EXPRESSION OF POLYPEPTIDES INVOLVED IN LYSINE DECARBOXYLATION, AND METHODS AND APPLICATIONS THEREOF
20170145403 ยท 2017-05-25
Assignee
- CATHAY R&D CENTER CO., LTD. (New District, Shanghai, CN)
- CATHAY INDUSTRIAL BIOTECH LTD. (George Town, Grand Cayman, KY)
Inventors
- Howard CHOU (New District, Shanghai, CN)
- Naiqiang LI (New District, Shanghai, CN)
- Xiucai LIU (New District, Shanghai, CN)
Cpc classification
International classification
Abstract
The expression plasmid vectors comprise a polynucleotide sequence encoding Ldc2 polypeptide, a fragment, and/or a mutant. A backbone plasmid is capable of autonomous replication in a host cell. The host cell is not a P. aeruginosa cell. Transformants are transformed with expression plasmid vector. The transformants are not P. aeruginosa. Mutant host cells comprise a polynucleotide sequence encoding Ldc2 polypeptide, a fragment and/or a mutant that has been integrated into the host cell chromosome. A polypeptide, a fragment and/or a mutant comprise Ldc2. A non-naturally occurring polynucleotide, and/or a mutant encodes polypeptide comprising Ldc2. Biobased cadaverine is produced using the transformants and the biobased cadaverine is prepared by the method. Polyamides are formed using the biobased cadaverine and compositions.
Claims
1-35. (canceled)
36. A product, selected from the group consisting of: I) a transformant comprising an expression plasmid vector in a host cell that is not a Pseudomonas aeruginosa (P. aeruginosa) cell, the expression plasmid vector comprising: a seventh polynucleotide encoding one or more seventh polypeptides comprising one or more eighth polypeptide selected from the group consisting of the amino acid sequence of SEQ ID NO: 4 (Ldc2), fragments thereof, and mutants thereof; and a backbone plasmid capable of autonomous replication in the host cell; II) an expression plasmid vector comprising: a seventh polynucleotide encoding a seventh polypeptide comprising one or more eighth polypeptides selected from the group consisting of the amino acid sequence of SEQ ID NO: 4 (Ldc2), fragments of Ldc2, and mutants of Ldc2; and a backbone plasmid capable of autonomous replication in a host cell, wherein the host cell is not a P. aeruginosa cell; III) a first mutant host cell comprising a seventh polynucleotide integrated into a chromosome of the host cell, wherein the seventh polynucleotide encodes one or more seventh polypeptides comprising one or more eighth polypeptides selected from the group consisting of the amino acid sequence of SEQ ID NO: 4 (Ldc2), fragments of Ldc2, and mutants of Ldc2; IV) a polypeptide comprising a mutant of the amino acid sequence of SEQ ID NO: 4; V) a non-naturally occurring polynucleotide encoding a polypeptide of IV) the polypeptide; and VI) a non-naturally occurring polynucleotide comprising the polynucleotide sequence of SEQ ID NO: 17, a fragment thereof, or a mutant thereof.
37. A product of claim 36, which is I) the transformant, wherein the seventh polynucleotide sequence comprises a polynucleotide sequence of SEQ ID NO: 3 (ldc2), a fragment thereof, or a mutant thereof.
38. A product of claim 36, which is I) the transformant, wherein the mutants of Ldc2 are selected from the group consisting of the amino acid sequences of SEQ ID NO: 6 (Ldc2 S111C), SEQ ID NO: 11 (Ldc2 N262T), SEQ ID NO: 12 (Ldc2 K265N), SEQ ID NO: 13 (Ldc2 S111C/N262T), SEQ ID NO: 14 (Ldc2 S111C/K265N), SEQ ID NO: 15 (Ldc2 N262T/K265N), and SEQ ID NO: 16 (Ldc2 S111C/N262T/K265N).
