Highly active agonistic CD4 binding site anti-HIV antibodies (HAADS) comprising modified CDRH2 regions that improve contact with GP120
11472868 · 2022-10-18
Assignee
Inventors
- Ron Diskin (Rehovot, IL)
- Pamela J. Bjorkman (Pasadena, CA, US)
- Michel C. Nussenzweig (New York, NY, US)
- Johannes Scheid (New York, NY)
Cpc classification
C07K2317/76
CHEMISTRY; METALLURGY
C07K16/1063
CHEMISTRY; METALLURGY
C07K2317/92
CHEMISTRY; METALLURGY
International classification
Abstract
Embodiments of the present invention are directed to compositions and methods for anti-HIV (anti-CD4 binding site) potent VRC01-like (PVL) antibodies targeted to gp120 having an amino acid substitution at a residue in the anti-CD4 binding site PVL antibody that is equivalent to Phe43 in CD4, these antibodies having improved potency and breadth.
Claims
1. A nucleic acid molecule encoding a human anti-CD4 binding site (anti-CD4bs) VRC01-related antibody variant having a light chain and a heavy chain, the heavy chain comprising an amino acid (X) substitution at position 54 selected from the group consisting G54X, T54X, and S54X according to Kabat numbering, the amino acid (X) being selected from the group consisting of alanine, isoleucine, leucine, methionine, phenylalanine, tryptophan, tyrosine, valine, histidine, arginine, glutamine, asparagine, lysine, glutamic acid, and aspartic acid, the anti-CD4bs VRC01-related antibody variant comprising: a complementarily determining region (CDR) 1 of the heavy chain (CDRH1) having a sequence of Gly26-Tyr27-Glu28-Phe29-(Ile/Leu)30-(Asn/Asp)31-Cys32 (SEQ ID NO: 84); a CDR 2 of the heavy chain (CDRH2) having a sequence of Lys52-Pro52A-Arg53-Gly54-G1y55-Ala56 (SEQ ID NO: 85); a CDR 3 of the heavy chain (CDRH3) having a sequence selected from: Gly95-Lys96-(Asn/Tyr)97-Cys98-(Asp/Thr)99-Tyr100-Asn 100A-Trp100B-Asp100C-Phe100D-Glu101-His102 (SEE ID NO: 86) and Gly95-Lys96-(Asn/Tyr)97-Cys98-(Asp/Thr) 99-Ala100-Arg100A-Asp100B-Tyr100C-Tyr100D-Asn100E-Trp100F-Asp100G-Phe100H-Glu101-His102 (SEQ ID NO: 87); a CDR 1 of the light chain (CDRL1) having a sequence of Arg24-Thr25-Ser26-Gln27-(Ser/Tyr)28-Gly29-Ser30-Leu33-Ala34 (SEQ ID NO: 88); a CDR 2 of the light chain (CDRL2) having a sequence of Ser50-Gly51-Ser52-Thr53-Arg54-Ala55-Ala56 (SEQ ID NO: 89), and a CDR 3 of the light chain (CDRL3) having a sequence of Gln89-Gln90-Tyr91 Glu96-Phe97 (SEQ ID NO: 90), wherein the CDRs are defined according to the Chothia definition.
2. A vector comprising the nucleic acid molecule of claim 1.
3. A cell comprising a vector of claim 2.
4. The nucleic acid molecule of claim 1, wherein the heavy chain substitution is tryptophan, tyrosine, phenylalanine, histidine, arginine, glutamine, or asparagine.
5. The nucleic acid molecule of claim 1, wherein the human anti-CD4bs antibody is capable of binding to gp120 at positions corresponding to 279, 280, 368, 458, and 459 according to pdb code 3U7Y.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1) The patent or application file contains at least one drawing executed in color. Copies of this patent or patent application publication with color drawings will be provided by the Office upon request and payment of the necessary fee.
(2) These and other features and advantages of the present invention will be better understood by reference to the following detailed description when considered in conjunction with the accompanying drawings.
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
(24)
(25)
(26)
(27)
(28)
(29)
(30)
(31)
(32)
(33)
(34)
(35)
(36)
DETAILED DESCRIPTION
(37) Aspects of the present invention are directed to anti-CD4 binding site (CD4bs) antibodies. Embodiments of the present invention include anti-CD4bs antibodies which are potent VRC01-like (PVL) antibodies as defined herein. In some embodiments of the present invention, an anti-CD4bs PVL antibody has a substituted hydrophobic amino acid residue at a position that is equivalent to phenylalanine at position 43 (Phe43) of the host CD4 receptor protein (CD4). In some embodiments of the present invention, a method for increasing the potency and breadth of a PVL antibody includes identifying a target amino acid at the position on the heavy chain of the PVL antibody that is equivalent to Phe43 on CD4, and substituting the target amino acid with a hydrophobic amino acid. For example, in the PVL antibody, NIH45-46, glycine at position 54 (Gly54) is in the Phe43-equivalent position, and substitution of Gly54 in NIH45-46 (Gly54.sub.NIH45-46) with a hydrophobic amino acid such as tryptophan, results in NIH45-46.sup.G54W which has increased potency and breadth compared to NIH45-46.
(38) Abbreviations for amino acids are used throughout this disclosure and follow the standard nomenclature known in the art. For example, as would be understood by those of ordinary skill in the art, Alanine is Ala or A; Arginine is Arg or R; Asparagine is Asn or N; Aspartic Acid is Asp or D; Cysteine is Cys or C; Glutamic acid is Glu or E; Glutamine is Gln or Q; Glycine is Gly or G; Histidine is His or H; Isoleucine is Ile or I; Leucine is Leu or L; Lysine is Lys or K; Methionine is Met or M; Phenylalanine is Phe or F; Proline is Pro or P; Serine is Ser or S; Threonine is Thr or T; Tryptophan is Trp or W; Tyrosine is Tyr or Y; and Valine is Val or V.
(39) Hydrophobic amino acids are well known in the art. Hydrophobic amino acids include alanine, isoleucine, leucine, methionine, phenylalanine, tryptophan, tyrosine, and valine. In some embodiments of the present invention, an anti-CD4bs PVL antibody has a hydrophobic amino acid substituted at a position equivalent to Phe43 of the CD4 receptor protein, wherein the hydrophobic amino acid is alanine, isoleucine, leucine, methionine, phenylalanine, tryptophan, tyrosine, or valine. In other embodiments, an anti-CD4bs PVL antibody has a hydrophobic amino acid substituted at the position equivalent to Phe43 of CD4 receptor protein, wherein the hydrophobic amino acid is tryptophan, phenylalanine, or tyrosine.
(40) Throughout this disclosure and in embodiments of the present invention, the term “antibody” (Ab) as used herein includes monoclonal antibodies, polyclonal antibodies, multispecific antibodies (for example, bispecific antibodies and polyreactive antibodies), and antibody fragments. Thus, the term “antibody” and “isolated antibody” are used interchangeably herein to refer to an isolated antibody according to embodiments of the present invention. An antibody in any context within this specification is meant to include, but is not be limited to, any specific binding member, immunoglobulin class and/or isotype (e.g., IgG1, IgG2, IgG3, IgG4, IgM, IgA, IgD, IgE and IgM); and biologically relevant fragment or specific binding member thereof, including but not limited to Fab, F(ab′)2, Fv, and scFv (single chain or related entity). It is understood in the art that an antibody is a glycoprotein comprising at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds, or an antigen binding portion thereof. A heavy chain is comprised of a heavy chain variable region (VH) and a heavy chain constant region (CH1, CH2 and CH3). A light chain is comprised of a light chain variable region (VL) and a light chain constant region (CL). The variable regions of both the heavy and light chains comprise framework regions (FWR) and complementarity determining regions (CDR). The four FWR regions are relatively conserved while CDR regions (CDR1, CDR2 and CDR3) represent hypervariable regions and are arranged from the NH2 terminus to the COOH terminus as follows: FWR1, CDR1, FWR2, CDR2, FWR3, CDR3, FWR4. The variable regions of the heavy and light chains contain a binding domain that interacts with an antigen while, depending on the isotype, the constant region(s) may mediate the binding of the immunoglobulin to host tissues or factors. CDR1, CDR2, and CDR3 of the light chain are referred to as CDRL1, CDRL2 and CDRL3, respectively. CDR1, CDR2, CDR3 of the heavy chain are referred to as CDRH1, CDRH2, and CDRH3, respectively.
(41) Also included in the definition of “antibody” as used herein are chimeric antibodies, humanized antibodies, and recombinant antibodies, human antibodies generated from a transgenic non-human animal, as well as antibodies selected from libraries using enrichment technologies available to the artisan. The term “variable” refers to the fact that certain segments of the variable (V) domains differ extensively in sequence among antibodies. The V domain mediates antigen binding and defines specificity of a particular antibody for its particular antigen. However, the variability is not evenly distributed across the 110-amino acid span of the variable regions. Instead, the V regions consist of relatively invariant stretches called framework regions (FRs) of 15-30 amino acids separated by shorter regions of extreme variability called “hypervariable regions” that are each 9-12 amino acids long. The variable regions of native heavy and light chains each comprise four FRs, largely adopting a beta sheet configuration, connected by three hypervariable regions, which form loops connecting, and in some cases forming part of, the beta sheet structure. The hypervariable regions in each chain are held together in close proximity by the FRs and, with the hypervariable regions from the other chain, contribute to the formation of the antigen-binding site of antibodies. The term “hypervariable region” as used herein refers to the amino acid residues of an antibody that are responsible for antigen binding. The hypervariable region generally comprises amino acid residues from a “complementarity determining region” (“CDR”).
