Signal peptide fusion partners facilitating listerial expression of antigenic sequences and methods of preparation and use thereof

09663557 ยท 2017-05-30

Assignee

Inventors

Cpc classification

International classification

Abstract

The present invention provides nucleic acids, expression systems, and vaccine strains which provide efficient expression and secretion of antigens of interest into the cytosol of host cells, and elicit effective CD4 and CD8 T cell responses by functionally linking Listerial or other bacterial signal peptides/secretion chaperones as N-terminal fusion partners in translational reading frame with selected recombinant encoded protein antigens. These N-terminal fusion partners are deleted (either by actual deletion, by mutation, or by a combination of these approaches) for any PEST sequences native to the sequence, and/or for certain hydrophobic residues.

Claims

1. A polynucleotide comprising: (a) a promoter; and (b) a nucleic acid operably linked to the promoter, wherein the nucleic acid encodes a fusion protein comprising: a polypeptide derived by recombinant modification of a Listerial ActA protein sequence, the Listerial ActA protein sequence in its unmodified form comprising a signal sequence and one or more PEST motifs, the modification comprising removal of each of the PEST motifs by deletion or substitution by one or more residues such that the polypeptide lacks any PEST motif; and a non-Listerial antigen.

2. The polynucleotide of claim 1, wherein the modification comprises truncation of the unmodified Listerial ActA protein sequence at about residue 100 and the removal of each of the PEST motifs from the truncated Listerial ActA protein sequence by deletion or substitution by one or more residues such that the polypeptide lacks any PEST motif.

3. The polynucleotide of claim 1, wherein the polypeptide retains the signal sequence of the Listerial ActA protein sequence in unmodified form.

4. The polynucleotide of claim 1, wherein the modification further comprises: removal of one or more hydrophobic domains which are not part of the signal sequence of the Listerial ActA protein sequence; and/or substitution of one or more residues within one or more hydrophobic domains which are not part of the signal sequence of the Listerial ActA protein sequence with amino acids which are not hydrophobic.

5. The polynucleotide of claim 1, wherein at least 75% of the sequence KTEEQPSEVNTGP (SEQ ID NO: 1) is deleted from the Listerial ActA protein sequence.

6. The polynucleotide of claim 1, wherein the sequence KTEEQPSEVNTGP (SEQ ID NO: 1) or KTEEQPSEVNTGPR (SEQ ID NO: 2) is deleted from the Listerial ActA protein sequence.

7. The polynucleotide of claim 1, wherein one or more P, E, S, and T residues in the sequence KTEEQPSEVNTGPR (SEQ ID NO: 2) in the Listerial ActA protein sequence is substituted with a residue other than P, E, S, and T.

8. The polynucleotide of claim 7, wherein each P, E, S, and T residue in the sequence KTEEQPSEVNTGPR (SEQ ID NO: 2) is substituted with K or R.

9. The polynucleotide of claim 1, wherein one or more hydrophobic residues within the sequence LIAML (SEQ ID NO: 8) in the Listerial ActA protein sequence are substituted with amino acids which are not hydrophobic.

10. The polynucleotide of claim 9, wherein the sequence LIAML (SEQ ID NO: 8) is replaced with the sequence QDNKR (SEQ ID NO: 9).

11. The polynucleotide of claim 1, wherein the polypeptide comprises SEQ ID NO: 30 or SEQ ID NO: 31.

12. The polynucleotide of claim 1, wherein the promoter is an actA or hly promoter.

13. The polynucleotide of claim 1, wherein the non-Listerial antigen is a cancer cell, tumor, or infectious agent antigen.

14. A plasmid comprising the polynucleotide of claim 1.

15. A Listeria bacterium comprising the polynucleotide of claim 1.

16. The Listeria bacterium of claim 15, which is Listeria monocytogenes.

17. The Listeria bacterium of claim 15, which is attenuated by a functional deletion of the bacterium's genomic actA gene.

18. The Listeria bacterium of claim 15, wherein the polynucleotide is inserted into the bacterium's genomic actA or inlB gene.

19. A vaccine comprising the Listeria bacterium of claim 15 and a pharmacologically acceptable excipient.

20. A method of producing a Listeria bacterium for use in a vaccine, comprising: integrating a polynucleotide of claim 1 into the genome of the Listeria bacterium.

21. The method of claim 20, wherein the polynucleotide of claim 1 is inserted into the bacterium's genomic actA or inlB gene.

Description

BRIEF DESCRIPTION OF THE FIGURES

(1) FIG. 1 depicts certain functional attributes of ActA in schematic form.

(2) FIG. 2 depicts various modifications to the sequences of ActA (SEQ ID NOS 29-36, respectively, in order of appearance) and LLO (SEQ ID NOS 37-44, respectively, in order of appearance). QDNKR is disclosed as SEQ ID NO: 9.

(3) FIG. 3 depicts the location of a PEST motif (SEQ ID NO: 6) in the LLO sequence, scored using the epestfind algorithm.

(4) FIG. 4 depicts four PEST motifs (SEQ ID NOS 2-5) in the ActA sequence, scored using the epestfind algorithm. Mutant 40 sequences are disclosed as SEQ ID NOS 45-46, respectively, in order of appearance.

(5) FIG. 5 depicts the results of a B3Z T-cell activation assay following immunization with Listeria monocytogenes expressing fusion constructs having various modified ActA and LLO fusion partners. QDNKR is disclosed as SEQ ID NO: 9.

(6) FIG. 6 depicts responses from certain LLO441 (A) and ActAN100 (B) vaccine strains.

(7) FIG. 7 depicts several substitutions and deletions for use in deleting the PEST motif, using ActA as a model system (SEQ ID NOS 47-51, respectively, in order of appearance).

(8) FIG. 8. depicts the result of modifying the hydrophobic motif LIAML (SEQ ID NO: 8) on the a hydropathy plot of ActAN100. QDNKR is disclosed as SEQ ID NO: 9.

(9) FIG. 9 depicts percent survival of animals immunized with Listeria monocytogenes expressing fusion constructs having a modified ActAN100 sequence fused to human mesothelin residues 35-621 following a challenge with CT-26 tumor cells.

(10) FIG. 10 depicts EGFRvIII.sub.20-40/NY-ESO-1.sub.1-165 fusion constructs of the present invention depicted schematically, and expression of the fusion constructs by western blot.

(11) FIG. 11 depicts EGFR-specific T cell responses determined by intracellular cytokine staining, as (A) percent IFN- positive EGFRvIII-specific CD8+ T cells; and (B) absolute number of IFN- positive EGFRvIII-specific CD8+ T cells per spleen, following immunization with Listeria monocytogenes expressing fusion constructs having a modified ActAN100 sequence fused to EGFRvIII.sub.20-40/NY-ESO-1.sub.1-165.

(12) FIG. 12 depicts NY-ESO-1-specific CD8+ T cell responses following immunization with Listeria monocytogenes expressing fusion constructs having a modified ActAN100 sequence fused to EGFRvIII.sub.20-40/NY-ESO-1.sub.1-165.

DETAILED DESCRIPTION OF THE INVENTION

(13) The present invention relates to compositions and methods for preparing antigenic fusion proteins for expression in Listerial bacteria. The present invention can provide attenuated bacterial vaccine strains with advantageous safety profiles for use treatment or prevention of diseases having a risk-benefit profile not appropriate for live attenuated vaccines. While described hereinafter in detail with regard to Listeria monocytogenes, the skilled artisan will understand that the methods and compositions described herein are generally applicable to Listerial species.

(14) Listeria monocytogenes (Lm) is a facultative intracellular bacterium characterized by its ability to induce a profound innate immune response that leads to robust and highly functional CD4 and CD8 T cell immunity specific for vaccine-encoded Ags. Lm is a food-borne bacterium with increased pathogenicity among immune compromised individuals, including patients with cancer or other viral-induced immune deficiencies, pregnant women, the elderly and infants. To prime a desired CD8 T cell response, Lm-based vaccines must retain the ability to escape from the vacuole of infected dendritic cells (DCs) in a process mediated by expression of a pore-forming cytolysin known as listeriolysin O (LLO), and desired antigens are engineered to be expressed and secreted from bacteria in the cytoplasm, where they are subsequently processed and presented on MHC class I molecules.

(15) There is a certain dichotomy apparent in the development of Lm vaccine strains between antigen expression levels and the requirement for antigen processing. While the immunologic potency of Lm-based vaccines is related directly to the level of antigen expression and secretion in the host cell, efficient MHC class I and class II priming and induction of antigen-specific immune responses has been suggested to depend upon rapid turnover of the antigen by proteolytic machinery of the cell.

(16) Antigen expression cassettes are provided herein which result in efficient expression and secretion of encoded antigens into the cytosol of host cells, and elicit effective CD4 and CD8 T cell responses by functionally linking Listerial or other bacterial signal peptides/secretion chaperones as N-terminal fusion partners in translational reading frame with selected recombinant encoded protein antigens. These bacterial N-terminal signal peptide/secretion chaperone fusion partners direct the secretion of the synthesized fusion protein from the recombinant bacterium in the infected host mammalian cells. As described hereinafter, these N-terminal fusion partners are deleted (either by actual deletion, by mutation, or by a combination of these approaches) for any PEST sequences native to the sequence. Optionally, hydrophobic residues in these N-terminal fusion partners which are not part of the signal sequence are also deleted (again, either by actual deletion, by mutation, or by a combination of these approaches). The resulting fusion proteins are expressed at high levels and generate a robust immunologic response to the antigen(s) of interest which are contained in the fusion protein.

(17) In a preferred embodiment, the said fusion protein is functionally linked to an Lm PrfA-inducible promoter. Preferred non-limiting examples are the hly promoter, which drives the expression of the listeriolysin O (LLO) protein, and the actA promoter, which drives the expression of the ActA protein, respectively, in wild-type Listeria monocytogenes. PrfA-dependent promoters are induced within infected mammalian host cells and functionally linked proteins are synthesized at high levels. The temporally regulated high-level expression of encoded fusion proteins comprising selected antigens functionally linked to PrfA-dependent promoters in the host cells facilitates antigen processing and presentation, resulting in an optimal Lm vaccine-induced immune response.

(18) As described hereinafter, preferred non-limiting examples of N-terminal signal peptide/secretion chaperone fusion partners are modified LLO or ActA proteins, derived from Listeria monocytogenes. The LLO and ActA N-terminal signal peptide/secretion chaperone fusion partners can be functionally linked to a Listerial PrfA-dependent promoter (e.g., the hly promoter or the actA promoter). In a preferred embodiment, ActA and LLO N-terminal signal peptide/secretion chaperone fusion partners which lack any PEST-like sequence motifs for fusion in frame with any selected antigen sequences are provided. Such PEST-minus N-terminal fusion partners are referred to herein as PEST minus (PEST) ActA and PEST LLO.

(19) FIG. 1 depicts in schematic form certain functional attributes of ActA. Underlined regions depict the location of PEST sequences in the native ActA sequence. In certain embodiments, the N-terminal signal peptide/secretion chaperone is derived from ActA in that it comprises the signal sequence of ActA and is truncated at about residue 389 amino acids of ActA in order to delete the C-terminal domain which comprises a transmembrane region. The term about as used herein in this context refers to +/25 amino acid residues.

(20) The term derived as used herein with regard to modification of secreted Listerial proteins to provide signal peptides/secretion chaperones for use of N-terminal fusion partners, refers to removal of PEST sequences native to the Listerial protein, and also optionally truncation relative to the native length and/or modification of one or more hydrophobic motifs outside the signal sequence. By way of example, ActA may be truncated to delete the C-terminal membrane-binding domain, and in certain embodiments even further, to decrease the number of non-antigenic residues in the fusion protein. In addition, one or more hydrophobic residues in these N-terminal fusion partners which are not part of the signal sequence and which form a hydrophobic motif in the polypeptide sequence are also deleted (again, either by actual deletion, by mutation, or by a combination of these approaches). As described hereinafter, the resulting fusion proteins are expressed at high levels and generate a robust immunologic response to the antigen(s) of interest which are contained in the fusion protein.

(21) Similarly, native LLO contains 529 residues and comprises a 25 residue signal sequence followed by four structural domains. Domain 4 is roughly from residues 415-529 and contains a cholesterol binding region. Domain 1 contains a single PEST sequence. In certain embodiments, the N-terminal signal peptide/secretion chaperone is derived from LLO in that it comprises the signal sequence of LLO and is truncated prior to about residue 484 in order to abrogate cholesterol binding. The term derived as used herein in this context refers to being modified, relative to the native LLO sequence, in terms of length, the existence of PEST sequences, and the existence of hydrophobic motifs outside the signal sequence. Preferably, the modified ActA is truncated at about residue 441.

(22) As demonstrated hereinafter, the PEST sequences and hydrophobic domains may be functionally deleted, either by their removal, or by noon-conservative substitution of residues, or by a combination of these approaches. By way of example only, the following examples demonstrate the replacement of a LIAML (SEQ ID NO: 8) hydrophobic motif in ActA with the sequence QDNKR (SEQ ID NO: 9); and the actual deletion of all or a portion of the ActA PEST sequence.

(23) It is to be understood that the invention is not limited in its application to the details of construction and to the arrangements of the components set forth in the following description or illustrated in the drawings. The invention is capable of embodiments in addition to those described and of being practiced and carried out in various ways. Also, it is to be understood that the phraseology and terminology employed herein, as well as the abstract, are for the purpose of description and should not be regarded as limiting.

(24) As such, those skilled in the art will appreciate that the conception upon which this disclosure is based may readily be utilized as a basis for the designing of other structures, methods and systems for carrying out the several purposes of the present invention. It is important, therefore, that the claims be regarded as including such equivalent constructions insofar as they do not depart from the spirit and scope of the present invention.

1. DEFINITIONS

(25) Abbreviations used to indicate a mutation in a gene, or a mutation in a bacterium comprising the gene, are as follows. By way of example, the abbreviation L. monocytogenes actA means that part, or all, of the actA gene was deleted. The delta symbol () means deletion. An abbreviation including a superscripted minus sign (Listeria ActA.sup.) means that the actA gene was mutated, e.g., by way of a deletion, point mutation, or frameshift mutation, but not limited to these types of mutations.

(26) Administration as it applies to a human, mammal, mammalian subject, animal, veterinary subject, placebo subject, research subject, experimental subject, cell, tissue, organ, or biological fluid, refers without limitation to contact of an exogenous ligand, reagent, placebo, small molecule, pharmaceutical agent, therapeutic agent, diagnostic agent, or composition to the subject, cell, tissue, organ, or biological fluid, and the like. Administration can refer, e.g., to therapeutic, pharmacokinetic, diagnostic, research, placebo, and experimental methods. Treatment of a cell encompasses contact of a reagent to the cell, as well as contact of a reagent to a fluid, where the fluid is in contact with the cell. Administration also encompasses in vitro and ex vivo treatments, e.g., of a cell, by a reagent, diagnostic, binding composition, or by another cell.

(27) An agonist, as it relates to a ligand and receptor, comprises a molecule, combination of molecules, a complex, or a combination of reagents, that stimulates the receptor. For example, an agonist of granulocyte-macrophage colony stimulating factor (GM-CSF) can encompass GM-CSF, a mutein or derivative of GM-CSF, a peptide mimetic of GM-CSF, a small molecule that mimics the biological function of GM-CSF, or an antibody that stimulates GM-CSF receptor.

(28) An antagonist, as it relates to a ligand and receptor, comprises a molecule, combination of molecules, or a complex, that inhibits, counteracts, downregulates, and/or desensitizes the receptor. Antagonist encompasses any reagent that inhibits a constitutive activity of the receptor. A constitutive activity is one that is manifest in the absence of a ligand/receptor interaction. Antagonist also encompasses any reagent that inhibits or prevents a stimulated (or regulated) activity of a receptor. By way of example, an antagonist of GM-CSF receptor includes, without implying any limitation, an antibody that binds to the ligand (GM-CSF) and prevents it from binding to the receptor, or an antibody that binds to the receptor and prevents the ligand from binding to the receptor, or where the antibody locks the receptor in an inactive conformation.