39. A product of claim 36, which is I) the transformant, wherein the mutants of Ldc2 comprise one or more mutations selected from the group consisting of a mutation at amino acid position 111 to X, a mutation at amino acid position 262 to X, and a mutation at amino acid position 265 to X; X, X, and X are independently selected from the group consisting of alanine, arginine, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine, and valine; and with the proviso that X is not serine, X is not asparagine, and X is not lysine.
40. A product of claim 36, which is I) the transformant, wherein the host cell is an Escherichia coli (E. coli) cell.
41. A product of claim 40, wherein the seventh polynucleotide sequence has been codon optimized for optimal polypeptide expression in the E. coli cell.
42. A product of claim 40, wherein the backbone plasmid is an E. coli expression plasmid vector.
43. A product of claim 42, wherein the backbone plasmid is selected from the group consisting of pUC18, pUC19, pBR322, pACYC,pET, pSC101, and any derived plasmids thereof.
44. A product of claim 42, wherein the expression plasmid vector further comprises a promoter polynucleotide sequence comprising the polynucleotide sequence of SEQ ID NO: 5, which is positioned upstream from the polynucleotide sequence.
45. A product of claim 36, which is I) the transformant, wherein the host cell is a Hafnia alvei (H. alvei) cell.
46. A product of claim 36, which is II) the expression plasmid vector, wherein the mutants of Ldc2 are selected from the group consisting of the amino acid sequences of SEQ ID NO: 6 (Ldc2 S111C), SEQ ID NO: 11 (Ldc2 N262T), SEQ ID NO: 12 (Ldc2 K265N), SEQ ID NO: 13 (Ldc2 S111C/N262T), SEQ ID NO: 14 (Ldc2 S111C/K265N), SEQ ID NO: 15 (Ldc2 N262T/K265N), and SEQ ID NO: 16 (Ldc2 S111C/N262T/K265N).
47. A product of claim 46, wherein the mutants of Ldc2 are amino acid sequences of SEQ ID NO: 4 further comprising one or more mutations selected from the group consisting of a mutation at amino acid position 111 to X, a mutation at amino acid position 262 to X, and a mutation at amino acid position 265 to X; X, X, and X are independently selected from the group consisting of alanine, arginine, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine, and valine; and with the proviso that X is not serine, X is not asparagine, and X is not lysine.
48. A product of claim 36, which is II) the expression plasmid vector, wherein the host cell is an E. coli cell.
49. A product of claim 48, wherein the seventh polynucleotide sequence is a codon optimized polynucleotide for optimal polypeptide expression in the E. coli cell.
50. A product of claim 48, wherein the backbone plasmid is an E. coli expression plasmid vector.
51. A product of claim 50, wherein the backbone plasmid is selected from the group consisting of pUC18, pUC19, pBR322, pACYC, pET, pSC101, and any derived plasmids thereof.
52. A product of claim 51, wherein the expression plasmid vector further comprises a promoter polynucleotide sequence comprising the polynucleotide sequence of SEQ ID NO: 5, which is positioned upstream from the polynucleotide sequence.
53. A product of claim 36, which is II) the expression plasmid vector, wherein the host cell is a H. alvei cell.
54. A product of claim 36, which is III) the first mutant host cell, wherein the host cell is an E. coli cell.
55. A product of claim 36, which is III) the first mutant host cell, wherein the mutants of Ldc2 are selected from the group consisting of amino acid sequences of SEQ ID NO: 6 (Ldc2 S111C), SEQ ID NO: 11 (Ldc2 N262T), SEQ ID NO: 12 (Ldc2 K265N), SEQ ID NO: 13 (Ldc2 S111C/N262T), SEQ ID NO: 14 (Ldc2 S111C/K265N), SEQ ID NO: 15 (Ldc2 N262T/K265N), and SEQ ID NO: 16 (Ldc2 S111C/N262T/K265N).
56. A product of claim 36, which is III) the first mutant host cell, wherein the mutants of Ldc2 are amino acid sequences of SEQ ID NO: 4 further comprising one or more mutations selected from the group consisting of a mutation at amino acid position 111 to X, a mutation at amino acid position 262 to X, and a mutation at amino acid position 265 to X; X, X, and X are independently selected from the group consisting of alanine, arginine, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine, and valine; and with the proviso that X is not serine, X is not asparagine, and X is not lysine.
