G9683 Promega), measured on the SpectraMax Paradigm microplate reader (Molecular Devices) according to manufactures protocols, and the results are shown in
[0183] For WNT target gene expression screening upon surrogate WNT stimulation, mouse acinar cell organoids were grown in complete expansion days for 5 days prior to withdrawal of RSPO1, surrogate WNT and addition of 1 M porcupine inhibitor Wnt-C59 (#5148 Tocris) for 48 hours, as shown in
[0184] Human AXIN2 induction in Surrogate WNT screen was performed in human lacrimal gland explant cultures, derived from fresh human lacrimal gland tissue (shown in
IV. Immunofluorescence Staining and In Situ Hybridization
[0185] Organoids were harvested in cell recovery solution (354253, Corning) and fixed in 4% formaldehyde (R37814 Sigma-Aldrich) for at least 2 hours at room temperature and permeabilized using 0.2% Triton X-100 in PBS (#ICN19485450 Fisher Scientific). Whole-mount staining was performed overnight in 2% donkey serum using rabbit anti-MIST1 (#14896 CST) and DAPI (#EN62248 Fisher Scientific), secondary antibody was Alexa Fluor 568 donkey anti-rabbit IgG (Life Technologies, A10042). Organoids were imaged on a Leica THUNDER imaging system (
V. Animals and Treatment
[0186] Female C57BL/6 mice (8-10-week-old) were intraperitoneally dosed on day 0, 3, 7 and 10 at 10 mpk with various Wnt mimetics. At day 14, proliferating cells were detected in L-F12578, L-F127 and L-F58 treatment groups by Ki67 signal (
[0187] Female C57BL/6 mice (8-10-week-old) were purchased from Jackson Laboratory (Bar Harbor, ME). All animal procedures were performed in accordance with IACUC committee's regulations. Mice were anesthetized and the left extraorbital lacrimal glands were left untreated while the right lacrimal glands were injected with IL-1 or a cocktail of IL-1 and SWAP, i.e., WNT mimetic, as shown in
[0188] All animal experiments were performed according to national ethical guidelines in addition to the guidance and approval by the Institutional Animal Care and Use Committee (IACUC) of Surrozen, Inc. Twelve-week-old MRL-lpr (stock 000485) female mice were obtained from Jackson Laboratories (Bar Harbor, ME, USA) and were housed 4 per cage. Proteins treatments at 3 mg per kg and 10 mg per kg were intraperitoneally dosed on day 0, 3, 7 and 10 in C57Bl/6J mice and MRL-lpr along with MRL/MpJ mice respectively. RSPO2-nFcFc treatment at 0.1, 0.3, 1 and 3 mg per kg were intraperitoneally dose on day 0, 3, 7 and 10 in C57Bl/6J mice. Bone mineral density (BMD) and fat content of animals were measured via in vivo DEXA method using a Faxitron UltraFocus (Faxitron Bioptics, Tucson, Arizona) on day 0, 7 and 13. Animals were anesthetized during imaging through isoflurane and sample ROI included the entire murine skeleton except material above the cervical spine due to increased radiographical intensity of the skull. BMD and fat content were calculated using the accompanying Vision DXA software. Animals were terminated on day 14, and salivary glands were collected for histology.
VI. Intra-Lacrimal Gland Injection
[0189] Intra-lacrimal gland injection was performed as previously described with minor alteration in Zoukhri et al. A Single Injection of Interleukin-1 Induces a Reversible Aqueous-tear Deficiency, Lacrimal Gland Inflammation, and Acinar and Ductal Cell Proliferation, 84 E
[0190] The following procedure was established for lacrimal gland duct ligation, adapted from Liu et al. 2017. Animals are anesthetized with isoflurane. After the mouse is no longer responsive to pinches on two extremities in two different body quadrants, it is moved to the stage of a dissecting scope and fashioned with a nosecone to continue anesthesia by isoflurane. A small incision anterior to the ear is made to expose the extraorbital lacrimal gland which is lifted to expose the main excretory duct. A size 4-0 silk thread is then used to ligate the duct. After duct ligation, the skin incision is closed, sutured, and antibiotic ointment is then applied to the skin. The contralateral lacrimal gland is not operated on and served as a control. After three days, the skin suture is reopened to expose the lacrimal gland. The duct ligation is then released by cutting the silk suture with micro scissors. In the same surgery, treatment groups are injected with 2 mL of test article into the lacrimal gland ipsilateral to the ligation. After injection, the skin incision is closed, sutured, and antibiotic ointment is then applied. The animals are then sacrificed, and ipsilateral and contralateral lacrimal glands collected 24 h, 3 days or 14 days after releasing the ligation.