(29) As used herein, an analog or derivative with reference to a peptide, polypeptide or protein refers to another peptide, polypeptide or protein that possesses a similar or identical function as the original peptide, polypeptide or protein, but does not necessarily comprise a similar or identical amino acid sequence or structure of the original peptide, polypeptide or protein. An analog preferably satisfies at least one of the following: (a) a proteinaceous agent having an amino acid sequence that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% or at least 99% identical to the original amino acid sequence (b) a proteinaceous agent encoded by a nucleotide sequence that hybridizes under stringent conditions to a nucleotide sequence encoding the original amino acid sequence; and (c) a proteinaceous agent encoded by a nucleotide sequence that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% or at least 99% identical to the nucleotide sequence encoding the original amino acid sequence.

(30) Antigen presenting cells (APCs) are cells of the immune system used for presenting antigen to T cells. APCs include dendritic cells, monocytes, macrophages, marginal zone Kupffer cells, microglia, Langerhans cells, T cells, and B cells. Dendritic cells occur in at least two lineages. The first lineage encompasses pre-DC1, myeloid DC1, and mature DC1. The second lineage encompasses CD34.sup.+CD45RA.sup. early progenitor multipotent cells, CD34.sup.+CD45RA.sup.+ cells, CD34.sup.+CD45RA.sup.+CD4.sup.+ IL-3R.sup.+ pro-DC2 cells, CD4.sup.+CD11c.sup. plasmacytoid pre-DC2 cells, lymphoid human DC2 plasmacytoid-derived DC2s, and mature DC2s.

(31) Attenuation and attenuated encompasses a bacterium, virus, parasite, infectious organism, prion, tumor cell, gene in the infectious organism, and the like, that is modified to reduce toxicity to a host. The host can be a human or animal host, or an organ, tissue, or cell. The bacterium, to give a non-limiting example, can be attenuated to reduce binding to a host cell, to reduce spread from one host cell to another host cell, to reduce extracellular growth, or to reduce intracellular growth in a host cell. Attenuation can be assessed by measuring, e.g., an indicum or indicia of toxicity, the LD.sub.50, the rate of clearance from an organ, or the competitive index (see, e.g., Auerbuch, et al. (2001) Infect. Immunity 69:5953-5957). Generally, an attenuation results an increase in the LD.sub.50 and/or an increase in the rate of clearance by at least 25%; more generally by at least 50%; most generally by at least 100% (2-fold); normally by at least 5-fold; more normally by at least 10-fold; most normally by at least 50-fold; often by at least 100-fold; more often by at least 500-fold; and most often by at least 1000-fold; usually by at least 5000-fold; more usually by at least 10,000-fold; and most usually by at least 50,000-fold; and most often by at least 100,000-fold.

(32) Attenuated gene encompasses a gene that mediates toxicity, pathology, or virulence, to a host, growth within the host, or survival within the host, where the gene is mutated in a way that mitigates, reduces, or eliminates the toxicity, pathology, or virulence. The reduction or elimination can be assessed by comparing the virulence or toxicity mediated by the mutated gene with that mediated by the non-mutated (or parent) gene. Mutated gene encompasses deletions, point mutations, and frameshift mutations in regulatory regions of the gene, coding regions of the gene, non-coding regions of the gene, or any combination thereof.

(33) Conservatively modified variants applies to both amino acid and nucleic acid sequences. With respect to particular nucleic acid sequences, a conservatively modified variant refers to nucleic acids encoding identical amino acid sequences, or amino acid sequences that have one or more conservative substitutions. An example of a conservative substitution is the exchange of an amino acid in one of the following groups for another amino acid of the same group (U.S. Pat. No. 5,767,063 issued to Lee, et al.; Kyte and Doolittle (1982) J. Mol. Biol. 157:105-132). Conversely, a non-conservative substitution is the exchange of an amino acid in one of the following groups for another amino acid of a different group.

(34) (1) Hydrophobic: Norleucine, Ile, Val, Leu, Phe, Cys, Met;

(35) (2) Neutral hydrophilic: Cys, Ser, Thr;

(36) (3) Acidic: Asp, Glu;

(37) (4) Basic: Asn, Gln, His, Lys, Arg;

(38) (5) Residues that influence chain orientation: Gly, Pro;

(39) (6) Aromatic: Trp, Tyr, Phe; and

(40) (7) Small amino acids: Gly, Ala, Ser.

(41) Effective amount encompasses, without limitation, an amount that can ameliorate, reverse, mitigate, prevent, or diagnose a symptom or sign of a medical condition or disorder. Unless dictated otherwise, explicitly or by context, an effective amount is not limited to a minimal amount sufficient to ameliorate a condition.

(42) An extracellular fluid encompasses, e.g., serum, plasma, blood, interstitial fluid, cerebrospinal fluid, secreted fluids, lymph, bile, sweat, fecal matter, and urine. An extracelluar fluid can comprise a colloid or a suspension, e.g., whole blood or coagulated blood.

(43) The term fragments in the context of polypeptides include a peptide or polypeptide comprising an amino acid sequence of at least 5 contiguous amino acid residues, at least 10 contiguous amino acid residues, at least 15 contiguous amino acid residues, at least 20 contiguous amino acid residues, at least 25 contiguous amino acid residues, at least 40 contiguous amino acid residues, at least 50 contiguous amino acid residues, at least 60 contiguous amino residues, at least 70 contiguous amino acid residues, at least 80 contiguous amino acid residues, at least 90 contiguous amino acid residues, at least 100 contiguous amino acid residues, at least 125 contiguous amino acid residues, at least 150 contiguous amino acid residues, at least 175 contiguous amino acid residues, at least 200 contiguous amino acid residues, or at least 250 contiguous amino acid residues of the amino acid sequence of a larger polypeptide.

(44) Gene refers to a nucleic acid sequence encoding an oligopeptide or polypeptide. The oligopeptide or polypeptide can be biologically active, antigenically active, biologically inactive, or antigenically inactive, and the like. The term gene encompasses, e.g., the sum of the open reading frames (ORFs) encoding a specific oligopeptide or polypeptide; the sum of the ORFs plus the nucleic acids encoding introns; the sum of the ORFs and the operably linked promoter(s); the sum of the ORFS and the operably linked promoter(s) and any introns; the sum of the ORFS and the operably linked promoter(s), intron(s), and promoter(s), and other regulatory elements, such as enhancer(s). In certain embodiments, gene encompasses any sequences required in cis for regulating expression of the gene. The term gene can also refer to a nucleic acid that encodes a peptide encompassing an antigen or an antigenically active fragment of a peptide, oligopeptide, polypeptide, or protein. The term gene does not necessarily imply that the encoded peptide or protein has any biological activity, or even that the peptide or protein is antigenically active. A nucleic acid sequence encoding a non-expressable sequence is generally considered a pseudogene. The term gene also encompasses nucleic acid sequences encoding a ribonucleic acid such as rRNA, tRNA, or a ribozyme.

(45) Growth of a bacterium such as Listeria encompasses, without limitation, functions of bacterial physiology and genes relating to colonization, replication, increase in protein content, and/or increase in lipid content. Unless specified otherwise explicitly or by context, growth of a Listeria encompasses growth of the bacterium outside a host cell, and also growth inside a host cell. Growth related genes include, without implying any limitation, those that mediate energy production (e.g., glycolysis, Krebs cycle, cytochromes), anabolism and/or catabolism of amino acids, sugars, lipids, minerals, purines, and pyrimidines, nutrient transport, transcription, translation, and/or replication. In some embodiments, growth of a Listeria bacterium refers to intracellular growth of the Listeria bacterium, that is, growth inside a host cell such as a mammalian cell. While intracellular growth of a Listeria bacterium can be measured by light microscopy or colony forming unit (CFU) assays, growth is not to be limited by any technique of measurement. Biochemical parameters such as the quantity of a Listerial antigen, Listerial nucleic acid sequence, or lipid specific to the Listeria bacterium, can be used to assess growth. In some embodiments, a gene that mediates growth is one that specifically mediates intracellular growth. In some embodiments, a gene that specifically mediates intracellular growth encompasses, but is not limited to, a gene where inactivation of the gene reduces the rate of intracellular growth but does not detectably, substantially, or appreciably, reduce the rate of extracellular growth (e.g., growth in broth), or a gene where inactivation of the gene reduces the rate of intracellular growth to a greater extent than it reduces the rate of extracellular growth. To provide a non-limiting example, in some embodiments, a gene where inactivation reduces the rate of intracellular growth to a greater extent than extracellular growth encompasses the situation where inactivation reduces intracellular growth to less than 50% the normal or maximal value, but reduces extracellular growth to only 1-5%, 5-10%, or 10-15% the maximal value. The invention, in certain aspects, encompasses a Listeria attenuated in intracellular growth but not attenuated in extracellular growth, a Listeria not attenuated in intracellular growth and not attenuated in extracellular growth, as well as a Listeria not attenuated in intracellular growth but attenuated in extracellular growth.

(46) A composition that is labeled is detectable, either directly or indirectly, by spectroscopic, photochemical, biochemical, immunochemical, isotopic, or chemical methods. For example, useful labels include .sup.32P, .sup.33P, .sup.35S, .sup.14C, .sup.3H, .sup.125I, stable isotopes, epitope tags, fluorescent dyes, electron-dense reagents, substrates, or enzymes, e.g., as used in enzyme-linked immunoassays, or fluorettes (see, e.g., Rozinov and Nolan (1998) Chem. Biol. 5:713-728).

(47) Hydrophobic motif as used herein refers to a set of contuinguous amino acid residues which, in the context of the entire protein of which they are a part, exhibit a hydrophobic character by hydropathy analysis. A hydropathy analysis refers to the analysis of a polypeptide sequence by the method of Kyte and Doolittle: A Simple Method for Displaying the Hydropathic Character of a Protein. J. Mol. Biol. 157 (1982)105-132. In this method, each amino acid is given a hydrophobicity score between 4.6 and 4.6. A score of 4.6 is the most hydrophobic and a score of 4.6 is the most hydrophilic. Then a window size is set. A window size is the number of amino acids whose hydrophobicity scores will be averaged and assigned to the first amino acid in the window. The calculation starts with the first window of amino acids and calculates the average of all the hydrophobicity scores in that window. Then the window moves down one amino acid and calculates the average of all the hydrophobicity scores in the second window. This pattern continues to the end of the protein, computing the average score for each window and assigning it to the first amino acid in the window. The averages are then plotted on a graph. The y axis represents the hydrophobicity scores and the x axis represents the window number. The following hydrophobicity scores are used for the 20 common amino acids.

(48) TABLE-US-00001 Arg: 4.5 Ser: 0.8 Lys: 3.9 Thr: 0.7 Asn: 3.5 Gly: 0.4 Asp: 3.5 Ala: 1.8 Gln: 3.5 Met: 1.9 Glu: 3.5 Cys: 2.5 His: 3.2 Phe: 2.8 Pro: 1.6 Leu: 3.8 Tyr: 1.3 Val: 4.2 Trp: 0.9 Ile: 4.5

(49) Ligand refers to a small molecule, peptide, polypeptide, or membrane associated or membrane-bound molecule which is an agonist or antagonist of a receptor. Ligand also encompasses a binding agent that is not an agonist or antagonist, and has no agonist or antagonist properties. By convention, where a ligand is membrane-bound on a first cell, the receptor usually occurs on a second cell. The second cell may have the same identity (the same name), or it may have a different identity (a different name), as the first cell. A ligand or receptor may be entirely intracellular, that is, it may reside in the cytosol, nucleus, or in some other intracellular compartment. The ligand or receptor may change its location, e.g., from an intracellular compartment to the outer face of the plasma membrane. The complex of a ligand and receptor is termed a ligand receptor complex. Where a ligand and receptor are involved in a signaling pathway, the ligand occurs at an upstream position and the receptor occurs at a downstream position of the signaling pathway.

(50) Nucleic acid refers to deoxyribonucleotides or ribonucleotides and polymers thereof in either single stranded, double-stranded form, or multi-stranded form. Non-limiting examples of a nucleic acid are a, e.g., cDNA, mRNA, oligonucleotide, and polynucleotide. A particular nucleic acid sequence can also implicitly encompasses allelic variants and splice variants.

(51) Operably linked in the context of a promoter and a nucleic acid encoding a mRNA means that the promoter can be used to initiate transcription of that nucleic acid.

(52) The terms percent sequence identity and % sequence identity refer to the percentage of sequence similarity found by a comparison or alignment of two or more amino acid or nucleic acid sequences. Percent identity can be determined by a direct comparison of the sequence information between two molecules by aligning the sequences, counting the exact number of matches between the two aligned sequences, dividing by the length of the shorter sequence, and multiplying the result by 100. An algorithm for calculating percent identity is the Smith-Waterman homology search algorithm (see, e.g., Kann and Goldstein (2002) Proteins 48:367-376; Arslan, et al. (2001) Bioinformatics 17:327-337).

(53) By purified and isolated is meant, when referring to a polypeptide, that the polypeptide is present in the substantial absence of the other biological macromolecules with which it is associated in nature. The term purified as used herein means that an identified polypeptide often accounts for at least 50%, more often accounts for at least 60%, typically accounts for at least 70%, more typically accounts for at least 75%, most typically accounts for at least 80%, usually accounts for at least 85%, more usually accounts for at least 90%, most usually accounts for at least 95%, and conventionally accounts for at least 98% by weight, or greater, of the polypeptides present. The weights of water, buffers, salts, detergents, reductants, protease inhibitors, stabilizers (including an added protein such as albumin), and excipients, and molecules having a molecular weight of less than 1000, are generally not used in the determination of polypeptide purity. See, e.g., discussion of purity in U.S. Pat. No. 6,090,611 issued to Covacci, et al.

(54) Peptide refers to a short sequence of amino acids, where the amino acids are connected to each other by peptide bonds. A peptide may occur free or bound to another moiety, such as a macromolecule, lipid, oligo- or polysaccharide, and/or a polypeptide. Where a peptide is incorporated into a polypeptide chain, the term peptide may still be used to refer specifically to the short sequence of amino acids. A peptide may be connected to another moiety by way of a peptide bond or some other type of linkage. A peptide is at least two amino acids in length and generally less than about 25 amino acids in length, where the maximal length is a function of custom or context. The terms peptide and oligopeptide may be used interchangeably.

(55) PEST motifs are defined herein as hydrophilic stretches of at least 12 amino acids length with a high local concentration of P, E, S and T amino acids, and which score as a valid PEST motif according to the epestfind algorithm. Negatively charged amino acids are clustered within these motifs while positively charged amino acids, arginine (R), histidine (H) and lysine (K) are generally forbidden. The epestfind algorithm defines the last criterion even more stringently in that PEST motifs are required to be flanked by positively charged amino acids. All amino acids between the positively charged flanks are counted and only those motifs are considered further, which contain a number of amino acids equal to or higher than the window-size parameter. Additionally, all valid PEST regions are required to contain at least one proline (P), one aspartate (D) or glutamate (E) and at least one serine (S) or threonine (T). Sequences that do not meet the above criteria are classified as invalid PEST motifs.

(56) Valid PEST motifs are refined by means of a scoring parameter based on the local enrichment of critical amino acids as well as the motifs hydrophobicity. Enrichment of D, E, P, S and T is expressed in mass percent (w/w) and corrected for one equivalent of D or E, one of P and one of S or T. Calculation of hydrophobicity follows in principle the method of J. Kyte and R. F. Doolittle. For simplified calculations, Kyte-Doolittle hydropathy indices, which originally ranged from 4.5 for arginine to +4.5 for isoleucine, were converted to positive integers. This was achieved by the following linear transformation, which yielded values from 0 for arginine to 90 for isoleucine.
Hydropathy index=10*Kyte-Doolittle hydropathy index+45

(57) The motifs hydrophobicity is calculated as the sum over the products of mole percent and hydrophobicity index for each amino acid species. The desired PEST score is obtained as combination of local enrichment term and hydrophobicity term as expressed by the following equation:
PEST score=0.55*DEPST0.5*hydrophobicity index.