57. A product of claim 36, which is IV) the polypeptide, wherein the mutant of Ldc2 is the amino acid sequence of SEQ ID NO: 4 further comprising one or more mutations selected from the group consisting of a mutation at amino acid position 111 to X, a mutation at amino acid position 262 to X, and a mutation at amino acid position 265 to X; X, X, and X are independently selected from the group consisting of alanine, arginine, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine, and valine; and with the proviso that X is not serine, X is not asparagine, and X is not lysine.
58. A product of claim 57, wherein the mutant of Ldc2 is selected from the group consisting of amino acid sequences of SEQ ID NO: 6 (Ldc2 S111C), SEQ ID NO: 11 (Ldc2 N262T), SEQ ID NO: 12 (Ldc2 K265N), SEQ ID NO: 13 (Ldc2 S111C/N262T), SEQ ID NO: 14 (Ldc2 S111C/K265N), SEQ ID NO: 15 (Ldc2 N262T/K265N), and SEQ ID NO: 16 (Ldc2 S111C/N262T/K265N).
59. A product of claim 36, which is V) the non-naturally occurring polynucleotide, comprising a polynucleotide sequence encoding Ldc2 further comprising one or more mutations selected from the group consisting of a mutation at nucleotide position 331, a mutation at nucleotide position 332, a mutation at nucleotide position 333, a mutation at nucleotide position 784, a mutation at nucleotide position 785, a mutation at nucleotide position 786, a mutation at nucleotide position 793, a mutation at nucleotide position 794, and a mutation at nucleotide position 795.
60. A product of claim 59, wherein the mutation at the nucleotide position 332 is mutated to G, the mutation at the nucleotide position 785 is mutated to a C, and the mutation at the nucleotide position 795 is mutated to a T or C.
61. A product of claim 59, wherein the polynucleotide sequence encoding Ldc2 is the polynucleotide sequence of SEQ ID NO: 3 or a codon-optimized polynucleotide thereof.
62. A product of claim 61, wherein the codon-optimized polynucleotide is the polynucleotide sequence of SEQ ID NO: 17.
63. A product of claim 59, selected from the group consisting of SEQ ID NO: 18 (ldc2-co1 C332G), SEQ ID NO: 19 (ldc2-co1 A785C), SEQ ID NO: 20 (ldc2-co1 A795C), SEQ ID NO: 21 (ldc2-co1 C332G/A785C), SEQ ID NO: 22 (ldc2-co1 C332G/A795C), SEQ ID NO: 23 (ldc2-co1 A785C/A795C), and SEQ ID NO: 24 (ldc2-co1 C332G/A785C/A795C).
64. A product of claim 36, which is V) the non-naturally occurring polynucleotide, wherein the polynucleotide sequence has been codon optimized for optimal polypeptide expression in an E. coli cell.
65. A product of claim 36, which is VI) the non-naturally occurring polynucleotide, wherein the polynucleotide sequence has been codon optimized for optimal polypeptide expression in an E. coli cell.
66. A method for producing a polypeptide comprising the amino acid sequence of SEQ ID NO: 4 (Ldc2), a fragment thereof, or a mutant thereof, comprising: obtaining the first mutant host cell of claim 36 III) and/or the transformant of claim 36 I); culturing the first mutant host cell under conditions effective for the expression of the polypeptide; and harvesting the polypeptide.
67. A method for producing cadaverine (1,5-pentanediamine) comprising: 1a) cultivating the first mutant host cell of claim 36 III) and/or the transformant of claim 36 I); 1b) producing cadaverine using the culture obtained from step 1a to decarboxylate lysine; and 1c) extracting and purifying cadaverine using the culture obtained from step 1b.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
DETAILED DESCRIPTION OF THE INVENTION
[0021] The following description provides specific details for a thorough understanding of, and enabling description for, embodiments of the disclosure. However, one skilled in the art will understand that the disclosure may be practiced without these details. In other instances, well-known structures and functions have not been shown or described in detail to avoid unnecessarily obscuring the description of the embodiments of the disclosure.