(42) An antibody of the present invention may be a “humanized antibody”. A humanized antibody is considered to be a human antibody that has one or more amino acid residues introduced into it from a source that is non-human. These non-human amino acid residues often are referred to as “import” residues, which typically are taken from an “import” variable region. Humanization may be performed following known methods by substituting import hypervariable region sequences for the corresponding sequences of a human antibody. (See, for example, Jones et al., Nature, 321:522-525 20 (1986); Reichmann et al., Nature, 332:323-327 (1988); Verhoeyen et al., Science, 239:1534-1536 (1988)) the entire contents of each are incorporate herein by reference). Accordingly, such “humanized” antibodies are chimeric antibodies in which substantially less than an intact human variable region has been substituted by the corresponding sequence from a non-human species.
(43) An antibody of the present invention includes an “antibody fragment” which includes a portion of an intact antibody, such as the antigen binding or variable region of the intact antibody. Examples of antibody fragments include, but are not limited to, Fab, Fab′, F(ab′)2, and Fv fragments; diabodies; linear antibodies; single-chain antibody molecules; and multispecific antibodies formed from antibody fragments. (See, for example, U.S. Pat. No. 5,641,870, the entire content of which is incorporated herein by reference.)
(44) Throughout this disclosure and in embodiments of the present invention, a “potent VRC01-like” (“PVL”) antibody of the present invention is an anti-CD4 binding site antibody that has the following conserved heavy chain (HC) and light chain (LC) residues: Arg71.sub.HC, Trp50.sub.HC, Asn58.sub.HC, Trp100B.sub.HC, Glu96.sub.LC, Trp67.sub.LC/Phe67.sub.LC, as well as exactly 5 amino acids in CDRL3 domain (using Kabat numbering). (The Kabat numbering system is described in Abhinandan, K. R. and Martin, A. C. R. (2008), “Analysis and improvements to Kabat and structurally correct numbering of antibody variable domains,” Molecular Immunology, 45: 3832-3839, the entire contents of which are herein incorporated by reference.) A PVL antibody of the present invention is any antibody as defined herein, that has the listed PVL features irrespective of the synthesis or derivation of the antibody, irrespective of the other unrestricted domains of the antibody, and irrespective of whether or not other domains of the antibody are present, so long as the antibody has the signature residues and features.
(45) Throughout the disclosure and in embodiments of the present invention, the terms “Phe43-equivalent position” and “Phe43.sub.CD4 equivalent position” are used interchangeably and refer to an amino acid position within the heavy chain of a PVL antibody that replicates or mimics the binding pocket and interface contributed by Phe43 of the host CD4 receptor when the CD4 receptor protein is complexed with the HIV viral spike protein gp120. As known in the art, assigned amino acid positions of an antibody do not necessarily correspond to the amino acid residue as numbered from the amino-terminus. Following the Kabat antibody residue/position numbering system, the amino acid residue number may be the same as the amino acid position, but is not necessarily so. (See, Abhinandan, K. R. and Martin, A. C. R. (2008) Molecular Immunology, 45: 3832-3839.) The structure of the antibody peptide determines the position number. The information for determining position number using the Kabat system for each amino acid in a given sequence can be determined using the information found in Abhinandan and Martin, 2008. Using this position numbering system, the Phe43-equivalent position in a PVL antibody heavy chain sequence can be determined, and substituted with a hydrophobic amino acid to create a similar binding pocket as conferred by Phe43 in CD4. Methods for this mutagenesis are well known in the art (e.g. Example 2).
(46) Subsequent heavy chain sequences can be analyzed using the Kabat numbering system to determine the equivalent position to this position 54. Alternatively, the Phe43.sub.CD4-equivalent position can also be determined by structural analysis such as x-ray crystallography. Any means of determining the Phe43.sub.CD4-equivalent position may be used so long as the Kabat system is followed as applicable.
(47) For example, the Phe43-equivalent position in NIH45-46 is position 54 as determined by x-ray crystallography and shown herein. The native NIH45-46 sequence contains a glycine at position 54 (Gly54). As such, a PVL antibody substituted with a hydrophobic amino acid at this Phe-43 equivalent position mimics the desired contact interface between the CD4 receptor protein and the CD4 binding site of gp120 (see, e.g., Example 2).
(48) In some embodiments of the present invention, position 54 (Kabat numbering) of the heavy chain of a PVL antibody has a substituted hydrophobic amino acid. Position 54 is determined by analyzing a heavy chain amino acid sequence of a PVL antibody using the Kabat numbering system.
(49) In some embodiments of the present invention, a hydrophobic amino acid is substituted for the “native” amino acid present at the Phe43.sub.CD4-equivalent position on the heavy chain of a PVL antibody, where a PVL antibody is an antibody as defined herein having the PVL signature features as described herein, and “native” refers to the amino acid that is present in the PVL antibody prior to substitution. The native amino acid may also be hydrophobic, and may be substituted with another hydrophobic amino acid.
(50) In some embodiments of the present invention, non-limiting examples of PVL antibodies include VRC01, VRC02, NIH-45-46, 3BNC60, 3BNC117, 3BNC62, 3BNC95, 3BNC176, 12A21, VRC-PG04, VRC-CH30, VRC-CH31, VRC-CH32, VRC-CH33, VRC-CH34, VRC03 heavy chain (HC) with VRC01 light chain (LC), gVRC-H5(d74)/VRC-PG04LC, and gVRC-H12(d74)/VRC-PG04LC, VRC03, VRC01 heavy chain (HC) with VRC03 light chain (LC), 3BNC55, 3BNC91, 3BNC104, 3BNC89, 12A21, and VRC-PG04b as listed below in Table 1.
(51) TABLE-US-00001 TABLE 1 Examples of PVL Antibodies Light Chain Heavy Chain Antibody Name SEQ ID NO: SEQ ID NO: VRC01 1 2 VRC02 3 4 NIH-45-46 5 6 3BNC60 7 8 3BNC117 9 10 3BNC62 11 12 3BNC95 13 14 3BNC176 15 16 12A12 17 18 VRC-PG04 19 20 VRC-CH30 21 22 VRC-CH31 23 24 VRC-CH32 25 26 VRC-CH33 27 28 VRC-CH34 29 30 VRC03 31 32 3BNC55 33 34 3BNC91 35 36 3BNC104 37 38 3BNC89 39 40 12A21 41 42 VRC-PG04b 43 44 VRC03HC-VRC01LC 1 32 VRC01HC/VRC03LC 31 2 gVRC-H5(d74)/ 19 45 VRC-PG04LC gVRC0H12(D74)/ 19 46 VRC-PG04LC
(52) In some embodiments of the present invention, a PVL antibody has a heavy chain selected from one of the heavy chains listed above in Table 1 (SEQ ID NOs 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 45, and 46). Any PVL heavy chain may be matched with a PVL light chain so long as the signature PVL residue features are maintained. In some embodiments, any one of the PVL heavy chains of Table 1 is expressed with any one of the PVL light chains of SEQ ID NOs 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, 35, 37, 39, 41, and 43. In other embodiments, any PVL antibody heavy chain can be combined with any PVL antibody light chain.
(53) In embodiments of the present invention, the terms “nucleic acid” and “polynucleotide” are used interchangeably herein to refer to single-stranded or double-stranded RNA, DNA, or mixed polymers. Polynucleotides can include genomic sequences, extra-genomic and plasmid sequences, and smaller engineered gene segments that express, or can be adapted to express polypeptides.
(54) An “isolated nucleic acid” is a nucleic acid that is substantially separated from other genome DNA sequences as well as proteins or complexes such as ribosomes and polymerases, which naturally accompany a native sequence.
(55) In some embodiments of the present invention, nucleic acid molecules encode part or all of the light and heavy chains of the described inventive antibodies, and fragments thereof. Due to redundancy of the genetic code, variants of these sequences will exist that encode the same amino acid sequences.
(56) The present invention also includes isolated nucleic acid molecules encoding the polypeptides of the heavy and the light chain of the PVL antibodies listed in Table 1. In some embodiments, an isolated nucleic acid molecule encodes for any of the PVL heavy chain and light chain polypeptides including those of SEQ ID NOs 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 45, and 46, and SEQ ID NOs 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, 35, 37, 39, 41, and 43, respectively, in which the Phe43.sub.CD4-equivalent amino acid (i.e., the target amino acid) of the heavy chain is substituted with a hydrophobic amino acid.
(57) Embodiments of the present invention also include vectors and host cells including a nucleic acid encoding a PVL antibody of the present invention, as well as recombinant techniques for the production of polypeptide of the invention. Vectors of the invention include those capable of replication in any type of cell or organism, including, for example, plasmids, phage, cosmids, and mini chromosomes. In some embodiments, vectors comprising a polynucleotide 5 of the described invention are vectors suitable for propagation or replication of the polynucleotide, or vectors suitable for expressing a polypeptide of the described invention. Such vectors are known in the art and commercially available.