(58) In addition, the epestfind algorithm includes a correction for the hydropathy index of tyrosine, introduced by Robert H. Stellwagen from the University of Southern California. However, PEST scores can range from 45 for poly-isoleucine to about +50 for poly-aspartate plus one proline and one serine. Valid PEST motifs are those above the threshold score of 5.0 and are considered of real biological interest.

(59) Protein generally refers to the sequence of amino acids comprising a polypeptide chain. Protein may also refer to a three dimensional structure of the polypeptide. Denatured protein refers to a partially denatured polypeptide, having some residual three dimensional structure or, alternatively, to an essentially random three dimensional structure, i.e., totally denatured. The invention encompasses reagents of, and methods using, polypeptide variants, e.g., involving glycosylation, phosphorylation, sulfation, disulfide bond formation, deamidation, isomerization, cleavage points in signal or leader sequence processing, covalent and non-covalently bound cofactors, oxidized variants, and the like. The formation of disulfide linked proteins is described (see, e.g., Woycechowsky and Raines (2000) Curr. Opin. Chem. Biol. 4:533-539; Creighton, et al. (1995) Trends Biotechnol. 13:18-23).

(60) Recombinant when used with reference, e.g., to a nucleic acid, cell, animal, virus, plasmid, vector, or the like, indicates modification by the introduction of an exogenous, non-native nucleic acid, alteration of a native nucleic acid, or by derivation in whole or in part from a recombinant nucleic acid, cell, virus, plasmid, or vector. Recombinant protein refers to a protein derived, e.g., from a recombinant nucleic acid, virus, plasmid, vector, or the like. Recombinant bacterium encompasses a bacterium where the genome is engineered by recombinant methods, e.g., by way of a mutation, deletion, insertion, and/or a rearrangement. Recombinant bacterium also encompasses a bacterium modified to include a recombinant extra-genomic nucleic acid, e.g., a plasmid or a second chromosome, or a bacterium where an existing extra-genomic nucleic acid is altered.

(61) Sample refers to a sample from a human, animal, placebo, or research sample, e.g., a cell, tissue, organ, fluid, gas, aerosol, slurry, colloid, or coagulated material. The sample may be tested in vivo, e.g., without removal from the human or animal, or it may be tested in vitro. The sample may be tested after processing, e.g., by histological methods. Sample also refers, e.g., to a cell comprising a fluid or tissue sample or a cell separated from a fluid or tissue sample. Sample may also refer to a cell, tissue, organ, or fluid that is freshly taken from a human or animal, or to a cell, tissue, organ, or fluid that is processed or stored.

(62) A selectable marker encompasses a nucleic acid that allows one to select for or against a cell that contains the selectable marker. Examples of selectable markers include, without limitation, e.g.: (1) A nucleic acid encoding a product providing resistance to an otherwise toxic compound (e.g., an antibiotic), or encoding susceptibility to an otherwise harmless compound (e.g., sucrose); (2) A nucleic acid encoding a product that is otherwise lacking in the recipient cell (e.g., tRNA genes, auxotrophic markers); (3) A nucleic acid encoding a product that suppresses an activity of a gene product; (4) A nucleic acid that encodes a product that can be readily identified (e.g., phenotypic markers such as beta-galactosidase, green fluorescent protein (GFP), cell surface proteins, an epitope tag, a FLAG tag); (5) A nucleic acid that can be identified by hybridization techniques, for example, PCR or molecular beacons.

(63) Specifically or selectively binds, when referring to a ligand/receptor, nucleic acid/complementary nucleic acid, antibody/antigen, or other binding pair (e.g., a cytokine to a cytokine receptor) indicates a binding reaction which is determinative of the presence of the protein in a heterogeneous population of proteins and other biologics. Thus, under designated conditions, a specified ligand binds to a particular receptor and does not bind in a significant amount to other proteins present in the sample. Specific binding can also mean, e.g., that the binding compound, nucleic acid ligand, antibody, or binding composition derived from the antigen-binding site of an antibody, of the contemplated method binds to its target with an affinity that is often at least 25% greater, more often at least 50% greater, most often at least 100% (2-fold) greater, normally at least ten times greater, more normally at least 20-times greater, and most normally at least 100-times greater than the affinity with any other binding compound.

(64) In a typical embodiment an antibody will have an affinity that is greater than about 10.sup.9 liters/mol, as determined, e.g., by Scatchard analysis (Munsen, et al. (1980) Analyt. Biochem. 107:220-239). It is recognized by the skilled artisan that some binding compounds can specifically bind to more than one target, e.g., an antibody specifically binds to its antigen, to lectins by way of the antibody's oligosaccharide, and/or to an Fc receptor by way of the antibody's Fc region.

(65) Spread of a bacterium encompasses cell to cell spread, that is, transmission of the bacterium from a first host cell to a second host cell, as mediated, for example, by a vesicle. Functions relating to spread include, but are not limited to, e.g., formation of an actin tail, formation of a pseudopod-like extension, and formation of a double-membraned vacuole.

(66) The term subject as used herein refers to a human or non-human organism. Thus, the methods and compositions described herein are applicable to both human and veterinary disease. In certain embodiments, subjects are patients, i.e., living humans that are receiving medical care for a disease or condition. This includes persons with no defined illness who are being investigated for signs of pathology.

(67) The target site of a recombinase is the nucleic acid sequence or region that is recognized, bound, and/or acted upon by the recombinase (see, e.g., U.S. Pat. No. 6,379,943 issued to Graham, et al.; Smith and Thorpe (2002) Mol. Microbiol. 44:299-307; Groth and Calos (2004) J. Mol. Biol. 335:667-678; Nunes-Duby, et al. (1998) Nucleic Acids Res. 26:391-406).

(68) Therapeutically effective amount is defined as an amount of a reagent or pharmaceutical composition that is sufficient to induce a desired immune response specific for encoded heterologous antigens, show a patient benefit, i.e., to cause a decrease, prevention, or amelioration of the symptoms of the condition being treated. When the agent or pharmaceutical composition comprises a diagnostic agent, a diagnostically effective amount is defined as an amount that is sufficient to produce a signal, image, or other diagnostic parameter. Effective amounts of the pharmaceutical formulation will vary according to factors such as the degree of susceptibility of the individual, the age, gender, and weight of the individual, and idiosyncratic responses of the individual (see, e.g., U.S. Pat. No. 5,888,530 issued to Netti, et al.).

(69) Treatment or treating (with respect to a condition or a disease) is an approach for obtaining beneficial or desired results including and preferably clinical results. For purposes of this invention, beneficial or desired results with respect to a disease include, but are not limited to, one or more of the following: improving a condition associated with a disease, curing a disease, lessening severity of a disease, delaying progression of a disease, alleviating one or more symptoms associated with a disease, increasing the quality of life of one suffering from a disease, and/or prolonging survival. Likewise, for purposes of this invention, beneficial or desired results with respect to a condition include, but are not limited to, one or more of the following: improving a condition, curing a condition, lessening severity of a condition, delaying progression of a condition, alleviating one or more symptoms associated with a condition, increasing the quality of life of one suffering from a condition, and/or prolonging survival.

(70) Vaccine encompasses preventative vaccines. Vaccine also encompasses therapeutic vaccines, e.g., a vaccine administered to a mammal that comprises a condition or disorder associated with the antigen or epitope provided by the vaccine. A number of bacterial species have been developed for use as vaccines and can be used in the present invention, including, but not limited to, Shigella flexneri, Escherichia coli, Listeria monocytogenes, Yersinia enterocolitica, Salmonella typhimurium, Salmonella typhi or mycobacterium species. This list is not meant to be limiting. See, e.g., WO04/006837; WO07/103,225; and WO07/117,371, each of which is hereby incorporated by reference in its entirety, including all tables, figures, and claims. The bacterial vector used in the vaccine composition may be a facultative, intracellular bacterial vector. The bacterium may be used to deliver a polypeptide described herein to antigen-presenting cells in the host organism. As described herein, L. monocytogenes provides a preferred vaccine platform for expression of the antigens of the present invention.

(71) Antigenic Constructs

(72) Target Antigens

(73) A preferred feature of the fusion proteins described herein is the ability to initiate both the innate immune response as well as an antigen-specific T cell response against the antigen(s) when recombinantly expressed in a host by a L. monocytogenes vaccine platform. For example, L. monocytogenes expressing the antigen(s) as described herein can induce Type 1 interferon (IFN-/) and a cascade of co-regulated chemokine and cytokine protein which shape the nature of the vaccine-induce immune response. In response to this immune stimulation, NK cells and antigen presenting cells (APCs) are recruited to the liver following intravenous vaccination routes, or, alternatively to the vaccination site following other routes of vaccination, for example, by intramuscular, subcutaneous, or intradermal immunization routes. In certain embodiments, the vaccine platform of the present invention induces an increase at 24 hours following delivery of the vaccine platform to the subject in the serum concentration of one or more, and preferably all, cytokines and chemokines selected from the group consisting of IL-12p70, IFN-, IL-6, TNF , and MCP-1; and induces a CD4+ and/or CD8+ antigen-specific T cell response against one or more antigens expressed by the vaccine platform. In other embodiments, the vaccine platform of the present invention also induces the maturation of resident immature liver NK cells as demonstrated by the upregulation of activation markers such as DX5, CD11b, and CD43 in a mouse model system, or by NK cell-mediated cytolytic activity measured using .sup.51Cr-labeled YAC-1 cells that were used as target cells.

(74) The ability of L. monocytogenes to serve as a vaccine vector has been reviewed in Wesikirch, et al., Immunol. Rev. 158:159-169 (1997). A number of desirable features of the natural biology of L. monocytogenes make it an attractive platform for application to a therapeutic vaccine. The central rationale is that the intracellular lifecycle of L. monocytogenes enables effective stimulation of CD4+ and CD8+ T cell immunity. Multiple pathogen associated molecular pattern (PAMP) receptors including TLRs (TLR2, TLR5, TLR9) nucleotide-binding oligomerization domains (NOD), and Stimulator of Interferon Genes (STING) are triggered in response to interaction with L. monocytogenes macromolecules upon infection, resulting in the pan-activation of innate immune effectors and release of Th-1 polarizing cytokines, exerting a profound impact on the development of a CD4+ and CD8+ T cell response against the expressed antigens.

(75) Strains of L. monocytogenes have recently been developed as effective intracellular delivery vehicles of heterologous proteins providing delivery of antigens to the immune system to induce an immune response to clinical conditions that do not permit injection of the disease-causing agent, such as cancer and HIV. See, e.g., U.S. Pat. No. 6,051,237; Gunn et al., J. Immunol., 167:6471-6479 (2001); Liau, et al., Cancer Research, 62: 2287-2293 (2002); U.S. Pat. No. 6,099,848; WO 99/25376; WO 96/14087; and U.S. Pat. No. 5,830,702), each of which is hereby incorporated by reference in its entirety, including all tables, figures, and claims. A recombinant L. monocytogenes vaccine expressing an lymphocytic choriomeningitis virus (LCMV) antigen has also been shown to induce protective cell-mediated immunity to the antigen (Shen et al., Proc. Natl. Acad. Sci. USA, 92: 3987-3991 (1995).

(76) In certain embodiments, the L. monocytogenes used in the vaccine compositions of the present invention comprises an attenuating mutation in actA and/or inlB, and preferably a deletion of all or a portion of actA and inlB (referred to herein as Lm actA/inlB), and contains recombinant DNA encoding for the expression of the one or more antigen(s) of interest. The antigen(s) are preferably under the control of bacterial expression sequences and are stably integrated into the L. monocytogenes genome.

(77) The invention also contemplates a Listeria attenuated in at least one regulatory factor, e.g., a promoter or a transcription factor. The following concerns promoters. ActA expression is regulated by two different promoters (Vazwuez-Boland, et al. (1992) Infect. Immun. 60:219-230). Together, InlA and InlB expression is regulated by five promoters (Lingnau, et al. (1995) Infect. Immun. 63:3896-3903). The transcription factor prfA is required for transcription of a number of L. monocytogenes genes, e.g., hly, plcA, ActA, mpl, prfA, and iap. PrfA's regulatory properties are mediated by, e.g., the PrfA-dependent promoter (PinlC) and the PrfA-box. The present invention, in certain embodiments, provides a nucleic acid encoding inactivated, mutated, or deleted in at least one of ActA promoter, inlB promoter, PrfA, PinlC, PrfA box, and the like (see, e.g., Lalic Mullthaler, et al. (2001) Mol. Microbiol. 42:111-120; Shetron-Rama, et al. (2003) Mol. Microbiol. 48:1537-1551; Luo, et al. (2004) Mol. Microbiol. 52:39-52). PrfA can be made constitutively active by a Gly145Ser mutation, Gly155Ser mutation, or Glu77Lys mutation (see, e.g., Mueller and Freitag (2005) Infect. Immun. 73:1917-1926; Wong and Freitag (2004) J. Bacteriol. 186:6265-6276; Ripio, et al. (1997) J. Bacteriol. 179:1533-1540).

(78) Examples of target antigens that may find use in the invention are listed in the following table. The target antigen may also be a fragment or fusion polypeptide comprising an immunologically active portion of the antigens listed in the table. This list is not meant to be limiting.