[0022] P. aeruginosa Ldc2 (Accession: WP_014603046.1) was characterized as a beta-elimination lyase polypeptide in a BLAST search. P. aeruginosa Ldc2 has low sequence similarity with the known E. coli lysine decarboxylases, CadA and LdcC (39.44% and 38.71% sequence identity, respectively). The BLAST search results did not indicate that Ldc2 was a lysine decarboxylase.
[0023] Functional heterologous expression of Pseudomonas proteins in E. coli is challenging partially due to low gene expression and insoluble proteins (West, 1988). For example, heterologous expression of a previously characterized P. aeruginosa lysine decarboxylase, Ldc1 (SEQ ID NO: 2, Accession: EME94559.1), in an E. coli strain did not result in an increased cadaverine production, even though its BLAST result indicated that it was a putative member of the lysine decarboxylase family (the corresponding P. aeruginosa gene is ldc1 (SEQ ID NO: 1)).
[0024] As disclosed herein, it has unexpectedly been found that heterologous expression of P. aeruginosa Ldc2 has resulted in unexpectedly high yield cadaverine production, with E. coli expressing Ldc2 exhibiting higher cadaverine yields than E. coli expressing the E. coli lysine decarboxylase. CadA (see, e.g., Example 5). Expressions of P. aeruginosa Ldc2 in other host cells (e.g., Hafnia alvei (H. alvei)) have also resulted in an unexpectedly higher yield of cadaverine production compared to expression of E. coli CadA (see, e.g., Example 5). Furthermore, it has unexpectedly been found that expression of an Ldc2 mutant polypeptide disclosed herein has resulted in high cadaverine production.
[0025] One aspect of the invention relates to a polypeptide comprising, consisting of, or consisting essentially of one or more mutants of Ldc2. A mutant of Ldc2 may include deletion, substitution, addition, and/or insertion of one or more amino acids to the amino acid sequence of SEQ ID NO: 4, while the mutant of Ldc2 provides substantially the same function as Ldc2 (i.e., the mutant of Ldc2 has about 80% or higher lysine decarboxylase activity compared to that of Ldc2; about 90% or higher lysine decarboxylase activity compared to that of Ldc2; about 95% or higher lysine decarboxylase activity compared to that of Ldc2; about 97% or higher lysine decarboxylase activity compared to that of Ldc2; about 99% or higher lysine decarboxylase activity compared to that of Ldc2; or about 100% or higher lysine decarboxylase activity compared to that of Ldc2.)
[0026] Examples of mutants of Ldc2 include, without limitation, SEQ ID NO: 6 (Ldc2 S111C), SEQ ID NO: 11 (Ldc2 N262T), SEQ ID NO: 12 (Ldc2 K265N), SEQ ID NO: 13 (Ldc2 S111C/N262T), SEQ ID NO: 14 (Ldc2 S111C/K265N), SEQ ID NO: 15 (Ldc2 N262T/K265N), SEQ ID NO: 16 (Ldc2 S111C/N262T/K265N), homologous polypeptides of Ldc2, homologous polypeptides of Ldc2 S111C (e.g. Ldc2 S111X), homologous polypeptides of Ldc2 N262T (e.g. Ldc2 N262X), homologous polypeptides of Ldc2 K265N (e.g. Ldc2 K265X), homologous polypeptides of Ldc2 S111C/N262T (e.g. Ldc2 S111X/N262X), homologous polypeptides of Ldc2 S111C/K265N (e.g. Ldc2 S111X/K265X), homologous polypeptides of Ldc2 N262T/K265N (e.g. Ldc2 N262X/K265X), and homologous polypeptides of Ldc2 S111C/N262T/K265N (e.g. Ldc2 S111X/N262X/K265X). X is any amino acid that is not serine, X is any amino acid that is not asparagine, and X is any amino acid that is not lysine. As used herein, a homologous polypeptide is at least about 90%, at least about 95%, at least about 97%, at least about 98%, or at least about 99% homologous with the polypeptide. When a Ldc2 mutant has multiple mutations, each mutation may be the same or different.