(58) In embodiments of the present invention, “vector” includes shuttle and expression vectors. Typically, the plasmid construct will include an origin of replication (for example, the ColE1 origin of replication) and a selectable marker (for example, ampicillin or tetracycline resistance), for replication and selection, respectively, of the plasmids in bacteria. An “expression vector” refers to a vector that contains the necessary control sequences or regulatory elements for expression of the antibodies including antibody fragment of the invention, in bacterial or eukaryotic cells.
(59) In some embodiments of the present invention, in order to express a polypeptide of the invention, the nucleotide sequences encoding the polypeptide, or functional equivalents, may be inserted into an appropriate expression vector, i.e., a vector that contains the necessary elements for the transcription and translation of the inserted coding sequence. Methods well known to those skilled in the art may be used to construct expression vectors containing sequences encoding a polypeptide of interest and appropriate transcriptional and translational control elements. These methods include in vitro recombinant DNA techniques, synthetic techniques, and in vivo genetic recombination. Such techniques are described, for example, in Sambrook, J., et al. (2001) Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Press, Plainview, N.Y., the entire contents of which are incorporated herein by reference.
(60) As used herein, the term “cell” can be any cell, including, but not limited to, eukaryotic cells, such as, but not limited to, mammalian cells or human cells.
(61) In some embodiments of the present invention, the antibodies disclosed herein are produced recombinantly using vectors and methods available in the art. (see, e.g. Sambrook et al., 2001, supra). Human antibodies also can be generated by in vitro activated B cells (see, for example, U.S. Pat. Nos. 5,567,610 and 5,229,275). Reagents, cloning vectors, and kits for genetic manipulation are available from commercial vendors such as BioRad, Stratagene, Invitrogen, ClonTech and Sigma-Aldrich Co.
(62) In some embodiments of the present invention, human antibodies are produced in transgenic animals (for example, mice) that are capable of producing a full repertoire of human antibodies in the absence of endogenous immunoglobulin production. For example, it has been described that the homozygous deletion of the antibody heavy-chain joining region (JH) gene in chimeric and germ-line mutant mice results in complete inhibition of endogenous antibody production. Transfer of the human germ-line immunoglobulin gene array into such germline mutant mice results in the production of human antibodies upon antigen challenge. See, for example, Jakobovits et al., Proc. Natl. Acad. Sci. USA, 90:2551 (1993); Jakobovits et al., Nature, 362:255-258 (1993); Bruggemann et al., Year in Immuno., 7:33 (1993); U.S. Pat. Nos. 5,545,806, 5,569,825, 5,591,669; U.S. Pat. No. 5,545,807; and WO 97/17852, the entire contents of all of which are incorporated herein by reference. Such animals can be genetically engineered to produce human antibodies comprising a polypeptide of a PVL antibody of the present invention.
(63) In some embodiments of the present invention, a method includes the preparation and administration of an HIV antibody composition (e.g., a PVL antibody having a hydrophobic amino acid substituted at the Phe43.sub.CD4-equivalent position of the PVL heavy chain) that is suitable for administration to a human or non-human primate patient having an HIV infection, or at risk of HIV infection, in an amount and according to a schedule sufficient to induce a protective immune response against HIV, or reduction of the HIV virus, in a human.
(64) In some embodiments of the present invention, a vaccine includes at least one antibody as disclosed herein and a pharmaceutically acceptable carrier. In some embodiments of the present invention, the vaccine is a vaccine including at least one PVL antibody as described herein and a pharmaceutically acceptable carrier. The vaccine can include a plurality of the antibodies having the characteristics described herein in any combination and can further include HIV neutralizing antibodies such as a PVL antibody having the Phe43.sub.CD4-equivalent residue on the heavy chain substituted with a hydrophobic amino acid.
(65) In some embodiments of the present invention, carriers as used herein include pharmaceutically acceptable carriers, excipients or stabilizers that are nontoxic to the cell or mammal being exposed thereto at the dosages and concentrations employed. Often the physiologically acceptable carrier is an aqueous pH buffered solution. Examples of physiologically acceptable carriers include, but are not limited to, buffers such as phosphate, citrate, and other organic acids; antioxidants including, but not limited to, ascorbic acid; low molecular weight (less than about 10 residues) polypeptide; proteins, such as, but not limited to, serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as, but not limited to: polyvinylpyrrolidone; amino acids such as, but not limited to: glycine, glutamine, asparagine, arginine or lysine; monosaccharides, disaccharides, and other carbohydrates including, but not limited to: glucose, mannose, or dextrins; chelating agents such as, but not limited to: EDTA (ethylenediamineteteraacetic acid); sugar alcohols such as, but not limited to: mannitol or sorbitol; salt-forming counterions such as, but not limited to: sodium; and/or nonionic surfactants such as, but not limited to TWEEN® (polysorbate).; polyethylene glycol (PEG), and PLURONICS® (poloxamers).
(66) In some embodiments of the present invention, the compositions may include a single antibody or a combination of antibodies, which can be the same or different, in order to prophylactically or therapeutically treat the progression of various subtypes of HIV infection after vaccination. Such combinations can be selected according to the desired immunity. When an antibody is administered to an animal or a human, it can be combined with one or more pharmaceutically acceptable carriers, excipients or adjuvants as are known to one of ordinary skilled in the art. The composition can further include broadly neutralizing antibodies known in the art, including, for example, a PVL antibody having the Phe43.sub.CD4-equivalent residue substituted with a hydrophobic amino acid.
(67) In some embodiments of the present invention, an antibody-based pharmaceutical composition includes a therapeutically effective amount of an isolated HIV antibody which provides a prophylactic or therapeutic treatment choice to reduce infection of the HIV virus. The antibody-based pharmaceutical composition of the present invention may be formulated by any number of strategies known in the art (e.g., see McGoff and Scher, 2000, Solution Formulation of Proteins/Peptides: In McNally, E. J., ed. Protein Formulation and Delivery. New York, N.Y.: Marcel Dekker; pp. 139-158; Akers and Defilippis, 2000, Peptides and Proteins as Parenteral Solutions. In: Pharmaceutical Formulation Development of Peptides and Proteins. Philadelphia, Pa.: Taylor and Francis; pp. 145-177; Akers, et 5 al., 2002, Pharm. Biotechnol. 14:47-127, the entire contents of all of which are incorporated herein by reference).
(68) In some embodiments of the present invention, a method for treating a mammal infected with a virus infection, such as, for example, HIV, comprising administering to said mammal a pharmaceutical composition comprising an HIV antibody composition as disclosed herein. According to some embodiments, the method for treating a mammal infected with HIV includes administering to said mammal a pharmaceutical composition that includes an antibody as disclosed herein, or a fragment thereof. The compositions of embodiments of the present invention may include more than one antibody having the characteristics disclosed herein. For example, a plurality or pool of PVL antibodies, each antibody having the Phe43.sub.CD4-equivalent residue substituted with a hydrophobic amino acid.
(69) In some embodiments of the present invention, in vivo treatment of human and non-human patients includes administering or providing a pharmaceutical formulation including an HIV antibody according to embodiments of the present invention. When used for in vivo therapy, the antibodies of the invention are administered to the patient in therapeutically effective amounts (i.e., amounts that eliminate or reduce the patient's viral burden). The antibodies are administered to a human patient, in accord with known methods, such as intravenous administration, for example, as a bolus or by continuous infusion over a period of time, by intramuscular, intraperitoneal, intracerobrospinal, subcutaneous, intra-articular, intrasynovial, intrathecal, oral, topical, or inhalation routes. The antibodies can be administered parenterally, when possible, at the target cell site, or intravenously. In some embodiments, a PVL antibody composition as described herein is administered by intravenous or subcutaneous administration.
(70) In some embodiments of the present invention, a therapeutically effective amount of an antibody is administered to a patient. In some embodiments, the amount of antibody administered is in the range of about 0.1 mg/kg to about 50 mg/kg of patient body weight. Depending on the type and severity of the infection, about 0.1 mg/kg to about 50 mg/kg body weight (for example, about 0.1-15 mg/kg/dose) of antibody is an 5 initial candidate dosage for administration to the patient, whether, for example, by one or more separate administrations, or by continuous infusion. The progress of this therapy is readily monitored by conventional methods and assays and based on criteria known to the physician or other persons of skill in the art. The above parameters for assessing successful treatment and improvement in the disease are readily measurable by routine procedures familiar to a physician.
(71) In some embodiments of the present invention, passive immunization using a PVL antibody as disclosed herein, is used as an effective and safe strategy for the prevention and treatment of HIV disease. (See, for example, Keller et al., Clin. Microbiol. Rev. 13:602-14 (2000); Casadevall, Nat. Biotechnol. 20:114 (2002); Shibata et al., Nat. Med. 5:204-10 (1999); and Igarashi et al., Nat. Med. 5:211-16 (1999), each of which are incorporated herein by reference).
(72) The following Examples are presented for illustrative purposes only, and do not limit the scope or content of the present application.
EXAMPLES
(73) Reference is made to Diskin et al. 2013, JEM, 210: 1235-1249; Diskin et al., 2011, Science, 334:12989-1293; and West et al., 2012, PNAS, (doi: 10.1073/pnas.1208984109), the entire contents of all of which are incorporated herein by reference.