(79) TABLE-US-00002 TABLE 1 Antigens. Antigen Reference Tumor antigens Mesothelin GenBank Acc. No. NM_005823; U40434; NM_013404; BC003512 (see also, e.g., Hassan, et al. (2004) Clin. Cancer Res. 10: 3937-3942; Muminova, et al. (2004) BMC Cancer 4: 19; Iacobuzio-Donahue, et al. (2003) Cancer Res. 63: 8614-8622). Wilms' tumor-1 WT-1 isoform A (GenBank Acc. Nos. NM_000378; NP_000369). WT-1 associated protein (Wt-1), isoform B (GenBank Acc. Nos. NM_024424; NP_077742). WT-1 including isoform A; isoform C (GenBank Acc. Nos. NM_024425; NP_077743). WT-1 isoform B; isoform C; isoform D (GenBank Acc. Nos. NM_024426; NP_077744). isoform D. Stratum corneum GenBank Acc. No. NM_005046; NM_139277; AF332583. See also, e.g., chymotryptic enzyme Bondurant, et al. (2005) Clin. Cancer Res. 11: 3446-3454; Santin, et al. (SCCE), and variants (2004) Gynecol. Oncol. 94: 283-288; Shigemasa, et al. (2001) Int. J. thereof. Gynecol. Cancer 11: 454-461; Sepehr, et al. (2001) Oncogene 20: 7368-7374. MHC class I See, e.g., Groh, et al. (2005) Proc. Natl. Acad. Sci. USA 102: chain-related protein A 6461-6466; GenBank Acc. Nos. NM_000247; BC_016929; AY750850; (MICA); MHC class I NM_005931. chain-related protein A (MICB). Gastrin and peptides Harris, et al. (2004) Cancer Res. 64: 5624-5631; Gilliam, et al. derived from gastrin; (2004) Eur. J. Surg. Oncol. 30: 536-543; Laheru and Jaffee (2005) gastrin/CCK-2 receptor Nature Reviews Cancer 5: 459-467. (also known as CCK-B). Glypican-3 (an antigen GenBank Acc. No. NM_004484. Nakatsura, et al. (2003) Biochem. of, e.g., hepatocellular Biophys. Res. Commun. 306: 16-25; Capurro, et al. (2003) carcinoma and Gasteroenterol. 125: 89-97; Nakatsura, et al. (2004) Clin. Cancer melanoma). Res. 10: 6612-6621). Coactosin-like protein. Nakatsura, et al. (2002) Eur. J. Immunol. 32: 826-836; Laheru and Jaffee (2005) Nature Reviews Cancer 5: 459-467. Prostate stem cell antigen GenBank Acc. No. AF043498; AR026974; AR302232 (see also, e.g., (PSCA). Argani, et al. (2001) Cancer Res. 61: 4320-4324; Christiansen, et al. (2003) Prostate 55: 9-19; Fuessel, et al. (2003) 23: 221-228). Prostate acid phosphatase Small, et al. (2000) J. Clin. Oncol. 18: 3894-3903; Altwein and Luboldt (PAP); prostate-specific (1999) Urol. Int. 63: 62-71; Chan, et al. (1999) Prostate 41: 99-109; antigen (PSA); PSM; Ito, et al. (2005) Cancer 103: 242-250; Schmittgen, et al. (2003) Int. PSMA. J. Cancer 107: 323-329; Millon, et al. (1999) Eur. Urol. 36: 278-285. Six-transmembrane See, e.g., Machlenkin, et al. (2005) Cancer Res. 65: 6435-6442; epithelial antigen of GenBank Acc. No. NM_018234; NM_001008410; NM_182915; NM_024636; prostate (STEAP). NM_012449; BC011802. Prostate carcinoma tumor See, e.g., Machlenkin, et al. (2005) Cancer Res. 65: 6435-6442; antigen-1 (PCTA-1). GenBank Acc. No. L78132. Prostate tumor-inducing See, e.g., Machlenkin, et al. (2005) Cancer Res. 65: 6435-6442). gene-1 (PTI-1). Prostate-specific gene See, e.g., Machlenkin, et al. (2005) Cancer Res. 65: 6435-6442). with homology to G protein-coupled receptor. Prostase (an antrogen See, e.g., Machlenkin, et al. (2005) Cancer Res. 65: 6435-6442; regulated serine GenBank Acc. No. BC096178; BC096176; BC096175. protease). Proteinase 3. GenBank Acc. No. X55668. Cancer-testis antigens, GenBank Acc. No. NM_001327 (NY-ESO-1) (see also, e.g., Li, et al. e.g., NY-ESO-1; SCP-1; (2005) Clin. Cancer Res. 11: 1809-1814; Chen, et al. (2004) Proc. Natl. SSX-1; SSX-2; SSX-4; Acad. Sci. USA. 101(25): 9363-9368; Kubuschok, et al. (2004) Int. J. GAGE, CT7; CT8; CT10; Cancer. 109: 568-575; Scanlan, et al. (2004) Cancer Immun. 4: 1; Scanlan, MAGE-1; MAGE-2; et al. (2002) Cancer Res. 62: 4041-4047; Scanlan, et al. (2000) Cancer MAGE-3; MAGE-4; Lett. 150: 155-164; Dalerba, et al. (2001) Int. J. Cancer 93: 85-90; Ries, et MAGE-6; LAGE-1. al. (2005) Int. J. Oncol. 26: 817-824. MAGE-A1, MAGE-A2; Otte, et al. (2001) Cancer Res. 61: 6682-6687; Lee, et al. (2003) Proc. Natl. MAGE-A3; MAGE-A4; Acad. Sci. USA 100: 2651-2656; Sarcevic, et al. (2003) Oncology 64: 443- MAGE-A6; MAGE-A9; 449; Lin, et al. (2004) Clin. Cancer Res. 10: 5708-5716. MAGE-A10; MAGE-A12; GAGE-3/6; NT-SAR-35; BAGE; CA125. GAGE-1; GAGE-2; De Backer, et al. (1999) Cancer Res. 59: 3157-3165; Scarcella, et al. GAGE-3; GAGE-4; (1999) Clin. Cancer Res. 5: 335-341. GAGE-5; GAGE-6; GAGE-7; GAGE-8; GAGE-65; GAGE-11; GAGE-13; GAGE-7B. HIP1R; LMNA; Scanlan, et al. (2002) Cancer Res. 62: 4041-4047. KIAA1416; Seb4D; KNSL6; TRIP4; MBD2; HCAC5; MAGEA3. DAM family of genes, Fleishhauer, et al. (1998) Cancer Res. 58: 2969-2972. e.g., DAM-1; DAM-6. RCAS1. Enjoji, et al. (2004) Dig. Dis. Sci. 49: 1654-1656. RU2. Van Den Eynde, et al. (1999) J. Exp. Med. 190: 1793-1800. CAMEL. Slager, et al. (2004) J. Immunol. 172: 5095-5102; Slager, et al. (2004) Cancer Gene Ther. 11: 227-236. Colon cancer associated Scanlan, et al. (2002) Cancer Res. 62: 4041-4047. antigens, e.g., NY-CO-8; NY-CO-9; NY-CO-13; NY-CO-16; NY-CO-20; NY-CO-38; NY-CO-45; NY-CO-9/HDAC5; NY-CO-41/MBD2; NY-CO-42/TRIP4; NY-CO-95/KIAA1416; KNSL6; seb4D. N-Acetylglucosaminyl- Dosaka-Akita, et al. (2004) Clin. Cancer Res. 10: 1773-1779. tranferase V (GnT-V). Elongation factor 2 Renkvist, et al. (2001) Cancer Immunol Immunother. 50: 3-15. mutated (ELF2M). HOM-MEL-40/SSX2 Neumann, et al. (2004) Int. J. Cancer 112: 661-668; Scanlan, et al. (2000) Cancer Lett. 150: 155-164. BRDT. Scanlan, et al. (2000) Cancer Lett. 150: 155-164. SAGE; HAGE. Sasaki, et al. (2003) Eur. J. Surg. Oncol. 29: 900-903. RAGE. See, e.g., Li, et al. (2004) Am. J. Pathol. 164: 1389-1397; Shirasawa, et al. (2004) Genes to Cells 9: 165-174. MUM-1 (melanoma Gueguen, et al. (1998) J. Immunol. 160: 6188-6194; Hirose, et al. (2005) ubiquitous mutated); Int. J. Hematol. 81: 48-57; Baurain, et al. (2000) J. Immunol. 164: 6057- MUM-2; MUM-2 Arg- 6066; Chiari, et al. (1999) Cancer Res. 59: 5785-5792. Gly mutation; MUM-3. LDLR/FUT fusion Wang, et al. (1999) J. Exp. Med. 189: 1659-1667. protein antigen of melanoma. NY-REN series of renal Scanlan, et al. (2002) Cancer Res. 62: 4041-4047; cancer antigens. Scanlan, et al. (1999) Cancer Res. 83: 456-464. NY-BR series of breast Scanlan, et al. (2002) Cancer Res. 62: 4041-4047; cancer antigens, e.g., Scanlan, et al. (2001) Cancer Immunity 1: 4. NY-BR-62; NY-BR-75; NY-BR-85; NY-BR-62; NY-BR-85. BRCA-1; BRCA-2. Stolier, et al. (2004) Breast J. 10: 475-480; Nicoletto, et al. (2001) Cancer Treat Rev. 27: 295-304. DEK/CAN fusion Von Lindern, et al. (1992) Mol. Cell. Biol. 12: 1687-1697. protein. Ras, e.g., wild type ras, GenBank Acc. Nos. P01112; P01116; M54969; M54968; P01111; ras with mutations at P01112; K00654. See also, e.g., GenBank Acc. Nos. M26261; M34904; codon 12, 13, 59, or 61, K01519; K01520; BC006499; NM_006270; NM_002890; NM_004985; e.g., mutations G12C; NM_033360; NM_176795; NM_005343. G12D; G12R; G12S; G12V; G13D; A59T; Q61H. K-RAS; H-RAS; N-RAS. BRAF (an isoform of Tannapfel, et al. (2005) Am. J. Clin. Pathol. 123: 256-2601; RAF). Tsao and Sober (2005) Dermatol. Clin. 23: 323-333. Melanoma antigens, GenBank Acc. No. NM_206956; NM_206955; NM_206954; including HST-2 NM_206953; NM_006115; NM_005367; NM_004988; AY148486; melanoma cell antigens. U10340; U10339; M77481. See, eg., Suzuki, et al. (1999) J. Immunol. 163: 2783-2791. Survivin GenBank Acc. No. AB028869; U75285 (see also, e.g., Tsuruma, et al. (2004) J. Translational Med. 2: 19 (11 pages); Pisarev, et al. (2003) Clin. Cancer Res. 9: 6523-6533; Siegel, et al. (2003) Br. J. Haematol. 122: 911- 914; Andersen, et al. (2002) Histol. Histopathol. 17: 669-675). MDM-2 NM_002392; NM_006878 (see also, e.g., Mayo, et al. (1997) Cancer Res. 57: 5013-5016; Demidenko and Blagosklonny (2004) Cancer Res. 64: 3653-3660). Methyl-CpG-binding Muller, et al. (2003) Br. J. Cancer 89: 1934-1939; Fang, et al. proteins (MeCP2; (2004) World J. Gastreenterol. 10: 3394-3398. MBD2). NA88-A. Moreau-Aubry, et al. (2000) J. Exp. Med. 191: 1617-1624. Histone deacetylases Waltregny, et al. (2004) Eur. J. Histochem. 48: 273-290; (HDAC), e.g., HDAC5. Scanlan, et al. (2002) Cancer Res. 62: 4041-4047. Cyclophilin B (Cyp-B). Tamura, et al. (2001) Jpn. J. Cancer Res. 92: 762-767. CA 15-3; CA 27.29. Clinton, et al. (2003) Biomed. Sci. Instrum. 39: 408-414. Heat shock protein Faure, et al. (2004) Int. J. Cancer 108: 863-870. Hsp70. GAGE/PAGE family, Brinkmann, et al. (1999) Cancer Res. 59: 1445-1448. e.g., PAGE-1; PAGE-2; PAGE-3; PAGE-4; XAGE-1; XAGE-2; XAGE-3. MAGE-A, B, C, and D Lucas, et al. (2000) Int. J. Cancer 87: 55-60; families. MAGE-B5; Scanlan, et al. (2001) Cancer Immun. 1: 4. MAGE-B6; MAGE-C2; MAGE-C3; MAGE-3; MAGE-6. Kinesin 2; TATA element Scanlan, et al. (2001) Cancer Immun. 30: 1-4. modulatory factor 1; tumor protein D53; NY Alpha-fetoprotein (AFP) Grimm, et al. (2000) Gastroenterol. 119: 1104-1112. SART1; SART2; Kumamuru, et al. (2004) Int. J. Cancer 108: 686-695; Sasatomi, et al. SART3; ART4. (2002) Cancer 94: 1636-1641; Matsumoto, et al. (1998) Jpn. J. Cancer Res. 89: 1292-1295; Tanaka, et al. (2000) Jpn. J. Cancer Res. 91: 1177-1184. Preferentially expressed Matsushita, et al. (2003) Leuk. Lymphoma 44: 439-444; antigen of melanoma Oberthuer, et al. (2004) Clin. Cancer Res. 10: 4307-4313. (PRAME). Carcinoembryonic GenBank Acc. No. M29540; E03352; X98311; M17303 (see also, e.g., antigen (CEA), CAP1-6D Zaremba (1997) Cancer Res. 57: 4570-4577; Sarobe, et al. (2004) Curr. enhancer agonist peptide. Cancer Drug Targets 4: 443-454; Tsang, et al. (1997) Clin. Cancer Res. 3: 2439-2449; Fong, et al. (2001) Proc. Natl. Acad. Sci. USA 98: 8809- 8814). HER-2/neu. Disis, et al. (2004) J. Clin. Immunol. 24: 571-578; Disis and Cheever (1997) Adv. Cancer Res. 71: 343-371. Cdk4; cdk6; p16 (INK4); Ghazizadeh, et al. (2005) Respiration 72: 68-73; Rb protein. Ericson, et al. (2003) Mol. Cancer Res. 1: 654-664. TEL; AML1; Stams, et al. (2005) Clin. Cancer Res. 11: 2974-2980. TEL/AML1. Telomerase (TERT). Nair, et al. (2000) Nat. Med. 6: 1011-1017. 707-AP. Takahashi, et al. (1997) Clin. Cancer Res. 3: 1363-1370. Annexin, e.g., Zimmerman, et al. (2004) Virchows Arch. 445: 368-374. Annexin II. BCR/ABL; BCR/ABL Cobaldda, et al. (2000) Blood 95: 1007-1013; Hakansson, et al. (2004) p210; BCR/ABL p190; Leukemia 18: 538-547; Schwartz, et al. (2003) Semin. Hematol. 40: 87-96; CML-66; CML-28. Lim, et al. (1999) Int. J. Mol. Med. 4: 665-667. BCL2; BLC6; Iqbal, et al. (2004) Am. J. Pathol. 165: 159-166. CD10 protein. CDC27 (this is a Wang, et al. (1999) Science 284: 1351-1354. melanoma antigen). Sperm protein 17 (SP17); Arora, et al. (2005) Mol. Carcinog. 42: 97-108. 14-3-3-zeta; MEMD; KIAA0471; TC21. Tyrosinase-related GenBank Acc. No. NM_001922. (see also, e.g., Bronte, proteins 1 and 2 (TRP-1 et al. (2000) Cancer Res. 60: 253-258). and TRP-2). Gp100/pmel-17. GenBank Acc. Nos. AH003567; U31798; U31799; U31807; U31799 (see also, e.g., Bronte, et al. (2000) Cancer Res. 60: 253-258). TARP. See, e.g., Clifton, et al. (2004) Proc. Natl. Acad. Sci. USA 101: 10166- 10171; Virok, et al. (2005) Infection Immunity 73: 1939-1946. Tyrosinase-related GenBank Acc. No. NM_001922. (see also, e.g., Bronte, et al. (2000) proteins 1 and 2 (TRP-1 Cancer Res. 60: 253-258). and TRP-2). Melanocortin 1 receptor Salazar-Onfray, et al. (1997) Cancer Res. 57: 4348-4355; Reynolds, et al. (MC1R); MAGE-3; (1998) J. Immunol. 161: 6970-6976; Chang, et al. (2002) Clin. Cancer Res. gp100; tyrosinase; 8: 1021-1032. dopachrome tautomerase (TRP-2); MART-1. MUC-1; MUC-2. See, e.g., Davies, et al. (1994) Cancer Lett. 82: 179-184; Gambus, et al. (1995) Int. J. Cancer 60: 146-148; McCool, et al. (1999) Biochem. J. 341: 593-600. Spas-1. U.S. Published patent application No. 20020150588 of Allison, et al. CASP-8; FLICE; MACH. Mandruzzato, et al. (1997) J. Exp. Med. 186: 785-793. CEACAM6; CAP-1. Duxbury, et al. (2004) Biochem. Biophys. Res. Commun. 317: 837-843; Morse, et al. (1999) Clin. Cancer Res. 5: 1331-1338. HMGB1 (a DNA binding Brezniceanu, et al. (2003) FASEB J. 17: 1295-1297. protein and cytokine). ETV6/AML1. Codrington, et al. (2000) Br. J. Haematol. 111: 1071-1079. Mutant and wild type Clements, et al. (2003) Clin. Colorectal Cancer 3: 113-120; Gulmann, et al. forms of adenomatous (2003) Appl. Immunohistochem. Mol. Morphol. 11: 230-237; Jungck, et al. polyposis coli (APC); (2004) Int. J. Colorectal. Dis. 19: 438-445; Wang, et al. (2004) J. Surg. beta-catenin; c-met; p53; Res. 120: 242-248; Abutaily, et al. (2003) J. Pathol. 201: 355-362; Liang, et E-cadherin; al. (2004) Br. J. Surg. 91: 355-361; Shirakawa, et al. (2004) Clin. Cancer cyclooxygenase-2 Res. 10: 4342-4348. (COX-2). Renal cell carcinoma Mulders, et al. (2003) Urol. Clin. North Am. 30: 455-465; Steffens, et al. antigen bound by mAB (1999) Anticancer Res. 19: 1197-1200. G250. EphA2 See. e.g., U.S. Patent Publication No. 2005/0281783 A1; Genbank Accession No. NM_004431 (human); Genbank Accession No. NM_010139 (Mouse); Genbank Accession No. AB038986 (Chicken, partial sequence); GenBank Accession Nos. NP_004422, AAH37166, and AAA53375 (human); GenBank Accession Nos. NP_034269 (mouse), AAH06954 (mouse), XP_345597 (rat), and BAB63910 (chicken). Francisella tularensis antigens Francisella tularensis Complete genome of subspecies Schu S4 (GenBank Acc. No. AJ749949); A and B. of subspecies Schu 4 (GenBank Acc. No. NC_006570). Outer membrane protein (43 kDa) Bevanger, et al. (1988) J. Clin. Microbiol. 27: 922-926; Porsch-Ozcurumez, et al. (2004) Clin. Diagnostic. Lab. Immunol. 11: 1008-1015). Antigenic components of F. tularensis include, e.g., 80 antigens, including 10 kDa and 60 kDa chaperonins (Havlasova, et al. (2002) Proteomics 2: 857-86), nucleoside diphosphate kinase, isocitrate dehydrogenase, RNA-binding protein Hfq, the chaperone ClpB (Havlasova, et al. (2005) Proteomics 5: 2090-2103). See also, e.g., Oyston and Quarry (2005) Antonie Van Leeuwenhoek 87: 277-281; Isherwood, et al. (2005) Adv. Drug Deliv. Rev. 57: 1403-1414; Biagini, et al. (2005) Anal. Bioanal. Chem. 382: 1027-1034. Malarial antigens Circumsporozoite protein See, e.g., Haddad, et al. (2004) Infection Immunity 72: 1594-1602; (CSP); SSP2; HEP17; Hoffman, et al. (1997) Vaccine 15: 842-845; Oliveira-Ferreira and Exp-1 orthologs found in Daniel-Ribeiro (2001) Mem. Inst. Oswaldo Cruz, Rio de Janeiro 96: 221- P. falciparum; and 227. CSP (see, e.g., GenBank Acc. No. AB121024). SSP2 (see, e.g., LSA-1. GenBank Acc. No. AF249739). LSA-1 (see, e.g., GenBank Acc. No. Z30319). Ring-infected erythrocyte See, e.g., Stirnadel, et al. (2000) Int. J. Epidemiol. 