[0027] As used herein, a polypeptide comprising a specific polypeptide sequence may include fragments, and/or mutants of the specific polypeptide sequence, while still providing substantially the same function as the whole original unmutated specific polypeptide sequence. A fragment of a polypeptide means a part of the polypeptide that provides substantially the same function as the whole polypeptide. Examples of mutants of a specific polypeptide sequence include deletions, substitutions, additions, and/or insertions of one or more amino acids to the specific polypeptide sequence. For example, a fragment or mutant of Ldc2 possesses substantially the same function of the Ldc2 polypeptide (e.g. lysine decarboxylase activity).
[0028] Another aspect of the invention relates to a first polynucleotide encoding one or more first polypeptides comprising, consisting of, or consisting essentially of one or more second polypeptides selected from the group consisting of Ldc2, fragments of Ldc2, and mutants of Ldc2; wherein the first polynucleotide comprises one or more second polynucleotides encoding the one or more second polypeptides, respectively; when there are a plurality of the first polypeptides, each first polypeptides may be the same or different; when there are a plurality of the second polypeptides, each second polypeptide may be the same or different; when there are a plurality of the second polynucleotides, each second polynucleotide may be the same or different; the one or more first polypeptides may be expressed individually or as a fusion protein; and when a second polypeptide is Ldc2, at least one of the corresponding second polynucleotides encoding the second polypeptide comprises, consists of, or consists essentially of a mutant ldc2. Examples of mutants of ldc2 encode Ldc2, and may be codon optimized ldc2 (e.g., ldc2-col (SEQ ID NO: 17)).
[0029] Mutants of Ldc2 are the same as described supra. For example, without limitation, mutants of Ldc2 comprise, consist, or consist essentially of Ldc2 with mutations at one or more amino acid positions selected from the group consisting of 111, 262, and 265 (as described supra, e.g. SEQ ID NO: 6 (Ldc2 S111C), SEQ ID NO: 11 (Ldc2 N262T), SEQ ID NO: 12 (Ldc2 K265N), SEQ ID NO: 13 (Ldc2 S111C/N262T), SEQ ID NO: 14 (Ldc2 S111C/K265N), SEQ ID NO: 15 (Ldc2 N262T/K265N), SEQ ID NO: 16 (Ldc2 S111C/N262T/K265N), Ldc2 S111X, Ldc2 N262X, Ldc2 K265X, Ldc2 S111X/N262X, Ldc2 S111X/K265X, Ldc2 N262X/K265X, and Ldc2 S111X/N262X/K265X).
[0030] In one embodiment, the second polypeptides are mutants of Ldc2, and the corresponding second polynucleotides encoding the second polypeptides are polynucleotides encoding Ldc2 (e.g. ldc2 (SEQ ID NO: 3)), a codon optimized ldc2 (e.g. ldc2-col, SEQ ID NO: 17)) containing one or more suitable nucleotide mutations selected from the group consisting of a mutation at nucleotide position 331, a mutation at nucleotide position 332, a mutation at nucleotide position 333, a mutation at nucleotide position 784, a mutation at nucleotide position 785, a mutation at nucleotide position 786, a mutation at nucleotide position 793, a mutation at nucleotide position 794, and a mutation at nucleotide position 795.
[0031] In another embodiment, the second polypeptides are mutants of Ldc2, and the corresponding second polynucleotides encoding the second polypeptides are polynucleotides encoding Ldc2 (e.g. ldc2 (SEQ ID NO: 3), a codon optimized ldc2 (e.g. ldc2-co1, SEQ ID NO: 17)) containing one or more suitable nucleotide mutations selected from the group consisting of a mutation at nucleotide position 332, a mutation at nucleotide position 785, and a mutation at nucleotide position 795. In certain examples, without limitation, the nucleotide at position 332 may be mutated to G, the nucleotide at position 785 may be mutated to a C, and the nucleotide at position 795 may be mutated to a T or C.