Example 1. Structural Comparisons of NIH45-46 and VRC01
(74) To determine structural correlates of high potency and breadth in HAADs, structures of NIH45-46 alone and bound to the clade A/E 93TH057 gp120 core were solved (
(75) The crystal structure of the NIH45-46-93TH057 gp120 complex verified that NIH45-46 targets the CD4bs on gp120 (
(76) A notable difference between VRC01 and NIH45-46 is the four-residue insertion (residues 99a-99d) in CDRH3. Three inserted residues contribute to binding to gp120 (
(77) TABLE-US-00002 TABLE 2 In vitro neutralization IC.sub.50 values (μg/mL) NIH45-46 NIH45-46 NIH45-46 Virus Clade WT Y99dA Δ99a-99d AC10.0.29 B 0.9 4.4 13 TRO.11 B 1.9 >50 >50 SC422661.8 B 0.05 0.08 1.4 QH0692.42 B 0.7 2.1 3.7 ZM214M.PL15.11 C 0.3 1.1 2.2 CAP45.2.00.G3 C >50 >50 >50 T257-31 CRF02 0.5 2.4 7.0 (A/G)
(78) TABLE-US-00003 TABLE 3 CDRH3 sequence NIH45-46 WT FCTRGKYCTARDYYNWDFEHWGRGAP NIH45-46 Y99dA FCTRGKYCTARDAYNWDFEHWGRGAP NIH45-46 Δ99a-99d FCTRGKYCT----YNWDFEHWGRGAP
(79) First, the Tyr99d.sub.NIH45-46 sidechain hydrogen bonds with the loop D Ala281.sub.gp120 carbonyl oxygen (
(80) TABLE-US-00004 TABLE 4 Comparison of in vitro neutralization for viral strains with differences at 281.sub.gp120 Strain gp120 sequence surrounding residue 281 Residue 281.sub.gp120 IC.sub.50* μg/mL Du156.12 QLLLNGSLAEEEIIIKSENLTDNIKTIIVQLNQSIGINCTRPNNNTRKSV I 0.01 ZM197M.PB7 QLLLNGSLAEEEIIIRSENLTDNTKTIIVHLNESVEIECVRPNNNTRKSV T 0.14 ZM214M.PL15 QLLLNGSLAEKEIMIRSENLTNNAKTIIVQLTEAVNITCMRPGNNTRRSV A 0.05 ZM249M.PL1 QLLLNGSLAEKEIIIRSENITDNVKIIIVHLNESVEINCTRPNNNTRKSI V 0.02 ZM53M.PB12 QLLLNGSTAEEDIIIRSENLTNNAKTIIVHLNESIEIECTRPGNNTRKSI A 0.65 ZM109F.PB4 QLLLNGSLAEEEIVIRSENLTDNAKTIIVHLNKSVEIECIRPGNNTRKSI A 0.22 ZM135M.PL10a QLLLNGSLSEEGIIIRSKNLTDNTKTIIVHLNESVAIVCTRPNNNTRKSI T 0.36
(81) The importance of Tyr99d.sub.NIH45-46 for potency is demonstrated by alanine substitution (NIH45-46 Y99dA), which reduces the neutralization potency of NIH45-46 to values intermediate between wild-type NIH45-46 and the deletion mutant (Table 2). Second, Asp99c.sub.NIH45-46 interacts electrostatically with Lys97.sub.gp120 at the base of α-helix 1.sub.gp120, and third, Arg99b.sub.NIH45-46 hydrogen bonds with Asn99.sub.gp120 (
(82) The insertion in CDRH3 contributes to a higher total buried surface area between the NIH45-46 heavy chain and gp120 compared with VRC01 (Table 5, below). The extra contacts with gp120 created by the CDRH3 insertion allow the NIH45-46 footprint on gp120 to more closely resemble the CD4 footprint on gp120 than does the VRC01 footprint (
(83) TABLE-US-00005 TABLE 5A Buried Surface Area (Å.sup.2) Total Interface CDR2 + FWR1 CDR1 FWR2 CDR2 FWR3 CDR3 Fab on gp120 FWR3.sub.56-65* NIH45-46 HC 0 35 51 181 551 326 1144 1097 576 VRC01 HC 0 20 98 136 521 117 892 882 545 NIH45-46 LC 35 8 0 0 0 159 203 192 0 VRC01 LC 36 114 0 0 0 165 314 367 0 *Residues that correspond to the CDR2 region as defined in Zhou et al., Science, 2010, 329: 811-817.
(84) TABLE-US-00006 TABLE 5B Inner domain & Outer bridging Loop D + β-15/α-3 + domain exit Total Interface on sheet NAG NAG V5 β-24 loop gp120 Fab or CD4 NIH45-46 328 335 222 292 81 35 1290 1346 VRC01 157 433 208 328 43 57 1225 1206 CD4 400 136 263 155 14 97 973 1059
(85) The observation that NIH45-46 shows more extensive contacts relative to VRC01 with the inner domain and bridging sheet of gp120 (
Example 2. Hydrophobic Amino Acid Substitution at Position 54 of NIH45-46
(86) Although NIH45-46 increases its contacts with the inner domain/bridging sheet area of gp120, like VRC01, it lacks a critical CD4 contact to a hydrophobic pocket at the boundary between the gp120 bridging sheet and outer domain made by burying Phe43CD4. This residue alone accounts for 23% of the interatomic contacts between CD4 and gp120, serving as a “linchpin” that welds CD4 to gp120 (Kwong et al., 1998, Nature, 393:648-659). On gp120, the Phe43 binding cavity is a binding site of small-molecule CD4 mimics (Madani et al., 2008, Structure, 16:1689-1701), and a desirable target for compounds to disrupt CD4-gp120 interactions (Kwong et al., 1998, supra), yet it remains unfilled in the 93TH057 complexes with VRC01 (Zhou et al., 2010, supra) and NIH45-46. In a superimposition of a CD4-gp120 structure and NIH45-46-gp120 (
(87) A series of NIH45-46 mutants were constructed to test the possibility that a hydrophobic sidechain at position 54 in NIH45-46 would improve activity. First it was verified that substitutions at residue 54 did not interfere with antigen binding by assessing the ability of one mutant, NIH45-46.sup.G54W, to bind core gp120s. Surface plasmon resonance (SPR) binding analyses demonstrated that NIH45-46.sup.G54W Fab bound core gp120s with slightly higher affinities than did NIH45-46 Fab, with differences largely due to slower dissociation rates (
(88) TABLE-US-00007 TABLE 6 NIH45-46 IC.sub.50 (μg/mL) Virus Clade WT G54W G54F G54Y G54I G54M G54L G54H SC422661.8 B 0.06 0.03 0.02 0.06 0.1 0.06 0.1 0.09 AC10.0.29 B 0.9 0.2 0.3 0.4 8.6 1.5 1.7 0.6 TRO.11 B 1.0 0.09 0.08 0.1 10 0.3 0.3 0.2 Du172.17 C >50 0.9 16 >50 >50 >50 >50 >50 CAP210.2.00.E8 C >50 41 >50 >50 >50 >50 >50 >50 CAP45.2.00.G3 C >50 6.6 >50 45 >50 >50 >50 >50
(89) NIH45-46.sup.54W and NIH45-46.sup.G54F showed increased potencies and NIH45-46.sup.G54W increased breadth by neutralizing three strains that are resistant to >50 μg/mL of NIH45-46. The apparent increase in breadth is likely due to increased potency as evidenced by the extrapolated IC.sub.50 for NIH45-46 against strain DU172.17 (
(90) An additional 82 viruses were tested including 13 NIH45-46-resistant, 14 weakly-neutralized, and 55 sensitive strains representing all clades, of which 12 are transmitted founder viruses (