29: 579-586; Krzych, et survace protein (RESA); al. (1995) J. Immunol. 155: 4072-4077. See also, Good, et al. (2004) merozoite surface Immunol. Rev. 201: 254-267; Good, et al. (2004) Ann. Rev. Immunol. protein 2 (MSP2); Spf66; 23: 69-99. MSP2 (see, e.g., GenBank Acc. No. X96399; X96397). MSP1 merozoite surface (see, e.g., GenBank Acc. No. X03371). RESA (see, e.g., GenBank Acc. protein 1(MSP1); 195A; No. X05181; X05182). BVp42. Apical membrane See, e.g., Gupta, et al. (2005) Protein Expr. Purif. 41: 186-198. AMA1 antigen 1 (AMA1). (see, e.g., GenBank Acc. No. A{grave over ()}13; AJ494905; AJ490565). Viruses and viral antigens Hepatitis A GenBank Acc. Nos., e.g., NC_001489; AY644670; X83302; K02990; M14707. Hepatitis B Complete genome (see, e.g., GenBank Acc. Nos. AB214516; NC_003977; AB205192; AB205191; AB205190; AJ748098; AB198079; AB198078; AB198076; AB074756). Hepatitis C Complete genome (see, e.g., GenBank Acc. Nos. NC_004102; AJ238800; AJ238799; AJ132997; AJ132996; AJ000009; D84263). Hepatitis D GenBank Acc. Nos, e.g. NC_001653; AB118847; AY261457. Human papillomavirus, See, e.g., Trimble, et al. (2003) Vaccine 21: 4036-4042; Kim, et al. (2004) including all 200+ Gene Ther. 11: 1011-1018; Simon, et al. (2003) Eur. J. Obstet. Gynecol. subtypes (classed in Reprod. Biol. 109: 219-223; Jung, et al. (2004) J. Microbiol. 42: 255- 16 groups), such as the 266; Damasus-Awatai and Freeman-Wang (2003) Curr. Opin. high risk subtypes 16, Obstet. Gynecol. 15: 473-477; Jansen and Shaw (2004) Annu. Rev. 18, 30, 31, 33, 45. Med. 55: 319-331; Roden and Wu (2003) Expert Rev. Vaccines 2: 495-516; de Villiers, et al. (2004) Virology 324: 17-24; Hussain and Paterson (2005) Cancer Immunol. Immunother. 54: 577-586; Molijn, et al. (2005) J. Clin. Virol. 32 (Suppl. 1) S43-S51. GenBank Acc. Nos. AY686584; AY686583; AY686582; NC_006169; NC_006168; NC_006164; NC_001355; NC_001349; NC_005351; NC_001596). Human T-cell See, e.g., Capdepont, et al. (2005) AIDS Res. Hum. Retrovirus lymphotropic virus 21: 28-42; Bhigjee, et al. (1999) AIDS Res. Hum. Restrovirus (HTLV) types I and II, 15: 1229-1233; Vandamme, et al. (1998) J. Virol. 72: 4327-4340; including the Vallejo, et al. (1996) J. Acquir. Immune Defic. Syndr. Hum. HTLV type I subtypes Retrovirol. 13: 384-391. HTLV type I (see, e.g., GenBank Acc. Cosmopolitan, Central Nos. AY563954; AY563953. HTLV type II (see, e.g., GenBank Acc. African, and Nos. L03561; Y13051; AF139382). Austro-Melanesian, and the HTLV type II subtypes Iia, Iib, Iic, and Iid. Coronaviridae, See, e.g., Brian and Baric (2005) Curr. Top. Microbiol. Immunol. including 287: 1-30; Gonzalez, et al. (2003) Arch. Virol. 148: 2207-2235; Coronaviruses, such as Smits, et al. (2003) J. Virol. 77: 9567-9577; Jamieson, et al. (1998) SARS-coronavirus J. Infect. Dis. 178: 1263-1269 (GenBank Acc. Nos. AY348314; (SARS-CoV), and NC_004718; AY394850). Toroviruses. Rubella virus. GenBank Acc. Nos. NC_001545; AF435866. Mumps virus, including See, e.g., Orvell, eta 1. (2002) J. Gen. Virol. 83: 2489-2496. the genotypes A, C, D, See, e.g., GenBank Acc. Nos. AY681495; NC_002200; AY685921; G, H, and I. AF201473. Coxsackie virus A See, e.g., Brown, et al. (2003) J. Virol. 77: 8973-8984. including the serotypes GenBank Acc. Nos. AY421768; AY790926: X67706. 1, 11, 13, 15, 17, 18, 19, 20, 21, 22, and 24 (also known as Human enterovirus C; HEV-C). Coxsackie virus B, See, e.g., Ahn, et al. (2005) J. Med. Virol. 75: 290-294; Patel, et al. including subtypes 1-6. (2004) J. Virol. Methods 120: 167-172; Rezig, et al. (2004) J. Med. Virol. 72: 268-274. GenBank Acc. No. X05690. Human enteroviruses See, e.g., Oberste, et al. (2004) J. Virol. 78: 855-867. Human including, e.g., human enterovirus A (GenBank Acc. Nos. NC_001612); human enterovirus A (HEV-A, enterovirus B (NC_001472); human enterovirus C (NC_001428); CAV2 to CAV8, human enterovirus D (NC_001430). Simian enterovirus A CAV10, CAV12, (GenBank Acc. No. NC_003988). CAV14, CAV16, and EV71) and also including HEV-B (CAV9, CBV1 to CBV6, E1 to E7, E9, E11 to E21, E24 to E27, E29 to E33, and EV69 and E73), as well as HEV. Polioviruses including See, e.g., He, et al. (2003) J. Virol. 77: 4827-4835; Hahsido, et al. PV1, PV2, and PV3. (1999) Microbiol. Immunol. 43: 73-77. GenBank Acc. No. AJ132961 (type 1); AY278550 (type 2); X04468 (type 3). Viral encephalitides See, e.g., Hoke (2005) Mil. Med. 170: 92-105; Estrada-Franco, et al. viruses, including (2004) Emerg. Infect. Dis. 10: 2113-2121; Das, et al. (2004) equine encephalitis, Antiviral Res. 64: 85-92; Aguilar, et al. (2004) Emerg. Infect. Dis. Venezuelan equine 10: 880-888; Weaver, et al. (2004) Arch. Virol. Suppl. 18: 43-64; encephalitis (VEE) Weaver, et al. (2004) Annu. Rev. Entomol. 49: 141-174. Eastern (including subtypes IA, equine encephalitis (GenBank Acc. No. NC_003899; AY722102); IB, IC, ID, IIIC, IIID), Western equine encephalitis (NC_003908). Eastern equine encephalitis (EEE), Western equine encephalitis (WEE), St. Louis encephalitis, Murray Valley (Australian) encephalitis, Japanese encephalitis, and tick-born encephalitis. Human herpesviruses, See, e.g., Studahl, et al. (2000) Scand. J. Infect. Dis. 32: 237-248; including Padilla, et al. (2003) J. Med. Virol. 70 (Suppl. 1) S103-S110; cytomegalovirus Jainkittivong and Langlais (1998) Oral Surg. Oral Med. 85: 399-403. (CMV), Epstein-Barr GenBank Nos. NC_001806 (herpesvirus 1); NC_001798 virus (EBV), human (herpesvirus 2); X04370 and NC_001348 (herpesvirus 3); herpesvirus-1 NC_001345 (herpesvirus 4); NC_001347 (herpesvirus 5); X83413 (HHV-1), HHV-2, and NC_000898 (herpesvirus 6); NC_001716 (herpesvirus 7). HHV-3, HHV-4, Human herpesviruses types 6 and 7 (HHV-6; HHV-7) are disclosed HHV-5, HHV-6, by, e.g., Padilla, et al. (2003) J. Med. Virol. 70 (Suppl. 1)S103- HHV-7, HHV-8, S110. Human herpesvirus 8 (HHV-8), including subtypes A-E, are herpes B virus, herpes disclosed in, e.g., Treurnicht, et al. (2002) J. Med. Virul. 66: 235- simplex virus types 1 240. and 2 (HSV-1, HSV-2), and varicella zoster virus (VZV). HIV-1 including group See, e.g., Smith, et al. (1998) J. Med. Virol. 56: 264-268. See also, M (including subtypes e.g., GenBank Acc. Nos. DQ054367; NC_001802; AY968312; A to J) and group O DQ011180; DQ011179; DQ011178; DQ011177; AY588971; (including any AY588970; AY781127; AY781126; AY970950; AY970949; distinguishable AY970948; X61240; AJ006287; AJ508597; and AJ508596. subtypes) (HIV-2, including subtypes A-E. Epstein-Barr virus See, e.g., Peh, et al. (2002) Pathology 34: 446-450. (EBV), including Epstein-Barr virus strain B95-8 (GenBank Acc. No. V01555). subtypes A and B. Reovirus, including See, e.g., Barthold, et al. (1993) Lab. Anim. Sci. 43: 425-430; Roner, serotypes and strains 1, et al. (1995) Proc. Natl. Acad. Sci. USA 92: 12362-12366; Kedl, et 2, and 3, type 1 Lang, al. (1995) J. Virol. 69: 552-559. GenBank Acc. No. K02739 type 2 Jones, and (sigma-3 gene surface protein). type 3 Dearing. Cytomegalovirus See, e.g., Chern, et al. (1998) J. Infect. Dis. 178: 1149-1153; Vilas (CMV) subtypes Boas, et al. (2003) J. Med. Virol. 71: 404-407; Trincado, et al. include CMV subtypes (2000) J. Med. Virol. 61: 481-487. GenBank Acc. No. X17403. I-VII. Rhinovirus, including Human rhinovirus 2 (GenBank Acc. No. X02316); Human rhinovirus B all serotypes. (GenBank Acc. No. NC_001490); Human rhinovirus 89 (GenBank Acc. No. NC_001617); Human rhinovirus 39 (GenBank Acc. No. AY751783). Adenovirus, including AY803294; NC_004001; AC_000019; AC_000018; AC_000017; all serotypes. AC_000015; AC_000008; AC_000007; AC_000006; AC_000005; AY737798; AY737797; NC_003266; NC_002067; AY594256; AY594254; AY875648; AJ854486; AY163756; AY594255; AY594253; NC_001460; NC_001405; AY598970; AY458656; AY487947; NC_001454; AF534906; AY45969; AY128640; L19443; AY339865; AF532578. Varicella-zoster virus, See, e.g., Loparev, et al. (2004) J. Virol. 78: 8349-8358; including strains and Carr, et al. (2004) J. Med. Virol. 73: 131-136; Takayama genotypes Oka, Dumas, and Takayama (2004) J. Clin. Virol. 29: 113-119. European, Japanese, and Mosaic. Filoviruses, including See, e.g., Geisbert and Jahrling (1995) Virus Res. 39: 129-150; Marburg virus and Hutchinson, et al. (2001) J. Med. Virol. 65: 561-566. Marburg virus Ebola virus, and strains (see, e.g., GenBank Acc. No. NC_001608). Ebola virus (see, e.g., such as Ebola-Sudan GenBank Acc. Nos. NC_006432; AY769362; NC_002549; (EBO-S), Ebola-Zaire AF272001; AF086833). (EBO-Z), and Ebola-Reston (EBO-R). Arenaviruses, including Junin virus, segment S (GenBank Acc. No. NC_005081); Junin virus, lymphocytic segment L (GenBank Acc. No. NC_005080). choriomeningitis (LCM) virus, Lassa virus, Junin virus, and Machupo virus. Rabies virus. See, e.g., GenBank Acc. Nos. NC_001542; AY956319; AY705373; AF499686; AB128149; AB085828; AB009663. Arboviruses, including Dengue virus type 1 (see, e.g., GenBank Acc. Nos. AB195673; West Nile virus, AY762084). Dengue virus type 2 (see, e.g., GenBank Acc. Nos. Dengue viruses 1 to 4, NC_001474; AY702040; AY702039; AY702037). Dengue virus Colorado tick fever type 3 (see, e.g., GenBank Acc. Nos. AY923865; AT858043). virus, Sindbis virus, Dengue virus type 4 (see, e.g., GenBank Acc. Nos. AY947539; Togaviraidae, AY947539; AF326573). Sindbis virus (see, e.g., GenBank Acc. Flaviviridae, Nos. NC_001547; AF429428; J02363; AF103728). West Nile virus Bunyaviridae, (see, e.g., GenBank Acc. Nos. NC_001563; AY603654). Reoviridae, Rhabdoviridae, Orthomyxoviridae, and the like. Poxvirus including Viriola virus (see, e.g., GenBank Acc. Nos. NC_001611; Y16780; orthopoxvirus (variola X72086; X69198). virus, monkeypox virus, vaccinia virus, cowpox virus), yatapoxvirus (tanapox virus, Yaba monkey tumor virus), parapoxvirus, and molluscipoxvirus. Yellow fever. See, e.g., GenBank Acc. No. NC_002031; AY640589; X03700. Hantaviruses, including See, e.g., Elgh, et al. (1997) J. Clin. Microbiol. 35: 1122-1130; serotypes Hantaan Sjolander, et al. (2002) Epidemiol. Infect. 128: 99-103; Zeier, et al. (HTN), Seoul (SEO), (2005) Virus Genes 30: 157-180. GenBank Acc. No. NC_005222 Dobrava (DOB), Sin and NC_005219 (Hantavirus). See also, e.g., GenBank Acc. Nos. Nombre (SN), Puumala NC_005218; NC_005222; NC_005219. (PUU), and Dobrava-like Saaremaa (SAAV). Flaviviruses, including See, e.g., Mukhopadhyay, et al. (2005) Nature Rev. Microbiol. 3: 13- Dengue virus, Japanese 22. GenBank Acc. Nos NC_001474 and AY702040 (Dengue). encephalitis virus, West GenBank Acc. Nos. NC_001563 and AY603654. Nile virus, and yellow fever virus. Measles virus. See, e.g., GenBank Acc. Nos. AB040874 and AY486084. Human Human parainfluenza virus 2 (see, e.g., GenBank Acc. Nos. AB176531; parainfluenzaviruses NC003443). Human parainfluenza virus 3 (see, e.g., GenBank Acc. No. (HPV), including HPV NC_001796). types 1-56. Influenza virus, Influenza nucleocapsid (see, e.g., GenBank Acc. No. AY626145). including influenza Influenza hemagglutinin (see, e.g., GenBank Acc. Nos. AY627885; virus types A, B, AY555153). Influenza neuraminidase (see, e.g., GenBank Acc. Nos. and C. AY555151; AY577316). Influenza matrix protein 2 (see, e.g., GenBank Acc. Nos. AY626144(.Influenza basic protein 1 (see, e.g., GenBank Acc. No. AY627897). Influenza polymerase acid protein (see, e.g., GenBank Acc. No. AY627896). Influenza nucleoprotein (see, e.g., GenBank Acc. Nno. AY627895). Influenza A virus Hemagglutinin of H1N1 (GenBank Acc. No. S67220). Influenza A virus subtypes, e.g., swine matrix protein (GenBank Acc. No. AY700216). Influenza virus A H5H1 viruses (SIV): H1N1 nucleoprotein (GenBank Acc. No. AY646426). H1N1 haemagglutinin influenzaA and swine (GenBank Acc. No. D00837). See also, GenBank Acc. Nos. BD006058; influenza virus. BD006055; BD006052. See also, e.g., Wenrworth, et al. (1994) J. Virol. 68: 2051-2058; Wells, et al. (1991) J.A.M.A. 265: 478-481. Respiratory syncytial Respiratory syncytial virus (RSV) (see, e.g., GenBank Acc. Nos. virus (RSV), including AY353550; NC_001803; NC001781). subgroup A and subgroup B. Rotaviruses, including Human rotavirus C segment 8 (GenBank Acc. No. AJ549087); human rotaviruses A to Human rotavirus G9 strain outer capsid protein (see, e.g., E, bovine rotavirus, GenBank Acc. No. DQ056300); Human rotavirus B strain non-structural rhesus monkey protein 4 (see, e.g., GenBank Acc. No. AY548957); human rotavirus rotavirus, and A strain major inner capsid protein (see, e.g., GenBank Acc. No. human-RVV AY601554). reassortments. Polyomavirus, See, e.g., Engels, et al. (2004) J. Infect. Dis. 190: 2065-2069; including simian Vilchez and Butel (2004) Clin. Microbiol. Rev. 17: 495-508; virus 40 (SV40), JC Shivapurkar, et al. (2004) Cancer Res. 64: 3757-3760; Carbone, et virus (JCV) and BK al. (2003) Oncogene 2: 5173-5180; Barbanti-Brodano, et al. (2004) virus (BKV). Virology 318: 1-9) (SV40 complete genome in, e.g., GenBank Acc. Nos. NC_001669; AF168994; AY271817; AY271816; AY120890; AF345344; AF332562). Coltiviruses, including Attoui, et al. (1998) J. Gen. Virol. 79: 2481-2489. Segments of Colorado tick fever Eyach virus (see, e.g., GenBank Acc. Nos. AF282475; AF282472; virus, Eyach virus. AF282473; AF282478; AF282476; NC_003707; NC_003702; NC_003703; NC_003704; NC_003705; NC_003696; NC_003697; NC_003698; NC_003699; NC_003701; NC_003706; NC_003700; AF282471; AF282477). Calciviruses, including Snow Mountain virus (see, e.g., GenBank Acc. No. AY134748). the genogroups Norwalk, Snow Mountain group (SMA), and Saaporo. Parvoviridae, including See, e.g., Brown (2004) Dev. Biol. (Basel) 118: 71-77; Alvarez-Lafuente, dependovirus, et al. (2005) Ann. Rheum. Dis. 64: 780-782; Ziyaeyan, et al. (2005) Jpn. J. parvovirus (including Infect. Dis. 58: 95-97; Kaufman, et al. (2005) Virology 332: 189-198. parvovirus B19), and erythrovirus.
Other organisms for which suitable antigens are known in the art include, but are not limited to, Chlamydia trachomatis, Streptococcus pyogenes (Group A Strep), Streptococcus agalactia (Group B Strep), Streptococcus pneumonia, Staphylococcus aureus, Escherichia coli, Haemophilus influenzae, Neisseria meningitidis, Neisseria gonorrheae, Vibrio cholerae, Salmonella species (including typhi, typhimurium), enterica (including Helicobactor pylori Shigella flexneri and other Group D shigella species), Burkholderia mallei, Burkholderia pseudomallei, Klebsiella pneumonia, Clostridium species (including C. difficile), Vibrio parahaemolyticus and V. vulnificus. This list is not meant to be limiting.