VII. Induction of Dry Eye and SWAP Treatment
[0191] For induction of dry eye, 3 L of recombinant human IL-1 (Peprotech) at 2 g/L was injected to the lacrimal gland. For local SWAP treatment, SWAP (3.5 g/L) was mixed with IL-1 (2 g/L) in a total volume of 3 L then injected to the lacrimal gland. For systemic SWAP treatment, SWAP was intraperitoneally injected at 10 mg/kg twice a week for 2 weeks, as shown in
VIII. Measurement of Aqueous Tear Secretion
[0192] Aqueous tear secretion was measured using phenol-impregnated cotton threads (Zone-Quick, Menicon) on restrained, unanesthetized mice. The threads were held with forceps and applied to the lateral canthus of both eyes for 30 seconds. Wetting of the thread which turned from yellow to red in contact with tears was measured in millimeters, and the results are shown in
IX. WNT Mimetic Molecules Induce Salivary Gland Hypertrophy
[0193] The effect of systemic WNT mimetic administration on salivary gland weight and histology in vivo, was examined. Significant increases in salivary gland weight in the groups of L-F12578, L-F127, L-F4, and L-F10 dosed at 3 mpk compared with Vehicle group on day 14, by 101% (P<0.001), 114% (P<0.001), 29% (p<0.01) and 22% (P<0.05), respectively, were observed, with the effects of L-F12578 and L-F127 being the most pronounced (
[0194] To understand the effect of WNT activation on salivary gland cells, murine salivary gland organoids as an experimental platform (see, e.g., Maimets et al. (2016) Stem Cell 6:150-162) were utilized. Treatment with L-F12578 (5 nM) in combination with recombinant RSPO1 increased proliferation compared to RSPO1 alone, resulting in the fast expansion of larger organoids (
[0195] Sjgren's syndrome is a systemic autoimmune disease that particularly affects exocrine glands such as the salivary glands. Chronic inflammation in the glands with immune cell infiltration results in acinar cell atrophy leading to xerostomia (see, e.g., Jensen and Vissink (2014) Oral Maxillofac. Surg. Clin. North Am. 26:35-53). The MRL-lpr mouse strain, also known as lupus mice, exhibit systemic autoimmunity with similar salivary gland abnormalities in Sjgren's syndrome in humans such as reduced salivary production and lymphocyte infiltration (see, e.g., Ma et al. (2014) Diag. Pathol. 9:5). To test whether the L-F12578 WNT mimetic can increase and restore salivary gland weight in an ongoing damage environment, aged lupus and MRL/MpJ control mice were dosed for two weeks. Treatment with L-F12578 significantly increased salivary gland weight in both genetic strains without any observable adverse effect on histology (
X. Reagents and Materials
[0196] WNT mimetics were constructed as described in WO 2020/010308 A1 incorporated herein in its entirety herein. All recombinant proteins were produced in Expi293F cells (Thermo Fisher Scientific) by transient transfection unless otherwise specified. All IgG-based and Fc-containing constructs were first purified with Protein-A resin and eluted with 0.1 M glycine pH 3.5. All proteins were then polished by a size exclusion column in HBS buffer (10 mM HEPES pH 7.2, 150 mM NaCl). Proteins were supplemented with glycerol to 10% for long term storage at 80 C.