(91) TABLE-US-00008 TABLE 7 In vitro neutralization IC.sub.50 values (μg/mL) in the “hard panel” of viruses NIH45-46 IC.sub.50 (μg/mL) Virus Clade Category WT G54W G54F G54Y 6545.v4.c1 AC R >50 18.92 >50 >50 6540.v4.c1 AC R >50 >50 >50 >50 CAP45.2.00. G3 C R >50 32.25 >50 >50 Du422.1 C R >50 >50 >50 >50 CAP210.2.00.E8 C R >50 >50 >50 >50 3817.v2.c59 CD R >50 >50 >50 >50 89-F1_2_25 CD R >50 >50 >50 >50 620345.c01 CRF01_AE R >50 >50 >50 >50 T250-4 CRF02_AG R >50 1.33 >50 >50 T278-50 CRF02_AG R >50 >50 >50 >50 211-9 CRF02_AG R >50 16.41 >50 >50 3016.v5.c45 D R >50 1.47 5.82 17.89 Du172.17 C R >50 3.65 >50 >50 3718.v3.c11 A P 19.61 0.01 0.32 0.30 703357.C02 CRF01_AE P 19.17 3.43 7.91 5.60 CNE20 BC P 7.83 0.04 0.53 0.33 CNE21 BC P 6.01 0.03 0.12 0.07 HIV-16845-2.22 C P 5.00 0.45 0.59 0.59 C2101.c01 CRF01_AE P 4.24 0.04 0.11 0.09 ZM247v1(Rev-) C P, T/F 2.94 0.32 0.28 0.42 ZM233M.PB6 C P 2.50 0.02 0.22 0.16 C1080.c03 CRF01_AE P 2.48 0.20 0.36 0.29 THRO4156.18 B P 1.91 0.54 0.89 0.66 3103.v3.c10 ACD P 1.770 0.200 0.370 0.300 231966.c02 D P 1.640 0.020 0.060 0.060 TRO.11 B P 1.610 0.040 0.110 0.080 T251-18 CRF02_AG P 1.350 0.260 0.410 0.350 Ce1176_A3 C S, T/F 0.930 0.160 0.240 0.210 QH0692.42 B S 0.720 0.370 0.560 0.520 T255-34 CRF02_AG S 0.710 <0.001 0.030 0.040 ZM135M.PL10a C S 0.590 0.040 0.130 0.090 AC10.0.29 B S 0.560 0.130 0.240 0.190 T257-31 CRF02_AG S 0.490 0.130 0.170 0.180 CNE58 BC S 0.430 0.020 0.040 0.040 Ce0393_C3 C S, T/F 0.334 0.013 0.040 0.036 R1166.c01 CRF01_AE S 0.310 0.130 0.400 0.240 CNE30 BC S 0.309 0.052 0.100 0.099 CNE17 BC S 0.261 0.036 0.075 0.073 X2131_C1_B5 G S 0.230 0.050 0.100 0.100 928-28 CRF02_AG S 0.230 0.060 0.110 0.120 6535.3 B S 0.230 0.030 0.070 0.080 ZM53M.PB12 C S 0.175 0.040 0.080 0.060 ZM214M.PL15 C S 0.170 0.030 0.090 0.060 Ce703010054_2A2 C S, T/F 0.159 0.027 0.020 0.022 ZM197M.PB7 C S 0.150 0.040 0.090 0.070 CAAN5342.A2 B S 0.150 0.070 0.100 0.100 Q23.17 A S 0.140 0.010 0.030 0.020 PVO.4 B S 0.120 0.050 0.070 0.060 1054_07_TC4_1499 B S, T/F 0.113 0.040 0.076 0.064 Ce2010_F5 C S, T/F 0.101 0.038 0.046 0.049 ZM109F.PB4 C S 0.095 0.002 0.022 0.026 1056_10_TA11_1826 B S, T/F 0.094 0.024 0.064 0.044 0330.v4.c3 A S 0.090 0.030 0.040 0.030 P1981_C5_3 G S 0.080 0.020 0.030 0.040 Q461.e2 A S 0.076 0.009 0.030 0.023 P0402_c2_11 G S 0.073 0.003 0.008 0.012 SC422661.8 B S 0.060 0.020 0.040 0.040 62357_14_D3_4589 B S, T/F 0.060 0.020 0.040 0.030 WITO4160.33 B S 0.060 0.010 0.020 0.030 Ce2060_G9 C S, T/F 0.058 0.005 0.022 0.021 Ce0682_E4 C S, T/F 0.054 0.010 0.011 0.017 231965.c01 D S 0.051 <0.001 0.022 0.025 Q259.d2.17 A S 0.043 <0.001 0.009 0.009 TRJO4551.58 B S 0.040 0.010 0.030 0.030 6811.v7.c18 CD S 0.035 <0.001 0.017 0.011 R2184.c04 CRF01_AE S 0.034 0.005 0.015 0.015 6480.v4.c25 CD S 0.032 0.004 0.014 0.018 X1254_c3 G S 0.032 0.002 0.011 0.013 Q842.d12 A S 0.031 0.005 0.011 0.015 C3347.c11 CRF01_AE S 0.029 <0.001 0.015 0.011 1006_11_C3_1601 B S, T/F 0.027 <0.001 0.003 0.005 3415.v1.c1 A S 0.022 <0.001 <0.001 <0.001 X1193_c1 G S 0.021 <0.001 <0.001 0.006 Du156.12 C S 0.020 <0.001 <0.001 0.007 RHPA4259.7 B S 0.017 <0.001 0.005 0.007 ZM249M.PL1 C S 0.017 0.002 0.004 0.003 0815.v3.c3 ACD S 0.014 <0.001 <0.001 <0.001 REJO4541.67 B S 0.014 0.002 0.007 0.007 3301.v1.c24 AC S 0.009 <0.001 0.001 0.003 Q769.d22 A S 0.009 <0.001 0.005 0.007 CNE53 BC S 0.008 <0.001 0.005 0.006 WEAU_d15_410_787 B S, T/F 0.005 <0.001 <0.001 0.002 Geometric means 0.417 0.046 0.120 0.124 Category R-Resistant P-Poorly sensitive S-Sensitive T/F-Transmitted Founder
(92) TABLE-US-00009 TABLE 8 In vitro neutralization IC.sub.80 values (μg/mL) in the “hard panel” of viruses NIH45-46 IC.sub.80 (μg/mL) Virus Clade Category WT G54W G54F G54Y T250-4 CRF02_AG R >50 44.94 >50 >50 703357.C02 CRF01_AE R >50 17.61 >50 30.58 CAP45.2.00.G3 C R >50 >50 >50 >50 CNE20 BC R >50 0.48 3.91 2.40 CAP210.2.00.E8 C R >50 >50 >50 >50 T278-50 CRF02_AG R >50 >50 >50 >50 211-9 CRF02_AG R >50 >50 >50 >50 620345.c01 CRF01_AE R >50 >50 >50 >50 3016.v5.c45 D R >50 15.37 36.97 >50 3817.v2.c59 CD R >50 >50 >50 >50 89-F1_2_25 CD R >50 >50 >50 >50 6540.v4.c1 AC R >50 >50 >50 >50 6545.v4.c1 AC R >50 >50 >50 >50 Du422.1 C P >50 >50 >50 >50 3718.v3.c11 A P >50 0.04 4.620 3.85 Du172.17 C P >50 42.85 >50 >50 CNE21 BC P 38.07 0.16 0.66 0.29 C2101.c01 CRF01_AE P 31.37 0.17 0.42 0.27 ZM247v1(Rev-) C P, T/F 24.50 2.60 2.45 3.57 HIV-16845-2.22 C P 22.61 2.10 2.75 2.75 ZM233M.PB6 C P 14.18 0.11 0.99 0.78 C1080.c03 CRF01_AE P 11.56 0.91 2.26 1.83 231966.c02 D P 9.64 0.11 0.24 0.23 THRO4156.18 B P 8.22 1.81 3.01 2.14 TRO.11 B P 7.49 0.13 0.30 0.22 3103.v3.c10 ACD P 6.15 0.56 1.28 0.81 T251-18 CRF02_AG P 3.68 0.92 1.38 1.16 T255-34 CRF02_AG S 3.442 0.099 0.198 0.174 Ce1176_A3 C S, T/F 3.17 0.45 0.83 0.58 ZM135M.PL10a C S 2.79 0.16 0.43 0.30 CNE58 BC S 2.08 0.05 0.11 0.11 AC10.0.29 B S 1.93 0.63 1.12 0.90 QH0692.42 B S 1.71 1.12 1.65 1.50 T257-31 CRF02_AG S 1.38 0.45 0.51 0.67 R1166.c01 CRF01_AE S 1.21 0.51 1.32 0.84 CNE30 BC S 1.067 0.196 0.348 0.263 Ce0393_C3 C S, T/F 0.936 0.089 0.173 0.134 X2131_C1_B5 G S 0.88 0.24 0.41 0.39 CNE17 BC S 0.734 0.127 0.287 0.264 928-28 CRF02_AG S 0.64 0.25 0.41 0.33 ZM53M.PB12 C S 0.61 0.16 0.23 0.22 ZM214M.PL15 C S 0.59 0.15 0.30 0.23 ZM197M.PB7 C S 0.55 0.18 0.23 0.21 6535.3 B S 0.54 0.13 0.27 0.24 Ce703010054_2A2 C S, T/F 0.538 0.077 0.070 0.070 Q23.17 A S 0.50 0.03 0.07 0.06 1056_10_TA11_1826 B S, T/F 0.447 0.160 0.283 0.189 ZM109F.PB4 C S 0.437 0.070 0.17 0.168 PVO.4 B S 0.41 0.16 0.25 0.18 1054_07_TC4_1499 B S, T/F 0.404 0.165 0.283 0.236 CAAN5342.A2 B S 0.40 0.21 0.28 0.27 Ce2010_F5 C S, T/F 0.357 0.187 0.186 0.235 0330.v4.c3 A S 0.3 0.11 0.13 0.09 Q461.e2 A S 0.291 0.091 0.135 0.103 Ce2060_G9 C S, T/F 0.290 0.042 0.085 0.068 WITO4160.33 B S 0.26 0.04 0.14 0.09 P1981_C5_3 G S 0.24 0.07 0.11 0.09 P0402_c2_11 G S 0.214 0.023 0.047 0.049 1006_11_C3_1601 B S, T/F 0.196 0.008 0.024 0.021 62357_14_D3_4589 B S, T/F 0.19 0.07 0.14 0.09 Ce0682_E4 C S, T/F 0.155 0.039 0.056 0.065 Q259.d2.17 A S 0.154 0.014 0.036 0.034 SC422661.8 B S 0.13 0.07 0.10 0.09 TRJO4551.58 B S 0.13 0.05 0.08 0.07 R2184.c04 CRF01_AE S 0.127 0.036 0.054 0.045 231965.c01 D S 0.126 0.035 0.062 0.054 6811.v7.c18 CD S 0.113 0.033 0.063 0.059 X1254_c3 G S 0.107 0.018 0.043 0.041 6480.v4.c25 CD S 0.100 0.021 0.046 0.051 C3347.c11 CRF01_AE S 0.094 0.028 0.059 0.052 3415.v1.c1 A S 0.086 0.023 0.029 0.037 Q842.d12 A S 0.073 0.025 0.039 0.045 X1193_c1 G S 0.064 0.009 0.026 0.024 Du156.12 C S 0.054 0.005 0.019 0.026 ZM249M.PL1 C S 0.053 0.007 0.016 0.011 0815.v3.c3 ACD S 0.052 0.003 0.014 0.015 RHPA4259.7 B S 0.047 0.007 0.020 0.020 CNE53 BC S 0.039 0.005 0.024 0.027 REJO4541.67 B S 0.035 0.013 0.028 0.020 3301.v1.c24 AC S 0.033 0.004 0.011 0.014 Q769.d22 A S 0.033 0.009 0.023 0.024 WEAU_d15_410_787 B S, T/F 0.015 0.003 0.004 0.008 Geometric means 1.231 0.225 0.437 0.393 Category R-Resistant P-Poorly sensitive S-Sensitive T/F-Transmitted Founder
(93) The above panel of viruses in Tables 7 and 8 (referred to as the “hard panel”) is more difficult for NIH45-46 to neutralize than a recently-published panel (Sheid et al, 2011, supra) (