(80) As described herein antigen sequence(s) are preferably expressed as a single polypeptide fused to a modified amino-terminal portion of the L. monocytogenes ActA or LLO protein in frame with the ActA or LLO secretory signal sequence. The ActA signal sequence is MGLNRFMRAMMVVFITANCITINPDIIFA (SEQ ID NO: 10); the LLO signal sequence is MKKIMLVFIT LILVSLPIAQ QTE (SEQ ID NO: 11). Preferably, the native signal sequence used is not modified in the construct.

(81) In some embodiments, the modified ActA comprises a modified form of about the first 100 amino acids of ActA, referred to herein as ActA-N100. ActA-N100 has the following sequence (SEQ ID NO: 12):

(82) TABLE-US-00003 VGLNRFMRAMMVVFITANCITINPDIIFAATDSEDSSLNTDEWEEEKTEE 50 QPSEVNTGPRYETAREVSSRDIEELEKSNKVKNTNKADLIAMLKAKAEKG 100

(83) In this sequence, the first residue is depicted as a valine; the polypeptide is synthesized by Listeria with a methionine in this position. Thus, ActA-N100 may also have the following sequence (SEQ ID NO: 13):

(84) TABLE-US-00004 MGLNRFMRAMMVVFITANCITINPDIIFAATDSEDSSLNTDEWEEEKTEE 50 QPSEVNTGPRYETAREVSSRDIEELEKSNKVKNTNKADLIAMLKAKAEKG 100

(85) The constructs of the present invention may also comprise one or more additional, non-ActA, residues lying between the C-terminal residue of the modified ActA and the antigen sequence. In the following sequences, ActA-N100 is extended by two residues added by inclusion of a BamH1 site (SEQ ID NO: 14):

(86) TABLE-US-00005 VGLNRFMRAMMVVFITANCITINPDIIFAATDSEDSSLNTDEWEEEKTEE 50 QPSEVNTGPRYETAREVSSRDIEELEKSNKVKNTNKADLIAMLKAKAEKG 100 GS
which when synthesized with a first residue methionine has the sequence (SEQ ID NO: 15):

(87) TABLE-US-00006 MGLNRFMRAMMVVFITANCITINPDIIFAATDSEDSSLNTDEWEEEKTEE 50 QPSEVNTGPRYETAREVSSRDIEELEKSNKVKNTNKADLIAMLKAKAEKG 100 GS.

(88) These sequences may then serve as the basis for modification by deletion (actual or functional) of the PEST motif and any existing hydrophobic motifs. Thus, a modified ActA of the invention may comprise or consist of the following sequence (dashes indicate deletions and bold text indicates substitutions) (SEQ ID NO: 16):

(89) TABLE-US-00007 VGLNRFMRAMMVVFITANCITINPDIIFAATDSEDSSLNTDEWEEE---- 50 ----------YETAREVSSRDIEELEKSNKVKNTNKADQDNKRKAKAEKG 100

(90) In this sequence, the first residue is depicted as a valine; the polypeptide is synthesized by Listeria with a methionine in this position. Thus, a modified may also comprise or consist of the following sequence (SEQ ID NO: 17):

(91) TABLE-US-00008 MGLNRFMRAMMVVFITANCITINPDIIFAATDSEDSSLNTDEWEEE---- 50 ----------YETAREVSSRDIEELEKSNKVKNTNKADQDNKRKAKAEKG 100

(92) In these cases, the substitution with QDNKR (SEQ ID NO: 9) is optionally included with the deletion of the PEST motif, and as above, these constructs of the present invention may also comprise one or more additional, non-ActA, residues lying between the C-terminal residue of the modified ActA and the antigen sequence.

(93) Alternatively, antigen sequence(s) are preferably expressed as a single polypeptide fused to a modified amino-terminal portion of the L. monocytogenes LLO protein which permits expression and secretion of a fusion protein from the bacterium within the vaccinated host. In these embodiments, the antigenic construct may be a polynucleotide comprising a promoter operably linked to a nucleic acid sequence encoding a fusion protein, wherein the fusion protein comprises (a) modified LLO and (b) one or more antigenic epitopes to be expressed as a fusion protein following the modified LLO sequence. The LLO signal sequence is MKKIMLVFIT LILVSLPIAQ QTEAK (SEQ ID NO: 18). In some embodiments, the promoter is hly promoter.

(94) In some embodiments, the modified LLO comprises a modified form of about the first 441 amino acids of LLO, referred to herein as LLO-N441. LLO-N441 has the following sequence (SEQ ID NO: 19):

(95) TABLE-US-00009 102030405060 MKKIMLVFITLILVSLPIAQQTEAKDASAFNKENSISSMAPPASPPASPKTPIEKKHADE 708090100110120 IDKYIQGLDYNKNNVLVYHGDAVTNVPPRKGYKDGNEYIVVEKKKKSINQNNADIQVVNA 130140150160170180 ISSLTYPGALVKANSELVENQPDVLPVKRDSLTLSIDLPGMTNQDNKIVVKNATKSNVNN 190200210220230240 AVNTLVERWNEKYAQAYPNVSAKIDYDDEMAYSESQLIAKFGTAFKAVNNSLNVNFGAIS 250260270280290300 EGKMQEEVISFKQIYYNVNVNEPTRPSRFFGKAVTKEQLQALGVNAENPPAYISSVAYGR 310320330340350360 QVYLKLSTNSHSTKVKAAFDAAVSGKSVSGDVELTNIIKNSSFKAVIYGGSAKDEVQIID 370380390400410420 GNLGDLRDILKKGATFNRETPGVPIAYTTNFLKDNELAVIKNNSEYIETTSKAYTDGKIN 430440 IDHSGGYVAQFNISWDEVNYD

(96) In this sequence, the PEST motif is represented by KENSISSMA PPASPPASPK (SEQ ID NO: 6). This may be functionally deleted by replacement with the following sequence (dashes indicate deletions and bold text indicates substitutions):

(97) KEcustom character, or by its complete deletion. This is intended to be exemplary only.

(98) As sequences encoded by one organism are not necessarily codon optimized for optimal expression in a chosen vaccine platform bacterial strain, the present invention also provides nucleic acids that are altered by codon optimized for expressing by a bacterium such as L. monocytogenes.

(99) In various embodiments, at least one percent of any non-optimal codons are changed to provide optimal codons, more normally at least five percent are changed, most normally at least ten percent are changed, often at least 20% are changed, more often at least 30% are changed, most often at least 40%, usually at least 50% are changed, more usually at least 60% are changed, most usually at least 70% are changed, optimally at least 80% are changed, more optimally at least 90% are changed, most optimally at least 95% are changed, and conventionally 100% of any non-optimal codons are codon-optimized for Listeria expression (Table 2).

(100) TABLE-US-00010 TABLE2 OptimalcodonsforexpressioninListeria. Amino A R N D C Q E G H I Acid Optimal GCA CGU AAU GAU UGU CAA GAA GGU CAU AUU Listeriacodon AminoAcid L K M F P S T W Y V Optimal UUA AAA AUG UUU CCA AGU ACA UGG UAU GUU Listeriacodon

(101) The invention supplies a number of Listeria species and strains for making or engineering a bacterium of the present invention. The Listeria of the present invention is not to be limited by the species and strains disclosed in Table 3.

(102) TABLE-US-00011 TABLE 3 Strains of Listeria suitable for use in the present invention, e.g., as a vaccine or as a source of nucleic acids. L. monocytogenes 10403S wild type. Bishop and Hinrichs (1987) J. Immunol. 139: 2005-2009; Lauer, et al. (2002) J. Bact. 184: 4177-4186. L. monocytogenes DP-L4056 (phage cured). The Lauer, et al. (2002) J. Bact. 184: 4177-4186. prophage-cured 10403S strain is designated DP- L4056. L. monocytogenes DP-L4027, which is DP-L2161, Lauer, et al. (2002) J. Bact. 184: 4177-4186; Jones phage cured, deleted in hly gene. and Portnoy (1994) Infect. Immunity 65: 5608- 5613. L. monocytogenes DP-L4029, which is DP-L3078, Lauer, et al. (2002) J. Bact. 184: 4177-4186; phage cured, deleted in ActA. Skoble, et al. (2000) J. Cell Biol. 150: 527-538. L. monocytogenes DP-L4042 (delta PEST) Brockstedt, et al. (2004) Proc. Natl. Acad. Sci. USA 101: 13832-13837; supporting information. L. monocytogenes DP-L4097 (LLO-S44A). Brockstedt, et al. (2004) Proc. Natl. Acad. Sci. USA 101: 13832-13837; supporting information. L. monocytogenes DP-L4364 (delta lplA; Brockstedt, et al. (2004) Proc. Natl. Acad. Sci. lipoate protein ligase). USA 101: 13832-13837; supporting information. L. monocytogenes DP-L4405 (delta inlA). Brockstedt, et al. (2004) Proc. Natl. Acad. Sci. USA 101: 13832-13837; supporting information. L. monocytogenes DP-L4406 (delta inlB). Brockstedt, et al. (2004) Proc. Natl. Acad. Sci. USA 101: 13832-13837; supporting information. L. monocytogenes CS-L0001 (delta ActA-delta Brockstedt, et al. (2004) Proc. Natl. Acad. Sci. inlB). USA 101: 13832-13837; supporting information. L. monocytogenes CS-L0002 (delta ActA-delta Brockstedt, et al. (2004) Proc. Natl. Acad. Sci. lplA). USA 101: 13832-13837; supporting information. L. monocytogenes CS-L0003 (L461T-delta lplA). Brockstedt, et al. (2004) Proc. Natl. Acad. Sci. USA 101: 13832-13837; supporting information. L. monocytogenes DP-L4038 (delta ActA-LLO Brockstedt, et al. (2004) Proc. Natl. Acad. Sci. L461T). USA 101: 13832-13837; supporting information. L. monocytogenes DP-L4384 (S44A-LLO L461T). Brockstedt, et al. (2004) Proc. Natl. Acad. Sci. USA 101: 13832-13837; supporting information. L. monocytogenes. Mutation in lipoate protein O'Riordan, et al. (2003) Science 302: 462-464. ligase (LplA1). L. monocytogenes DP-L4017 (10403S hly (L461T) U.S. Provisional Pat. application Ser. No. point mutation in hemolysin gene. 60/490,089 filed Jul. 24, 2003. L. monocytogenes EGD. GenBank Acc. No. AL591824. L. monocytogenes EGD-e. GenBank Acc. No. NC_003210. ATCC Acc. No. BAA-679. L. monocytogenes strain EGD, complete genome, GenBank Acc. No. AL591975 segment 3/12 L. monocytogenes. ATCC Nos. 13932; 15313; 19111-19120; 43248- 43251; 51772-51782. L. monocytogenes DP-L4029 deleted in uvrAB. U.S. Provisional Pat. application Ser. No. 60/541,515 filed Feb. 2, 2004; U.S. Provisional Pat. application Ser. No. 60/490,080 filed Jul. 24, 2003. L. monocytogenes DP-L4029 deleted in uvrAB U.S. Provisional Pat. application Ser. No. treated with a psoralen. 60/541,515 filed Feb. 2, 2004. L. monocytogenes ActA-/inlB- double mutant. Deposited with ATCC on Oct. 3, 2003. Acc. No. PTA-5562. L. monocytogenes lplA mutant or hly mutant. U.S. patent application No. 20040013690 of Portnoy, et al. L. monocytogenes DAL/DAT double mutant. U.S. patent application No. 20050048081 of Frankel and Portnoy. L. monocytogenes str. 4b F2365. GenBank Acc. No. NC_002973. Listeria ivanovii ATCC No. 49954 Listeria innocua Clip11262. GenBank Acc. No. NC_003212; AL592022. Listeria innocua, a naturally occurring hemolytic Johnson, et al. (2004) Appl. Environ. strain containing the PrfA-regulated virulence gene Microbiol. 70: 4256-4266. cluster. Listeria seeligeri. Howard, et al. (1992) Appl. Eviron. Microbiol. 58: 709-712. Listeria innocua with L. monocytogenes Johnson, et al. (2004) Appl. Environ. pathogenicity island genes. Microbiol. 70: 4256-4266. Listeria innocua with L. monocytogenes internalin A See, e.g., Lingnau, et al. (1995) Infection gene, e.g., as a plasmid or as a genomic nucleic acid. Immunity 63: 3896-3903; Gaillard, et al. (1991) Cell 65: 1127-1141). The present invention encompasses reagents and methods that comprise the above Listerial strains, as well as these strains that are modified, e.g., by a plasmid and/or by genomic integration, to contain a nucleic acid encoding one of, or any combination of, the following genes: hly (LLO; listeriolysin); iap (p60); inlA; inlB; inlC; dal (alanine racemase); daaA (dat; D-amino acid aminotransferase); plcA; plcB; ActA; or any nucleic acid that mediates growth, spread, breakdown of a single walled vesicle, breakdown of a double walled vesicle, binding to a host cell, uptake by a host cell. The present invention is not to be limited by the particular strains disclosed above.