[0197] Reagents used in lacrimal gland regeneration experiments include (but are not limited to):
TABLE-US-00001 Reagent List Component Catalog number Advanced DMEM/F-12 Thermo Scientific 12634-010 HEPES Thermo Scientific 15630080 GlutaMAX Thermo Scientific 35050061 Penicillin-Streptomycin Thermo Scientific 15140122 B27 Thermo Scientific 17504044 N2 Thermo Scientific 17502048 Human Growth Factors Peprotech Recombinant Human R-Spondin 1 R&D 4645RS Surrogate WNT In-house production Matrigel GFR Membrane Matrix Corning CB40230C Y-27632 MilliporeSigma 5092280001
TABLE-US-00002 Primername Primersequence SEQIDNo. MouseforwardAxin2 CAGCCCAAGAACCGGGAAAT 17 MousereverseAxin2 GAGCCTCCTCTCTTTTACAGCA 18 MouseforwardActb ACCTTCTACAATGAGCTGCGT 19 MousereverseActb AGGTCTCAAACATGATCTGGGT 20 MouseforwardRnf43 CGGAGCCGTACTGGGTTAAG 21 MousereverseRnf43 GGCACGGGGATGAAACAAAT 22 MouseforwardMist1 CCAAGATCGAGACCCTCACG 23 MousereverseMist1 GCGGCTGCTGGACATAGTAA 24 MouseforwardKrt7 GCGGAGATGAACCGCTCTAT 25 MousereverseKrt7 TCTAACTTGGCACGCTGGTT 26 HumanforwardAXIN2 TCATTTCCCGAGAACCCACC 27 HumanreverseAXIN2 AGCTTCAGCTTTTCCAGCCT 28 HumanforwardACTB CTGGAACGGTGAAGGTGACA 29 HumanreverseACTB AAGGGACTTCCTGTAACAATGCA 30 MouseforwardFzd1 CATCGAGGCCAACTCACAGT 31 MousereverseFzd1 TGAGCCCCACAAAACACACT 32 MouseforwardFzd2 AGCGATTTCGCTACCCAGAG 33 MousereverseFzd2 AGAACGAAGCCCGCAATGTA 34 MouseforwardFzd3 GCCCTTTGTGAGACCAGGTT 35 MousereverseFzd3 ATATGCCTGCAGGTCTCAGC 36 MouseforwardFzd4 CCTGAGCGCCCCATCATATT 37 MousereverseFzd4 CTTTCCCGGCCTACAGTCAG 38 MouseforwardFzd5 CCGCCACAGGTACCTAGCTT 39 MousereverseFzd5 AAGGACAGAACTCTCGGAGGA 40 MouseforwardFzd6 CCCGAGGTGAGGCGTCC 41 MousereverseFzd6 TGAATTCTGGGGCAACTGCT 42 MouseforwardFzd7 ATGCTCTATGTACGCACCCG 43 MousereverseFzd7 CGAACTTGTTCATGAGCGCC 44 MouseforwardFzd8 TGTTGGAAGTGACCTCGCTC 45 MousereverseFzd8 AACCGATGCCTTTGCACAAC 46 MouseforwardFzd9 TAAGGACTTCGCGCTGGTTT 47 MousereverseFzd9 AAGATAATCGGGCGCTCTGG 48 MouseforwardFzd10 CCTTCCTCATCGACCCATCG 49 MousereverseFzd10 TAGCCCACCGAATAAACGCA 50 MouseforwardLrp5 CCATTGTGTTGCACCCTGTG 51 MousereverseLrp5 CAGGACATGCCGATCTCTCC 52 MouseforwardLrp6 TGCAAACAGACGGGACTTGA 53 MousereverseLrp6 CCAAACACAAAGTCCACCGC 54
[0198] WNT mimetic constructs used in the experiments comprise the following amino acid sequences (Bold=LRP binding variable domain; underline=linker; italics=FZD binding variable domain; Plain (non-bold, non-underline, and non-italics=Fc domain).