(94) TABLE-US-00010 TABLE 9 Sequence correlates of resistance to NIH45-46 Strain 620345_c1 Ser456 (Arg) Asp459 (Gly) Lys279 (Asn/Asp) 89_F1_2_25 Ser456 (Arg) Asn458 (Gly) 6540_v4_c1 Ser456 (Arg) Tyr458 (Gly) Ser280 (Asn) 6545_v4_c1 Ser456 (Arg) Tyr458 (Gly) Ser280 (Asn) Du422.1 Trp456 (Arg) T250_4 Pro459 (Gly) T278_50 Glu459 (Gly) Ala279 (Asn/Asp) Ce1172_H1 deletion of Gly459 X2088_c9 Val459 (Gly) H086.8 Asp459 (Gly) Lys279 (Asn/Asp)
(95) As shown in Table 9, above, 10 of 17 NIH45-46-resistant strains (5 of 7 NIH45-46.sup.G54W-resistant strains) have amino acid variations at NIH45-46-contacting residues that have a fully conserved residue (shown in parenthesis) in all NIH45-46 sensitive strains. These mutations occur in the 323 strand immediately preceding V5 and in loop D. The positions of underlined sites have been shown to be important in resistance to VRC01 as reported in Li et al., 2011, J. Virol., 85:8954-8967.
(96) The largest difference between sensitivity to NIH45-46 and sensitivity to VRC01 was in strain 3016.v5.c45 (IC.sub.50s of >30 and 0.16 μg/mL, respectively). The most notable residue in 3016.v5.c45 is Tyr282 in loop D. This large residue may alter the conformation of loop D, which is closely contacted by the four-residue insertion in the NIH45-46 CDRH3. The absence of the insertion may permit VRC01 to better accommodate an altered loop D. The next largest NIH45-46/VRC01 difference, for strain C2101.c1 (12.78 vs. 0.36 μg/mL), may similarly relate to the unusual Lys99.sub.gp120 residue replacing the asparagine that favorably interacts with Arg99b.sub.NIH45-46 in the NIH45-46-gp120 crystal structure.
(97) From the neutralization assays, it is noted that NIH45-46.sup.G54W gained de novo neutralization activity against six NIH45-46 resistant strains, including the only three that were sensitive to VRC01 but resistant to NIH45-46 in the panel tested in Sheid et al, 2011, supra. For some strains that NIH45-46 neutralizes poorly, NIH45-46.sup.G54W was significantly more potent (e.g., improvements of >700-fold for T255-34 and 2000-fold for 3718.v3.c11). The enhanced neutralization activity of NIH45-46.sup.G54W implies that Trp54 forms a favorable hydrophobic interaction with Phe43 cavity of gp120 as seen in VRC03-gp120 (PDB 3SE8). NIH45-46.sup.G54F showed some increased activity (Tables 6, 7 and 8). Substituting Gly54 with tryptophan adds about 140 Å.sup.2 of buried surface area on V.sub.H when complexed with gp120, and is consistent with the reduced dissociation rates observed in surface plasmon resonance (SPR) experiments (
(98) Heavy chain residue 54 is not conserved in HAADs; in addition to glycine (NIH45-46 and VRC01), residue 54 can be threonine (3BNC60, 3BNC117, 3BNC115; VRC-PG04), tyrosine (12A12), phenylalanine (12A21), or arginine (1B2530 and 1NC9), as reported in Sheid et al., 2011, supra; and Wu et al., 2011, supra. Tryptophan substitution in some HAADs was tested and shown in Table 10, below.
(99) TABLE-US-00011 TABLE 10 In vitro neutralization IC.sub.50 values (μg/mL) 3BNC60 3BNC60 3BNC117 3BNC117 3BNC55 3BNC55 12A12 12A12 Virus Clade WT T54W WT T54W WT T54W WT Y54W SC422661.8 B 0.1 0.1 0.07 0.07 0.3 0.6 0.2 0.2 AC10.0.29 B 13 3.1 6.5 2.8 >50 >50 0.6 0.5 TRO.11 B 0.07 0.06 0.6 0.6 7.6 >50 0.3 0.2 Du172.17 C 0.05 0.04 0.04 0.9 2 >50 0.2 0.1 CAP210.2.00.E8 C 4.7 5.0 11 2.8 >50 >50 >50 >50 CAP45.2.00.G3 C 10 19 16 23 >50 >50 0.4 0.2
(100) Passive immunization and/or gene therapy to deliver HIV antibodies is increasingly being considered as an option for prevention of HIV infection. To reduce the concentrations and numbers of antibodies required for protection to realistic and affordable levels, highly potent and broadly neutralizing antibodies are the reagents of choice for passive delivery. Although it is difficult to compare the potencies and breadth of antibodies characterized using different virus panels, the natural form of NIH45-46 exhibits superior potency to VRC01 when compared against a panel of 82 Tier 2 and 3 viruses representing all known HIV clades (Sheid et al., 2011, supra). One set of HIV antibodies, the PGT antibodies that recognize the gp120 V3 loop and associated carbohydrates, exhibited median IC.sub.50s up to 10-fold lower than VRC01 (Walker et al., 2011, Nature, 477:466-471, the entire contents of which are incorporated herein by reference), but are less potent and broad than NIH45-46.sup.G54W (
(101) TABLE-US-00012 TABLE 11 IC.sub.50 from PGT antibodies and VRC01 using the same virus panel PGT- PGT- PGT- PGT- PGT- PGT- PGT- PGT- PGT- PGT- Isolate 121 122 123 125 126 127 128 130 131 135 Include > Geometric 0.53 1.03 0.66 1.85 1.05 2.92 0.39 3.07 7.27 9.53 50 mean (μg/mL) Arithmetic 16.63 19.39 18.29 25.81 21.75 26.19 15.31 25.39 31.06 34.91 mean Median 0.31 2.02 0.35 34.97 1.08 42.83 0.10 22.98 50.00 50.00 Exclude > Geometric 0.07 0.13 0.08 0.09 0.08 0.17 0.06 0.24 0.41 0.32 50 mean (μg/mL) Arithmetic 2.17 3.21 2.44 3.34 2.82 2.39 1.56 3.09 2.80 3.88 mean Median 0.03 0.05 0.03 0.04 0.04 0.08 0.02 0.16 0.52 0.17 % viruses < 50 70% 65% 67% 52% 60% 50% 72% 52% 40% 33% (μg/mL) PGT- PGT- PGT- PGT- PGT- PGT- PGT- VRC0 VRC- Isolate 136 137 141 142 143 144 145 1 PG04 PG9 Include > Geometric 30.39 23.53 3.15 2.40 3.14 13.62 0.91 0.45 0.57 1.27 50 mean (μg/mL) Arithmetic 44.02 41.22 24.62 23.30 24.62 33.76 12.83 4.41 7.92 15.89 mean Median 50.00 50.00 16.01 9.46 13.76 50.00 0.86 0.34 0.30 0.62 Exclude > Geometric 2.25 1.68 0.33 0.24 0.34 1.58 0.30 0.32 0.30 0.36 50 mean (μg/mL) Arithmetic 12.74 10.51 3.80 2.99 4.32 6.87 2.59 1.04 1.99 4.33 mean Median 7.81 3.46 0.35 0.21 0.31 2.06 0.29 0.32 0.20 0.23 % viruses < 50 16% 22% 55% 57% 56% 38% 78% 92% 88% 75% (μg/mL)
(102) Table 11 above shows a comparison of mean and median IC.sub.50 (μg/mL) values for PGT antibodies and VRC01. A direct comparison between NIH45-46 and the PGT antibodies is not available. However, VRC01 (which was shown in a direct comparison to be less potent than NIH45-46) was directly compared to the PGT antibodies using the same virus panel. (Sheid et al., 2011, supra.) Mean IC.sub.50 values were calculated using data taken from Sheid et al., 2011, supra. Geometric and arithmetic means were calculated to include data for all viral strains (listed as Include >50, in which case, values reported as IC.sub.50>50 μg/mL were entered as 50 μg/mL in the calculation) and to exclude viral strains in which the IC.sub.50 was >50 μg/mL (listed as Exclude >50, in which case the percent of viral strains with IC.sub.50s <50 μg/mL is also reported). Mean IC.sub.50s are compared with the median IC.sub.50s as reported in Sheid et al., 2011, supra.