(103) Therapeutic Compositions.

(104) The bacterial compositions described herein can be administered to a host, either alone or in combination with a pharmaceutically acceptable excipient, in an amount sufficient to induce an appropriate immune response. The immune response can comprise, without limitation, specific immune response, non-specific immune response, both specific and non-specific response, innate response, primary immune response, adaptive immunity, secondary immune response, memory immune response, immune cell activation, immune cell proliferation, immune cell differentiation, and cytokine expression. The vaccines of the present invention can be stored, e.g., frozen, lyophilized, as a suspension, as a cell paste, or complexed with a solid matrix or gel matrix.

(105) In certain embodiments, after the subject has been administered an effective dose of a first vaccine to prime the immune response, a second vaccine is administered. This is referred to in the art as a prime-boost regimen. In such a regimen, the compositions and methods of the present invention may be used as the prime delivery, as the boost delivery, or as both a prime and a boost. Any number of boost immunizations can be delivered in order to maintain the magnitude or effectiveness of a vaccine-induced immune response.

(106) As an example, a first vaccine comprised of killed but metabolically active Listeria that encodes and expresses the antigen polypeptide(s) may be delivered as the prime, and a second vaccine comprised of attenuated (live or killed but metabolically active) Listeria that encodes the antigen polypeptide(s) may be delivered as the boost. It should be understood, however, that each of the prime and boost need not utilize the methods and compositions of the present invention. Rather, the present invention contemplates the use of other vaccine modalities together with the bacterial vaccine methods and compositions of the present invention. The following are examples of suitable mixed prime-boost regimens: a DNA (e.g., plasmid) vaccine prime/bacterial vaccine boost; a viral vaccine prime/bacterial vaccine boost; a protein vaccine prime/bacterial vaccine boost; a DNA prime/bacterial vaccine boost plus protein vaccine boost; a bacterial vaccine prime/DNA vaccine boost; a bacterial vaccine prime/viral vaccine boost; a bacterial vaccine prime/protein vaccine boost; a bacterial vaccine prime/bacterial vaccine boost plus protein vaccine boost; etc. This list is not meant to be limiting

(107) The prime vaccine and boost vaccine may be administered by the same route or by different routes. The term different routes encompasses, but is not limited to, different sites on the body, for example, a site that is oral, non-oral, enteral, parenteral, rectal, intranode (lymph node), intravenous, arterial, subcutaneous, intradermal, intramuscular, intratumor, peritumor, infusion, mucosal, nasal, in the cerebrospinal space or cerebrospinal fluid, and so on, as well as by different modes, for example, oral, intravenous, and intramuscular.

(108) An effective amount of a prime or boost vaccine may be given in one dose, but is not restricted to one dose. Thus, the administration can be two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, fifteen, sixteen, seventeen, eighteen, nineteen, twenty, or more, administrations of the vaccine. Where there is more than one administration of a vaccine or vaccines in the present methods, the administrations can be spaced by time intervals of one minute, two minutes, three, four, five, six, seven, eight, nine, ten, or more minutes, by intervals of about one hour, two hours, three, four, five, six, seven, eight, nine, ten, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 hours, and so on. In the context of hours, the term about means plus or minus any time interval within 30 minutes. The administrations can also be spaced by time intervals of one day, two days, three days, four days, five days, six days, seven days, eight days, nine days, ten days, 11 days, 12 days, 13 days, 14 days, 15 days, 16 days, 17 days, 18 days, 19 days, 20 days, 21 days, and combinations thereof. The invention is not limited to dosing intervals that are spaced equally in time, but encompass doses at non-equal intervals, such as a priming schedule consisting of administration at 1 day, 4 days, 7 days, and 25 days, just to provide a non-limiting example.

(109) In certain embodiments, administration of the boost vaccination can be initiated at about 5 days after the prime vaccination is initiated; about 10 days after the prime vaccination is initiated; about 15 days; about 20 days; about 25 days; about 30 days; about 35 days; about 40 days; about 45 days; about 50 days; about 55 days; about 60 days; about 65 days; about 70 days; about 75 days; about 80 days, about 6 months, and about 1 year after administration of the prime vaccination is initiated. Preferably one or both of the prime and boost vaccination comprises delivery of a composition of the present invention.

(110) A pharmaceutically acceptable excipient or diagnostically acceptable excipient includes but is not limited to, sterile distilled water, saline, phosphate buffered solutions, amino acid based buffers, or bicarbonate buffered solutions. An excipient selected and the amount of excipient used will depend upon the mode of administration. Administration may be oral, intravenous, subcutaneous, dermal, intradermal, intramuscular, mucosal, parenteral, intraorgan, intralesional, intranasal, inhalation, intraocular, intramuscular, intravascular, intranodal, by scarification, rectal, intraperitoneal, or any one or combination of a variety of well-known routes of administration. The administration can comprise an injection, infusion, or a combination thereof.

(111) Administration of the vaccine of the present invention by a non-oral route can avoid tolerance. Methods are known in the art for administration intravenously, subcutaneously, intradermally, intramuscularly, intraperitoneally, orally, mucosally, by way of the urinary tract, by way of a genital tract, by way of the gastrointestinal tract, or by inhalation.

(112) An effective amount for a particular patient may vary depending on factors such as the condition being treated, the overall health of the patient, the route and dose of administration and the severity of side effects. Guidance for methods of treatment and diagnosis is available (see, e.g., Maynard, et al. (1996) A Handbook of SOPs for Good Clinical Practice, Interpharm Press, Boca Raton, Fla.; Dent (2001) Good Laboratory and Good Clinical Practice, Urch Publ., London, UK).

(113) The vaccines of the present invention can be administered in a dose, or dosages, where each dose comprises at least 100 bacterial cells/kg body weight or more; in certain embodiments 1000 bacterial cells/kg body weight or more; normally at least 10,000 cells; more normally at least 100,000 cells; most normally at least 1 million cells; often at least 10 million cells; more often at least 100 million cells; typically at least 1 billion cells; usually at least 10 billion cells; conventionally at least 100 billion cells; and sometimes at least 1 trillion cells/kg body weight. The present invention provides the above doses where the units of bacterial administration is colony forming units (CFU), the equivalent of CFU prior to psoralen treatment, or where the units are number of bacterial cells.

(114) The vaccines of the present invention can be administered in a dose, or dosages, where each dose comprises between 10.sup.7 and 10.sup.8 bacteria per 70 kg body weight (or per 1.7 square meters surface area; or per 1.5 kg liver weight); 210.sup.7 and 210.sup.8 bacteria per 70 kg body weight (or per 1.7 square meters surface area; or per 1.5 kg liver weight); 510.sup.7 and 510.sup.8 bacteria per 70 kg body weight (or per 1.7 square meters surface area; or per 1.5 kg liver weight); 10.sup.8 and 10.sup.9 bacteria per 70 kg body weight (or per 1.7 square meters surface area; or per 1.5 kg liver weight); between 2.010.sup.8 and 2.010.sup.9 bacteria per 70 kg (or per 1.7 square meters surface area, or per 1.5 kg liver weight); between 5.010.sup.8 to 5.010.sup.9 bacteria per 70 kg (or per 1.7 square meters surface area, or per 1.5 kg liver weight); between 10.sup.9 and 10.sup.10 bacteria per 70 kg (or per 1.7 square meters surface area, or per 1.5 kg liver weight); between 210.sup.9 and 210.sup.10 bacteria per 70 kg (or per 1.7 square meters surface area, or per 1.5 kg liver weight); between 510.sup.9 and 510.sup.10 bacteria per 70 kg (or per 1.7 square meters surface area, or per 1.5 kg liver weight); between 10.sup.11 and 10.sup.12 bacteria per 70 kg (or per 1.7 square meters surface area, or per 1.5 kg liver weight); between 210.sup.11 and 210.sup.12 bacteria per 70 kg (or per 1.7 square meters surface area, or per 1.5 kg liver weight); between 510.sup.11 and 510.sup.12 bacteria per 70 kg (or per 1.7 square meters surface area, or per 1.5 kg liver weight); between 10.sup.12 and 10.sup.13 bacteria per 70 kg (or per 1.7 square meters surface area); between 210.sup.12 and 210.sup.13 bacteria per 70 kg (or per 1.7 square meters surface area, or per 1.5 kg liver weight); between 510.sup.12 and 510.sup.13 bacteria per 70 kg (or per 1.7 square meters surface area, or per 1.5 kg liver weight); between 10.sup.13 and 10.sup.14 bacteria per 70 kg (or per 1.7 square meters surface area, or per 1.5 kg liver weight); between 210.sup.13 and 210.sup.14 bacteria per 70 kg (or per 1.7 square meters surface area, or per 1.5 kg liver weight); 510.sup.13 and 510.sup.14 bacteria per 70 kg (or per 1.7 square meters surface area, or per 1.5 kg liver weight); between 10.sup.14 and 10.sup.15 bacteria per 70 kg (or per 1.7 square meters surface area, or per 1.5 kg liver weight); between 210.sup.14 and 210.sup.15 bacteria per 70 kg (or per 1.7 square meters surface area, or per 1.5 kg liver weight); and so on, wet weight.

(115) Also provided is one or more of the above doses, where the dose is administered by way of one injection every day, one injection every two days, one injection every three days, one injection every four days, one injection every five days, one injection every six days, or one injection every seven days, where the injection schedule is maintained for, e.g., one day only, two days, three days, four days, five days, six days, seven days, two weeks, three weeks, four weeks, five weeks, or longer. The invention also embraces combinations of the above doses and schedules, e.g., a relatively large initial bacterial dose, followed by relatively small subsequent doses, or a relatively small initial dose followed by a large dose.

(116) A dosing schedule of, for example, once/week, twice/week, three times/week, four times/week, five times/week, six times/week, seven times/week, once every two weeks, once every three weeks, once every four weeks, once every five weeks, and the like, is available for the invention. The dosing schedules encompass dosing for a total period of time of, for example, one week, two weeks, three weeks, four weeks, five weeks, six weeks, two months, three months, four months, five months, six months, seven months, eight months, nine months, ten months, eleven months, and twelve months.

(117) Provided are cycles of the above dosing schedules. The cycle can be repeated about, e.g., every seven days; every 14 days; every 21 days; every 28 days; every 35 days; 42 days; every 49 days; every 56 days; every 63 days; every 70 days; and the like. An interval of non dosing can occur between a cycle, where the interval can be about, e.g., seven days; 14 days; 21 days; 28 days; 35 days; 42 days; 49 days; 56 days; 63 days; 70 days; and the like. In this context, the term about means plus or minus one day, plus or minus two days, plus or minus three days, plus or minus four days, plus or minus five days, plus or minus six days, or plus or minus seven days.

(118) The present invention encompasses a method of administering Listeria that is oral. Also provided is a method of administering Listeria that is intravenous. Moreover, what is provided is a method of administering Listeria that is oral, intramuscular, intravenous, intradermal and/or subcutaneous. The invention supplies a Listeria bacterium, or culture or suspension of Listeria bacteria, prepared by growing in a medium that is meat based, or that contains polypeptides derived from a meat or animal product. Also supplied by the present invention is a Listeria bacterium, or culture or suspension of Listeria bacteria, prepared by growing in a medium that does not contain meat or animal products, prepared by growing on a medium that contains vegetable polypeptides, prepared by growing on a medium that is not based on yeast products, or prepared by growing on a medium that contains yeast polypeptides.

(119) Methods for co-administration with an additional therapeutic agent are well known in the art (Hardman, et al. (eds.) (2001) Goodman and Gilman's The Pharmacological Basis of Therapeutics, 10th ed., McGraw-Hill, New York, N.Y.; Poole and Peterson (eds.) (2001) Pharmacotherapeutics for Advanced Practice: A Practical Approach, Lippincott, Williams & Wilkins, Phila., Pa.; Chabner and Longo (eds.) (2001) Cancer Chemotherapy and Biotherapy, Lippincott, Williams & Wilkins, Phila., Pa.).

(120) Additional agents which are beneficial to raising a cytolytic T cell response may be used as well. Such agents are termed herein carriers. These include, without limitation, B7 costimulatory molecule, interleukin-2, interferon-, GM-CSF, CTLA-4 antagonists, OX-40/OX-40 ligand, CD40/CD40 ligand, sargramostim, levamisol, vaccinia virus, Bacille Calmette-Guerin (BCG), liposomes, alum, Freund's complete or incomplete adjuvant, detoxified endotoxins, mineral oils, surface active substances such as lipolecithin, pluronic polyols, polyanions, peptides, and oil or hydrocarbon emulsions. Carriers for inducing a T cell immune response which preferentially stimulate a cytolytic T cell response versus an antibody response are preferred, although those that stimulate both types of response can be used as well. In cases where the agent is a polypeptide, the polypeptide itself or a polynucleotide encoding the polypeptide can be administered. The carrier can be a cell, such as an antigen presenting cell (APC) or a dendritic cell. Antigen presenting cells include such cell types as macrophages, dendritic cells and B cells. Other professional antigen-presenting cells include monocytes, marginal zone Kupffer cells, microglia, Langerhans' cells, interdigitating dendritic cells, follicular dendritic cells, and T cells. Facultative antigen-presenting cells can also be used. Examples of facultative antigen-presenting cells include astrocytes, follicular cells, endothelium and fibroblasts. The carrier can be a bacterial cell that is transformed to express the polypeptide or to deliver a polynucleoteide which is subsequently expressed in cells of the vaccinated individual. Adjuvants, such as aluminum hydroxide or aluminum phosphate, can be added to increase the ability of the vaccine to trigger, enhance, or prolong an immune response. Additional materials, such as cytokines, chemokines, and bacterial nucleic acid sequences, like CpG, a toll-like receptor (TLR) 9 agonist as well as additional agonists for TLR 2, TLR 4, TLR 5, TLR 7, TLR 8, TLR9, including lipoprotein, LPS, monophosphoryl lipid A, lipoteichoic acid, imiquimod, resiquimod, and other like immune modulators such as cyclic dinucleotide STING agonists including c-di-GMP, c-di-AMP, c-di-IMP, and c-AMP-GMP, used separately or in combination with the described compositions are also potential adjuvants. Other representative examples of adjuvants include the synthetic adjuvant QS-21 comprising a homogeneous saponin purified from the bark of Quillaja saponaria and Corynebacterium parvum (McCune et al., Cancer, 1979; 43:1619). It will be understood that the adjuvant is subject to optimization. In other words, the skilled artisan can engage in routine experimentation to determine the best adjuvant to use.