TABLE-US-00003 L-F12578 HeavyChainSEQID:1 (Fv-IgG) EVQLVESGGGLVQPGGSLRLSCAASGFTFTSYYISWVRQAPGKGLEWVA EISPYSGSTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCALR ARPPIRLHPRGSVMDYWGQGTLVTVSSGGGGSGGGGSGGGGSEVQLVESG GGLVQPGGSLRLSCAASGFTFSHYTLSWVRQAPGKGLEWVSVISGDGSYTYYADSV KGRFTISSDNSKNTLYLQMNSLRAEDTAVYYCARNFIKYVFANWGQGTLVTVSSAST KGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAV LQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTC PPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYV DGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALG APIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWES NGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHN HYTQKSLSLSPGK LightChainSEQID:2 DIQMTQSPSSLSASVGDRVTITCRASQDVSTAVAWYQQKPGKAPKLLIYS ASFLYSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYTTPPTFGQGT KVEIKGGGGSGGGGSGGGGSDIELTQPPSVSVAPGQTARISCSGDNIGSFYVHWY QQKPGQAPVLVIYDKSNRPSGIPERFSGSNSGNTATLTISGTQAEDEADYYCQSYAN TLSLVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTV AWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHE GSTVEKTVAPTECS L-F127 HeavyChainSEQID:3 (Fv-Ig) EVQLVESGGGLVQPGGSLRLSCAASGFTFTSYYISWVRQAPGKGLEWVA EISPYSGSTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCALR ARPPIRLHPRGSVMDYWGQGTLVTVSSGGGGSGGGGSGGGGSEVQLVESG GGLVQPGGSLRLSCAASGFNISSSYIHWVRQAPGKGLEWVAYIYSSYGSTYYADSVK GRFTISADTSKNTAYLQMNSLRAEDTAVYYCARASWYALDYWGQGTLVTVSSASTK GPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP PCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVD GVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALGA PIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNH YTQKSLSLSPGK LightChainSEQID:4 DIQMTQSPSSLSASVGDRVTITCRASQDVSTAVAWYQQKPGKAPKLLIYS ASFLYSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYTTPPTFGQGT KVEIKGGGGSGGGGSGGGGSDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAW YQQKPGKAPKLLIYSASSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQYWY GVAPITFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKV QWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT HQGLSSPVTKSFNRGEC L-F58 HeavyChainSEQID:5 (Fv-IgG) EVQLVESGGGLVQPGGSLRLSCAASGFTFTSYYISWVRQAPGKGLEWVA EISPYSGSTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCALR ARPPIRLHPRGSVMDYWGQGTLVTVSSGGGGSGGGGSGGGGSEVQLVESG GGLVQPGGSLRLSCAASGENISYSYIHWVRQAPGKGLEWVASIYSSSGSTSYADSVK GRFTISADTSKNTAYLQMNSLRAEDTAVYYCARGAIDYWGQGTLVTVSSASTKGPS VFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCP APEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV EVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALGAPIE KTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQ PENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYT QKSLSLSPGK LightChainSEQID:6 DIQMTQSPSSLSASVGDRVTITCRASQDVSTAVAWYQQKPGKAPKLLIYS ASFLYSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYTTPPTFGQGT KVEIKGGGGSGGGGSGGGGSDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAW YQQKPGKAPKLLIYSASSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQWYS SGHVLITFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAK VQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEV THQGLSSPVTKSFNRGEC L-F4 HeavyChainSEQID:7 (Fv-IgG) EVQLVESGGGLVQPGGSLRLSCAASGFTFTSYYISWVRQAPGKGLEWVA EISPYSGSTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCALR ARPPIRLHPRGSVMDYWGQGTLVTVSSGGGGSGGGGSGGGGSEVQLVESG GGLVQPGGSLRLSCAASGFNISYYYIHWVRQAPGKGLEWVASIYPSSGYTYYADSVK GRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSSFYWAMDYWGQGTLVTVSSAST KGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAV LQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTC PPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYV DGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALG APIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWES NGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHN HYTQKSLSLSPGK LightChainSEQID:8 DIQMTQSPSSLSASVGDRVTITCRASQDVSTAVAWYQQKPGKAPKLLIYS ASFLYSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYTTPPTFGQGT KVEIKGGGGSGGGGSGGGGSDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAW YQQKPGKAPKLLIYSASSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQSYA AYLFTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKV QWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT HQGLSSPVTKSFNRGEC L-F10 HeavyChainSEQID:9 (Fv-IgG) EVQLVESGGGLVQPGGSLRLSCAASGFTFTSYYISWVRQAPGKGLEWVA EISPYSGSTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCALR ARPPIRLHPRGSVMDYWGQGTLVTVSSGGGGSGGGGSGGGGSEVQLVESG GGLVQPGGSLRLSCAASGFTFSSFNMFWVRQAPGKGLEWVAGIDDDGSYPNYGS AVKGRATISRDNSKNTLYLQMNSLRAEDTAVYYCAKSGYGGSWGGYIADDIDAWG QGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGA LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKV EPKSCDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHE DPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEY KCKVSNKALGAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGF YPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS CSVMHEALHNHYTQKSLSLSPGK LightChainSEQID:10 DIQMTQSPSSLSASVGDRVTITCRASQDVSTAVAWYQQKPGKAPKLLIYS ASFLYSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYTTPPTFGQGT KVEIKGGGGSGGGGSGGGGSELTQPPSVSVSPGQTARITCSGDGSYAGSYYYGW YQQKPGQAPVTLIYYNNKRPSGIPERFSGSLSGSTNTLTISGVQAEDEADYYCGSAD NSGAAFGGGTKLTVLRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKV QWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT HQGLSSPVTKSFNRGEC 1SH1-03 LightChainSEQID:11 DVQLVESGGGLVQPGGSLRLSCTSSANINSIETLGWYRQAPGKQRELIAN MRGGGYMKYAGSLKGRFTMSTESAKNTMYLQMNSLKPEDTAVYYCYV KLRDDDYVYRGQGTQVTVSSGGSGSDVVMTQSPLSLPVTPGEPASISCRSSQSL LHSNGYNYLDWYLQKPGQSPQLLIYLGSKRASGVPDRFSGSGSGTDFTLKISRVEA EDVGVYYCMQALQIPPTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCL LNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYE KHKVYACEVTHQGLSSPVTKSFNRGEC 1SH1-26 LightChainSEQID:12 DVQLVESGGGLVQAGGSLRLACAGSGRIFAIYDIAWYRHPPGNQRELVA MIRPVVTEIDYADSVKGRFTISRNNAMKTVYLQMNNLKPEDTAVYYCNA KRPWGSRDEYWGQGTQVTVSSGGSGSDVVMTQSPLSLPVTPGEPASISCRSSQ SLLHSNGYNYLDWYLQKPGQSPQLLIYLGSKRASGVPDRFSGSGSGTDFTLKISRVE AEDVGVYYCMQALQIPPTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVC LLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADY EKHKVYACEVTHQGLSSPVTKSFNRGEC 1SH1-36 LightChainSEQID:13 QVKLEESGGGLVQAGGSLRLSCAASGRIFSIYDMGWFRQAPGKEREFVS GIRWSGGTSYADSVKGRFTISKDNAKNTIYLQMNNLKAEDTAVYYCGSR GYWGQGTLVTVSSGGSGSDVVMTQSPLSLPVTPGEPASISCRSSQSLLHSNGYN YLDWYLQKPGQSPQLLIYLGSKRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYY CMQALQIPPTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPR EAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYA CEVTHQGLSSPVTKSFNRGEC 1SH1-03 HeavyChainSEQID:14 1SH1-26 EVQLVESGPGLVKPSQTLSLTCTVSGGSISSGGYYWSWIRQHPGKGLEWIGYIYYSG 1SH1-36 STYYNPSLKSRVTISVDTSKNQFSLKLNSVTAADTAVYYCARHAGFYGLADYFDYWG QGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGA LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKV EPKSCDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHE DPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEY KCKVSNKALGAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGF YPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS CSVMHEALHNHYTQKSLSLSPGK L-F49 LightChainSEQID:15 DIQMTQSPSSLSASVGDRVTITCRASQDVSTAVAWYQQKPGKAPKLLIYS ASFLYSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYTTPPTFGQGT KVEIKRGGGGSGGGGSGGGGSDIQMTQSPSSPSASVGDRVTITCRASQSISSYL NWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYY CQQSYSTPLTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYP REAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVY ACEVTHQGLSSPVTKSFNRGEC HeavyChainSEQID:16 EVQLVESGGGLVQPGGSLRLSCAASGFTFTSYYISWVRQAPGKGLEWVA EISPYSGSTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCALR ARPPIRLHPRGSVMDYWGQGTLVTVSSGGGGSGGGGSGGGGSEVQLVQS GAEVKKPGASVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGWINAGN GNTTYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARHYYGSG SYPDWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPV TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPS NTKVDKKVEPKSCDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVT CVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLH QDWLNGKEYKCKVSNKALGAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQ VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
[0199] It will be readily understood to those skilled in the art that the above constructs may be altered and expressed as various homologs and isoforms, may be edited at non-binding-domain sequences, and may be expressed using various synonymous nucleotide sequences using various suitable expression vector systems.
REFERENCES
[0200] The following references are incorporated herein in their entireties: [0201] Marie Bannier-Hlaout et al., Exploring the human lacrimal gland using organoids and single-cell sequencing, C