(103) Contacts between the antibody light chain and gp120 are mostly conserved between the NIH45-46-93TH057 and VRC01-93THO57 structures with a notable exception: Ser28.sub.NIH45-46 LC in CDRL1 replaces a solvent-exposed tyrosine (Tyr28.sub.VRCO1 LC) that interacts with ordered N-linked carbohydrate attached to Asn276.sub.93TH057. By contrast, the Ser28.sub.NIH45-46 LC sidechain does not contact gp120 carbohydrates; instead it faces away from gp120, hydrogen bonding with Arg64.sub.NIH45-46 LC (FWR3) and creating a 2.7 Å displacement of the main-chain Cα atoms (
(104) TABLE-US-00013 TABLE 12 In vitro neutralization IC.sub.50 values (μg/mL) NIH45- VRC01 46 HC HC NIH45- VRC01 NIH45- Virus Clade 46 LC 46 LC VRC01 AC10.0.29 B 0.9 1.0 4.5 0.8 TRO.11 B 1.9 0.3 24 0.5 SC422661.8 B 0.05 0.2 0.4 0.2 QH0692.42 B 0.7 0.9 1.2 0.7 ZM214M.PL15.11 C 0.5 0.6 1.8 0.8 CAP45.2.00.G3 C >50 2.1 >50 1.8 T257-31 CRF02 0.5 0.6 15 1.0 (A/G)
Example 3. Protein Expression and Purification
(105) Proteins were produced and purified using previously-described methods (Diskin et al., 2010, Nat. Struct. Mol. Biol., 17:608-613, the entire contents of which are incorporated herein by reference). Briefly, NIH45-46 IgG was expressed by transient transfection in HEK293-6E cells. Secreted IgG was purified from cell supernatants using protein A affinity chromatography (GE Healthcare). Fab fragments were prepared by digesting purified IgG with immobilized papain (Pierce) at 10 mg/mL and then separating Fabs from Fc-containing proteins using protein A chromatography and Superdex 200 16/60 size exclusion chromatography. For crystallization trials, the NIH45-46 Fab for crystallization experiments was concentrated to 11 mg/mL in 20 mM Tris pH 8.0, 150 mM sodium chloride, 0.02% sodium azide (TBS). Substitutions in heavy chain residue 54 of NIH45-46, 3BNC55, 12A12, 3BNC117 and 3BNC60 were introduced using a Quikchange II kit (Agilent technologies). Wild type, mutant forms and chain swapped versions of these proteins were expressed as IgGs in HEK293-6E cells and purified by protein A chromatography as described for NIH45-46 IgG. Proteins were stored at a concentration of 1 mg/mL for neutralization assays in either 10 mM sodium citrate pH 3.05, 50 mM sodium chloride, 0.02% sodium azide or in TBS (12A12 and 12A12.sup.Y54W) or in phosphate buffered saline (NIH45-46 mutated/truncated in CDRH3 and NIH45-46/VRC01 heavy and light chain swapped antibodies (Abs)) prior to dilution into neutral pH cell media. For SPR analyses, NIH45-46 and NIH45-46.sup.G54W heavy chains were subcloned into the pTT5 (NRC-BRI) expression vector to encode C-terminal 6×-His tagged Fab heavy chains (V.sub.H-C.sub.H1-6×-His tag), and the heavy chain expression vectors were co-transfected with the appropriate light chain vector into HEK293-6E cells. Supernatants were collected after 7 days, buffer exchanged into TBS and loaded on a Ni.sup.2+-NTA affinity column (Qiagen). Fabs were eluted using TBS supplemented with 250 mM imidazole and further purified by Superdex200 10/300 size exclusion chromatography (GE Healthcare) in TBS.
(106) Genes encoding truncated 93TH053, CAP244.2.00.D3, and Q259.d2.17 gp120 cores including the deletions and modifications described in Zhou et al., 2010, supra (the entire contents of which are incorporated herein by reference), were chemically synthesized (BlueHeron). An extra disulfide bond was introduced into 93TH053 by changing the Val65 and Ser115 codons into cysteines.
(107) The modified core genes were subcloned into the pACgp67b expression vector (BD Biosynthesis) to include a C-terminal 6×-His tag, expressed in baculovirus-infected insect cells, and purified from insect cell supernatants as previously described in Diskin et al., 2010, supra. For crystallization experiments, purified NIH45-46 Fab and 93TH057 gp120 were incubated at a 1:1 molar ratio and treated with 40 kU of Endoglycosidase H (New England Biolabs) for 16 hours at 37° C. The complex was purified after the incubation by Superdex 200 10/300 size exclusion chromatography (GE Healthcare) and then concentrated to OD.sub.280=9.6 in 20 mM Tris pH 8.0, 300 mM sodium chloride, 0.02% sodium azide.
Example 4. Crystallization
(108) Crystallization screening was done by vapor diffusion in sitting drops by a Mosquito® crystallization robot (TTP labs) using 400 nL drops (1:1 protein to reservoir ratio) utilizing commercially available crystallization screens (Hampton). Initial crystallization hits for Fab NIH45-46 and for NIH45-46-93TH057 complex were identified using the PEGRx HT™ (Hampton) screen and then manually optimized. Thin needle-like crystals of Fab NIH45-46 (space group P2.sub.12.sub.12.sub.1, a=49.4 Å, b=87.4 Å, c=166.4 Å; one molecule per asymmetric unit) were obtained upon mixing a protein solution at 11 mg/mL with 12% polyethylene glycol 20,000, 0.1 M sodium acetate pH 5.0, 0.1 M sodium/potassium tartrate, 0.02 M ammonium sulfate at 20° C. Crystals were briefly soaked in mother liquor solution supplemented with 15% and then 30% glycerol before flash cooling in liquid nitrogen. Crystals of the NIH45-46-93TH057 complex (space group P2.sub.12.sub.12.sub.1, a=69.1 Å, b=70.5 Å, c=217.7 Å; one molecule per asymmetric unit) were obtained upon mixing a protein solution at OD.sub.280=9.6 with 12% isopropanol, 10% polyethylene glycol 10,000, 0.1 M sodium citrate pH 5.0 at 20° C. Complex crystals were cryo-cooled by covering the crystallization drops with paraffin oil to prevent evaporation and then adding an excess of 20% isopropanol, 5% glycerol, 10% polyethylene glycol, 0.1 M sodium citrate pH 5.0 to the drops prior to mounting and flash cooling the crystals in liquid nitrogen.
Example 5. Data Collection, Structure Solution and Refinement
(109) X-ray diffraction data were collected at the Stanford Synchrotron Radiation Lightsource (SSRL) beamline 12-2 using a Pilatus 6M pixel detector (Dectris). The data were indexed, integrated and scaled using XDS as described in Kabsch, 2010, Acta Crystallogr D Biol Crystallogr, 66:125-132, the entire contents of which are incorporated herein by reference. The Fab NIH45-46 structure was solved by molecular replacement using Phaser as described in McCoy et al., 2007, J. Appl. Cryst., 40:658-674, the entire contents of which are incorporated herein by reference, and the V.sub.HV.sub.L and C.sub.H1C.sub.L domains of the VRC01 Fab (PDB code 3NGB) as separate search models. The model was refined to 2.6 Å resolution using an iterative approach involving refinement using the Phenix crystallography package Adams et al., 2010, Acta Crystallogr D Biol Crystallogr, 66:213-221, the entire contents of which are incorporated herein by reference, and manually fitting models into electron density maps using Coot (Emsley et al., 2004, Acta Crystallogr D Biol Crystallogr, 60:2126-2132, the entire contents of which are incorporated herein by reference). The final model (R.sub.work=18.4%; R.sub.free=23.8%) includes 3380 protein atoms, 125 water molecules and 37 ligand atoms, including N-Acetylglucosamine, glycerol and a sulfate ion (
(110) A search model for solving the NIH45-46-93TH057 complex was created by superimposing the refined structure of the NIH45-46 Fab on the VRC01 Fab in the structure of VRC01-93TH057 (PDB code 3NGB). A molecular replacement solution was found as described above using separate search models for the V.sub.HV.sub.L domains of NIH45-46 complexed with 93TH057 and the C.sub.H1C.sub.L domains of NIH45-46. (
(111) Buried surface areas were calculated using ArealMol in CCP4 and a 1.4 Å probe. Superimposition calculations were done and molecular representations were generated using PyMol (The PyMOL Molecular Graphics System, Schridinger, LLC).