(121) An effective amount of a therapeutic agent is one that will decrease or ameliorate the symptoms normally by at least 10%, more normally by at least 20%, most normally by at least 30%, typically by at least 40%, more typically by at least 50%, most typically by at least 60%, often by at least 70%, more often by at least 80%, and most often by at least 90%, conventionally by at least 95%, more conventionally by at least 99%, and most conventionally by at least 99.9%.

(122) The reagents and methods of the present invention provide a vaccine comprising only one vaccination; or comprising a first vaccination; or comprising at least one booster vaccination; at least two booster vaccinations; or at least three booster vaccinations. Guidance in parameters for booster vaccinations is available. See, e.g., Marth (1997) Biologicals 25:199-203; Ramsay, et al. (1997) Immunol. Cell Biol. 75:382-388; Gherardi, et al. (2001) Histol. Histopathol. 16:655-667; Leroux-Roels, et al. (2001) ActA Clin. Belg. 56:209-219; Greiner, et al. (2002) Cancer Res. 62:6944-6951; Smith, et al. (2003) J. Med. Virol. 70:Suppl.1:S38-541; Sepulveda-Amor, et al. (2002) Vaccine 20:2790-2795).

(123) Formulations of therapeutic agents may be prepared for storage by mixing with physiologically acceptable carriers, excipients, or stabilizers in the form of, e.g., lyophilized powders, slurries, aqueous solutions or suspensions (see, e.g., Hardman, et al. (2001) Goodman and Gilman's The Pharmacological Basis of Therapeutics, McGraw-Hill, New York, N.Y.; Gennaro (2000) Remington: The Science and Practice of Pharmacy, Lippincott, Williams, and Wilkins, New York, N.Y.; Avis, et al. (eds.) (1993) Pharmaceutical Dosage Forms: Parenteral Medications, Marcel Dekker, NY; Lieberman, et al. (eds.) (1990) Pharmaceutical Dosage Forms: Tablets, Marcel Dekker, NY; Lieberman, et al. (eds.) (1990) Pharmaceutical Dosage Forms: Disperse Systems, Marcel Dekker, NY; Weiner and Kotkoskie (2000) Excipient Toxicity and Safety, Marcel Dekker, Inc., New York, N.Y.).

EXAMPLES

(124) The following examples serve to illustrate the present invention. These examples are in no way intended to limit the scope of the invention.

Example 1

(125) FIG. 2 depicts various modifications to the sequences of ActA and LLO tested in the following examples.

(126) With regard to the modifiedActA sequence, the parent ActA sequence was truncated at residue 100, and was extended by two residues added by inclusion of a BamH1 site, shown in the FIG as residues G101 and S102. Modifications to the PEST sequence involved the deletions shown in the figure, and an optional substitution of the hydrophobic motif LIAML (SEQ ID NO: 8) to QDNKR (SEQ ID NO: 9) is also depicted. With regard to the modified LLO sequence, the parent LLO sequence was truncated at residue 441. Modifications to the PEST sequence involved the deletions shown in the figure. In each case, the depicted signal peptide/secretion chaperone elements are functionally linked in-frame to selected antigen sequences.

Example 2

(127) FIG. 3 depicts the location of a PEST motif in the LLO sequence, scored using the epestfind algorithm. A single motif having a score of +4.72 was modified as noted above in Example 1. Also shown in the top of the figure is the hydropathy plot. A number of hydrophiobic motifs are shown (peaks rising above the sequence schematic) which may be modified as described herein.

(128) Similarly, FIG. 4 depicts four PEST motifs in the ActA sequence, scored using the epestfind algorithm. The first of these motifs has a score of +10.27, and was modified as noted above in Example 1. The remaining PEST motifs were deleted by truncating the ActA sequence at residue 100. Also shown in the top of the figure is the hydropathy plot. The hydrophobic motif LIAML (SEQ ID NO: 8) is apparent as the peak rising above the sequence schematic in ActAN100.

Example 3

(129) FIG. 5 shows the results of a B3Z T-cell activation assay following immunization with the constructs noted in the figure. In each antigenic construct, HIVgag was expreseed fused to SIINFEKL (SL8) epitope tag (SEQ ID NO: 20) and inserted into the genome of the host Lm actA inlB vaccine strain. DC2.4 cells were infected with the selected strains, and incubated with the OVA.sub.257-264-specific T cell hybridoma, B3Z. Presentation of SIINFEKL epitope (SEQ ID NO: 20) on H-2 K.sup.b class I molecules was assessed by measuring -galactosidase expression using a chromogenic substrate. As noted in the figure, deletion of the PEST sequence had a positive or neutral effect on the assay results.

Example 4

(130) FIG. 6 shows responses from the LL0441 (A) and ActAN100 vaccine strains. BALB/c mice were vaccinated once intravenously with 510.sup.6 colony forming units (cfu) with indicated vaccine strain containing an N-terminal fusion partner that contained a PEST motif or were deleted of the PEST motif, in order to directly compare the immunogenicity of these isogenic strains that differed only in the composition of the N-terminal LLO or ActA fusion partner. At the peak of the Lm vaccine response at 7 days post vaccination, the spleens of mice were harvested and the HIV-Gag CD8 T cell responses specific for the H2 K.sup.d-restricted HIV Gag.sub.197-205 epitope AMQMLKETI (SEQ ID NO: 21) by IFN- ELISpot assay performed with lymphocytes isolated from whole mouse blood using Lympholyte-Mammal (Cedarlane Labs, Burlington, N.C.) and a murine IFN- ELISpot pair (BD Biosciences, San Jose, Calif.). At the termination of the experiments, ELISpot assays were performed on splenocytes. 210.sup.5 cells/well were incubated with the appropriate peptide overnight at 37 C. in anti-murine IFN- coated ELISpot plate (Millipore, Billerica, Mass.). Cells were incubated with no peptide as a negative control. Murine ELISpots were developed using alkaline phosphatase detection reagents (Invitrogen, Carlsbad, Calif.) and scanned and quantified using Immunospot plate reader and software (CTL Ltd, Cleveland, Ohio).

(131) Mice vaccinated with Lm vaccine strains containing PEST LLO.sub.441 N-terminal secretion/chaperone elements generated HIV Gag-specific CD8 T cell responses that were higher than mice vaccinated with isogenic Lm vaccine strains containing LLO.sub.441 N-terminal secretion/chaperone elements with PEST motifs. Mice vaccinated with Lm vaccine strains containing PEST ActAN100 N-terminal secretion/chaperone elements generated HIV Gag-specific CD8 T cell responses that were at least equivalent to mice vaccinated with isogenic Lm vaccine strains containing ActAN100 N-terminal secretion/chaperone elements with PEST mot

Example 5

(132) FIG. 7 depicts several alternative substitutions and deletions for use in deleting the PEST motif, using ActA as a model system. Substitution of any of five P, E, S and T amino acids (E50, P52, S53, E54, T57) in the ActAN100 sequence to a positively charged residue (R, K, or H) was sufficient to abrogate a positive score using the pestfinder algorithm.

(133) FIG. 8. depicts in more detail the result of modifying the hydrophobic motif LIAML (SEQ ID NO: 8) on the resulting hydropathy plot. Nonconservative substitution to QDNKR (SEQ ID NO: 9) was sufficient to remove the hydrophobic nature of this sequence.

Example 6

(134) ActA-N100 (MGLNRFMRAM MVVFITANCI TINPDIIFAA TDSEDSSLNT DEWEEEKTE QPSEVNTGPR YETAREVSSR DIEELEKSNK VKNTNKADLI AMLKAKAEKG gs (SEQ ID NO: 22)) and a modified form thereof in which the PEST motif has been deleted and containing the nonconservative QDNKR (SEQ ID NO: 9) substitution (MGLNRFMRAM MVVFITANCI TINPDIIFAA TDSEDSSLNT DEWEEEYETA REVSSRDIEE LEKSNKVKNT NKADQDNKRK AKAEKg1 (SEQ ID NO: 23); referred to herein as ActA-N100*) were used to prepare a fusion construct with human mesothelin residues 35-621 (the lowercase residues above were included between the ActA sequence and the mesothlin sequence as a result of the restriction site used to prepare the in-frame fusion). The construct was integrated at the chromosomal tRNA locus of Listeria monocytogenes actAinlB. Balb/c mice were challenged with 210.sup.5 CT-26 tumor cells that express human mesothelin on Day 0. Mice were therapeutically vaccinated on day 4 and day 17 with Listeria vaccine strains. The results of this experiment are depicted in FIG. 9 as percent survival of the vaccinated animals. As shown, here was no difference in efficacy between ActA-N100 vs ActA-N100* based vaccines.

Example 7

(135) Similar Listeria monocytogenes actAinlB to those of Example 6 were prepared in which the mesothelin antigenic sequence was replaced by 5 copies of an EGFRvIII.sub.20-40 sequence and NY-ESO-1.sub.1-165. The DNA and protein sequences used in the antigenic construct are as follows (lowercase, not underlined: actA promoter; lowercase, underlined: restriction sites; uppercase, bold: ActAN100* sequence; uppercase underlined: EGFRvIII20-405; uppercase, italic: NY-ESO-1(1-165) (each EGFRvIII.sub.20-40 repeat is double underlined in the peptide sequence, and the leading Val codon is used to encode Met):

(136) TABLE-US-00012 ggtaccgggaagcagttggggttaactgattaacaaatgttagagaaaaattaattctccaagt gatattcttaaaataattcatgaatattttttcttatattagctaattaagaagataattaact gctaatccaatttttaacggaataaattagtgaaaatgaaggccgaattttccttgttctaaaa aggttgtattagcgtatcacgaggagggagtataaGTGGGATTAAATAGATTTATGCGTGCGAT GATGGTAGTTTTCATTACTGCCAACTGCATTACGATTAACCCCGACATAATATTTGCAGCGACA GATAGCGAAGATTCCAGTCTAAACACAGATGAATGGGAAGAAGAATACGAAACTGCACGTGAAG TAAGTTCACGTGATATTGAGGAACTAGAAAAATCGAATAAAGTGAAAAATACGAACAAAGCAGA CCAAGATAATAAACGTAAAGCAAAAGCAGAGAAAGGTggatccGCAAGCAAAGTATTGCCAGCT AGTCGTGCATTAGAGGAGAAAAAGGGGAATTACGTGGTGACGGATCATGGATCGTGTGCCGATG GCTCAGTAAAGACTAGTGCGAGCAAAGTGGCCCCTGCATCACGAGCACTTGAAGAGAAAAAAGG AAACTATGTTGTGACCGATCATGGTAGCTGCGGAGATGGTTCAATTAAATTATCAAAAGTCTTA CCAGCATCTAGAGCTTTAGAGGAAAAGAAGGGTAACTATGTCGTAACAGATCATGGAAGTTGTG CTGACGGAAGTGTTAAAGCGTCGAAAGTAGCTCCAGCTTCTCGCGCATTAGAAGAAAAGAAAGG CAATTATGTTGTAACAGACCATGGTAGTTGTGGTGATGGCTCGATCAAATTGTCAAAAGTTCTA CCGGCTTCTCGTGCGCTAGAAGAGAAGAAAGGAAATTACGTAGTTACAGACCACGGCTCTTGCG CGGATGGITCCGTTAAAcaattgATGCAAGCTGAAGGAAGAGGAACTGGGGGTAGTACAGGAGA TGCAGATGGCCCTGGCGGACCGGGTATTCCTGATGGACCAGGGGGTAATGCGGGTGGGCCAGGC GAAGCAGGTGCTACAGGCGGTAGAGGGCCACGAGGGGCAGGAGCAGCGAGAGCTTCTGGACCAG GTGGTGGCGCTCCACGCGGTCCGCATGGTGGTGCAGCGTCCGGCTTAAACGGTTGCTGTCGCTG TGGAGCTAGAGGACCAGAATCACGTCTTTTAGAGTTCTATTTGGCCATGCCGTTTGCTACGCCT ATGGAAGCAGAACTAGCACGTCGTAGCTTAGCGCAAGATGCACCTCCATTACCAGTTCCAGGCG TGTTGTTAAAGGAGTTCACGGTCAGTGGTAACATATTGACAATTCGCCTTACTGCGGCTGACCA CCGTCAATTACAGCTTAGCATTTCATCTTGTTTACAACAACTTTCGTTACTTATGTGGATCACC CAATGCTAAggcggccgc(SEQIDNO:24) MGLNRFMRAMMVVFITANCITINPDIIFAATDSEDSSLNTDEWEEEYETAREVSSRDIEE LEKSNKVKNTNKADQDNKRKAKAEKGgsASKVLPASRALEEKKGNYVVTDHGSCADGSVK TSASKVAPASRALEEKKGNYVVTDHGSCGDGSIKLSKVLPASRALEEKKGNYVVTDHGSC ADGSVKASKVAPASRALEEKKGNYVVTDHGSCGDGSIKLSKVLPASRALEEKKGNYVVTD HGSCADGSVKqlMQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGA GAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRS LAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQC (SEQIDNO:25)

(137) The fusion construct is depicted schematically in FIG. 10, left panel. The mouse dendritic cell line DC2.4 was infected with Lm actA/inlB (FIG. 10, right panel, lane 1), BH3763 (EGFRvIII.sub.20-40/NY-ESO-1.sub.1-165), or BH3816 (clinical strain with EGFRvIII.sub.20-40/NY-ESO-1.sub.1-165 in which selection markers have been deleted). Seven hours later, cells were washed, lysed, run on SDS-PAGE, and transferred to nitrocellulose. The Western blot was probed with a rabbit polyclonal antibody raised to the amino terminus of the ActA protein and expression level was normalized to the Listeria P60 protein, which correlates with bacterial counts in infected cells. High levels of the fusion construct were expressed by both the research and clinical strains.

(138) Female B10.Br mice (n=5 per group) were vaccinated intravenously with varying doses of BH3816 (Lm actAinlB EGFRvIII-NY-ESO-1). EGFR-specific T cell responses were determined by intracellular cytokine staining, and are depicted in FIG. 11 as (A) percent IFN- positive EGFRvIII-specific CD8+ T cells; and (B) absolute number of IFN- positive EGFRvIII-specific CD8+ T cells per spleen. Robust EGFR T cell responses were observed. As depicted in FIG. 12, NY-ESO-1-specific CD8+ T cell responses were also observed, as determined by intracellular cytokine staining 7 days after prime vaccination using the defined H-2.sup.d restricted epitope ARGPESRLL (SEQ ID NO: 26).

(139) One skilled in the art readily appreciates that the present invention is well adapted to carry out the objects and obtain the ends and advantages mentioned, as well as those inherent therein. The examples provided herein are representative of preferred embodiments, are exemplary, and are not intended as limitations on the scope of the invention.

(140) It will be readily apparent to a person skilled in the art that varying substitutions and modifications may be made to the invention disclosed herein without departing from the scope and spirit of the invention.

(141) All patents and publications mentioned in the specification are indicative of the levels of those of ordinary skill in the art to which the invention pertains. All patents and publications are herein incorporated by reference to the same extent as if each individual publication was specifically and individually indicated to be incorporated by reference.

(142) The invention illustratively described herein suitably may be practiced in the absence of any element or elements, limitation or limitations which is not specifically disclosed herein. Thus, for example, in each instance herein any of the terms comprising, consisting essentially of and consisting of may be replaced with either of the other two terms. The terms and expressions which have been employed are used as terms of description and not of limitation, and there is no intention that in the use of such terms and expressions of excluding any equivalents of the features shown and described or portions thereof, but it is recognized that various modifications are possible within the scope of the invention claimed. Thus, it should be understood that although the present invention has been specifically disclosed by preferred embodiments and optional features, modification and variation of the concepts herein disclosed may be resorted to by those skilled in the art, and that such modifications and variations are considered to be within the scope of this invention as defined by the appended claims.

(143) Other embodiments are set forth within the following claims.