Example 6. Surface Plasmon Resonance (SPR) Measurements
(112) The binding of gp120 core proteins to wild-type NIH45-46 Fab and to mutant (NIH45-46.sup.G54W) Fab was compared using a Biacore T100 instrument (GE Healthcare). Purified NIH45-46 and NIH45-46.sup.G54W Fabs were immobilized at coupling densities of 500 resonance units (RU) or 1500 RU on a CM5 sensor chip (Biacore) in 10 mM acetate pH 5.0 using primary amine coupling chemistry as described in the Biacore manual. One of the four flow cells on each sensor chip was mock-coupled using buffer to serve as a blank. Experiments were performed at 25° C. in 20 mM HEPES, pH 7.0, 150 mM sodium chloride and 0.005% (v/v) surfactant P20, and the sensor chips were regenerated using 10 mM glycine, pH 2.5. gp120 core proteins were injected in a two-fold dilution series at concentrations ranging from 500 nM to 31.2 nM at a flow rate of 70 paL/min. After subtracting the signal from the mock-coupled flow cell, kinetic data were globally fit to a 1:1 binding model (Biacore evaluation software) to derive on- and off-rate constants, which were used to calculate affinities as K.sub.D=k.sub.d/k.sub.a.
Example 7. In Vitro Neutralization Assays
(113) A previously-described pseudovirus neutralization assay was used to compare the neutralization potencies of wild-type and mutant IgGs as previously described in Montefiori, 2005, Current protocols in immunology, Edited by John E. Coligan et al., Chapter 12, Unit 12.11, the entire contents of which are incorporated herein by reference. Briefly, pseudoviruses were generated in HEK293T cells by co-transfection of an Env-expressing vector and a replication-incompetent backbone plasmid. Neutralization was assessed by measuring the reduction in luciferase reporter gene expression in the presence of a potential inhibitor following a single round of pseudovirus infection in TZM-bl cells. Antibodies were pre-incubated with 250 infectious viral units in a three or four-fold dilution series for one hour at 37° C. before adding 10,000 TZM-bl cells per well for a two-day incubation. Cells were then lysed and luciferase expression was measured using BrightGlo (Promega) and a Victor3 luminometer (PerkinElmer). Nonlinear regression analysis using the program Prism (GraphPad) was used to calculate the concentrations at which half-maximal inhibition was observed (IC.sub.50 values) as described in Klein et al., 2009, PNAS, 106:7385-7390, the entire contents of which are incorporated herein by reference. Samples were initially screened in duplicates. Reagents that showed enhanced activity were tested again as triplicates. Values for NIH45-46 and NIH45-46.sup.G54W in
Example 8. Signature Features of PVL Antibodies
(114) The correlation between neutralization potency and the length of two of the light chain CDR loops was analyzed in CD4bs antibodies. The relatively small CDRL1 of VRC01, which has a 2-residue deletion relative to its germline precursor, was previously correlated with increased neutralization potency (Zhou et al., 2010, supra). It was noted that sequences of VRC01, NIH45-46, and VRC-PG04 revealed a more striking correlation for the length of CDRL3, which is only 5 residues in these antibodies. Examination of the large Abysis database for human Ab sequences (http://www.bioinf.org.uk/abs/) showed that only about 1% of V.sub.L domains have a CDRL3 length of 5 amino acids, compared with more typical 9-11 residue lengths. Larger CDRL3 loops would place critical side chains at the tip of CDRL3 in different locations, thus not able to interact with gp120 in the same manner. In antibodies with longer CDRL3s, the tip of CDRL3 interacts with Trp47.sub.HC, a highly conserved residue (found in 63 of 69 germline V.sub.H gene segments) that plays a similar role as Trp102.sub.HC in the Abs with 5-residue CDRL3s to stabilize the V.sub.H-V.sub.L interface.
(115) V domain alignments revealed the following sequence characteristics of the most potent of the VRC01-like Abs: complete conservation of heavy chain Arg71.sub.HC, Trp50.sub.HC, Asn58.sub.HC, and Trp102.sub.HC, and light chain Glu90.sub.LC, Trp65.sub.LC/Phe65.sub.LC and a CDRL3 length of exactly 5 amino acids (residues are numbered here as in the structure of NIH45-46; pdb code 3U7Y). Analysis of the per residue variability of VH1-2*02-derived Abs indicates that the conservation of Trp50.sub.HC and Asn58.sub.HC is unlikely to be coincidental.
(116) The roles that conserved residues play in the V.sub.H domain structure and in binding to the CD4bs on gp120 are shown schematically in
(117) TABLE-US-00014 TABLE 13 PVL Features PVL Characteristic feature Role Trp50.sub.HC H bond with Asn280.sub.gp120 Asn58.sub.HC H bond with Arg456.sub.gp120 Arg71.sub.HC H bond/salt bridge with Asp368.sub.gp120 Trp102*.sub.HC H bond with Asn/Asp279.sub.gp120 Glu90**.sub.LC H bond with Gly459.sub.gp120 Trp65***.sub.LC/ interaction with Asn276.sub.gp120 glycan Phe65***.sub.LC 5-residue CDRL3 prevent steric clashes, position 89.sub.LC & 90.sub.LC side chains *Position Trp100B; **Postion Glu96; and ***Trp67/Phe67 using Kabat numbering system.
(118) The side chains of Trp50.sub.HC, Trp102.sub.HC, and Trp47.sub.HC form an unusual propeller-like arrangement on the surface the V.sub.H domain. (Although Trp47.sub.HC participates in the “propeller,” it is not considered to be a signature residue of potent CD4bs antibodies because it is commonly found in V.sub.H domains.) The main interactions of the characteristic V.sub.H domain residues with gp120 are as follows: Trp50.sub.HC: indole N—H hydrogen bonds with the side chain oxygen of Asn280.sub.gp120; Asn58.sub.HC: side chain N—H hydrogen bonds with the backbone carbonyl of Arg456.sub.gp120; Arg71.sub.HC: side chain hydrogen bonds/salt bridges with the side chain of Asp368.sub.gp120; and Trp102.sub.HC: indole N—H hydrogen bonds with the side chain oxygen of Asn/Asp279.sub.gp120. Trp102.sub.HC also buries 85 Å.sup.2 of surface area at the V.sub.H/V.sub.L interface—contacting residues Tyr89.sub.LC and Glu90.sub.LC.
(119) In the light chains, the side chain of Glu90.sub.LC forms a hydrogen bond with the backbone nitrogen of Gly459.sub.gp120 and/or the side chain of Asn280.sub.gp120. The conservation of Trp65.sub.LC/Phe65.sub.LC is surprising as this position is distant from gp120 in the available crystal structures.
(120) For those interactions that depend on specific gp120 side chains, the degree of conservation of the relevant gp120 residues is 96.4% for Asn/Asp279.sub.gp120, 96.4% for Asn280.sub.gp120, and 99.7% for Asp368.sub.gp120 (based on the 2010 filtered web alignment of 2869 HIV-1 sequences in the Los Alamos HIV database; http://www.hiv.lanl.gov/). Arg456.sub.gp120, which is involved in a main-chain hydrogen bond with the sidechain of Asn58.sub.HC, is also highly conserved (95.0%).
(121) An SPR-based binding assay demonstrated detectable binding of the germline heavy chain/mature light chain IgG to immobilized gp140 trimers. Binding of germline heavy chain IgGs was analyzed with substitutions in the four signature heavy chain residues (W50S, N58S, R71T, and W102S) (again paired with the mature 3BNC60 light chain). The W50S, R71T, and W102S mutants showed little or no gp140 binding, and the N58S mutation diminished binding by about 20-fold, consistent with the corresponding PVL characteristic residues playing key roles in recognition of the HIV-1 envelope spike by the germline PVL B cell receptor.
(122) To examine the importance of the signature PVL residues to their activity, the gp120 sequences of HIV-1 strains resistant to neutralization by NIH45-46 were analyzed. The gp120 residue variants associated with resistance were identified by three criteria: first, they are contact residues with NIH45-46; second, they are absent in NIH45-46-resistant viruses; third, they do not appear in NIH45-46-sensitive viruses. The critical positions identified were 279.sub.gp120, 280.sub.gp120, 456.sub.gp120, 458.sub.gp120, and 459.sub.gp120; the common (i.e., sensitive) residues at these positions are Asx, Asn, Arg, Gly, and Gly, respectively, where Asx is Asp or Asn. These sites make significant contacts with the characteristic PVL residues (
(123) To verify the significance of gp120 variations at these positions, point mutants within the gp160 gene of HIV-1 strain YU2 were engineered, created pseudoviruses carrying the mutant gp160s, and determined the neutralization potencies of the PVL NIH45-46.sup.G54W (Diskin et al., 2011, supra) (as characterized by IC.sub.50 values). Mutations at 279.sub.gp120 and 280.sub.gp120 rendered the virus resistant to neutralization by NIH45-46.sup.G54W and substitution of 458.sub.gp120 diminished the neutralization potency by >1500-fold (
(124) As disclosed throughout and evidenced by, for example, the neutralization assays of
(125) While the present invention has been illustrated and described with reference to certain exemplary embodiments, those of ordinary skill in the art will understand that various modifications and changes may be made to the described embodiments without departing from the spirit and scope of the present invention, as defined in the following claims.