[0032] In another embodiment, the second polypeptides are Ldc2, and the corresponding second polynucleotides are polynucleotides that are not ldc2 (SEQ ID NO: 3) and encode Ldc2. Examples of such second polynucleotides include, without limitation, codon optimized ldc2 (e.g. ldc2-col, SEQ ID NO: 17).
[0033] In certain embodiments, examples of the second polynucleotides include, without limitation, SEQ ID NO: 17 (ldc2-col), SEQ ID NO: 18 (ldc2-col C332G), SEQ ID NO: 19 (ldc2-col A785C), SEQ ID NO: 20 (ldc2-col A795C), SEQ ID NO: 21 (ldc2-co1 C332G/A785C), SEQ ID NO: 22 (ldc2-col C332G/A795C), SEQ ID NO: 23 (ldc2-co1 A785C/A795C), and SEQ ID NO: 24 (ldc2-col C332G/A785C/A795C).
[0034] In certain embodiments, the first and second polynucleotides may be recombinant or non-naturally occurring polynucleotides. In certain embodiments, the first and second polynucleotides may be cDNAs. In certain embodiments, the first and second polynucleotides are obtained by codon optimization for optimal polypeptide expression in a particular microorganism (e.g., E. coli, H. alvei, or P. aeruginosa).
[0035] Nucleotide sequences, polynucleotides, and DNA molecules as used herein are not limited to the functional region, and may include at least one of an expression suppression region, a coding region, a leader sequence, an exon, an intron, and an expression cassette (see, e.g. Papadakis et al., Promoters and Control Elements: Designing Expression Cassettes for Gene Therapy, Current Gene Therapy (2004), 4, 89-113). Further, nucleotide sequences or polynucleotides may include double strand DNA or single strand DNA (i.e., a sense chain and an antisense chain constituting the double strand DNA), or RNA. A polynucleotide containing a specific polynucleotides sequence may include fragments, and/or mutants of the specific polynucleotides sequence. A fragment of a polynucleotide means a part of the polynucleotide that encodes a polypeptide which provides substantially the same function as the polypeptide encoded by the whole polynucleotide. Examples of mutants of a specific polynucleotides sequence include naturally occurring allelic mutants; artificial mutants; and polynucleotides sequences obtained by deletion, substitution, addition, and/or insertion of one or more nucleotides to the specific polynucleotides sequence. It should be understood that such fragments, and/or mutants of a specific polynucleotides sequence encode polypeptides having substantially the same function as the polypeptide encoded by the original, specific polynucleotides sequence. For example, a fragment and/or mutant of ldc2 encodes a polypeptide that possesses substantially the same function of Ldc2 (e.g. lysine decarboxylase activity).
[0036] Another aspect of the invention relates to a third polynucleotide encoding one or more third polypeptides comprising, consisting of, or consisting essentially of one or more fourth polypeptides selected from the group consisting of Ldc2, fragments of Ldc2, and mutants of Ldc2; wherein the third polynucleotide comprises one or more fourth polynucleotides encoding the one or more fourth polypeptides, respectively; when there are a plurality of the third polypeptides, each third polypeptides may be the same or different; when there are a plurality of the fourth polypeptides, each fourth polypeptide may be the same or different; when there are a plurality of the fourth polynucleotides, each fourth polynucleotide may be the same or different; and the one or more third polypeptides may be expressed individually or as a fusion protein. In certain embodiments, the third and the fourth polynucleotides are recombinant or non-naturally occurring polynucleotides. In certain embodiments, the third and the fourth polynucleotides are cDNAs. In certain embodiments, the third and the fourth polynucleotides may be obtained by codon optimization for optimal polypeptide expression in a particular microorganism (e.g., E. coli, H. alvei, or P. aeruginosa). An example of a codon optimized ldc2 encoding Ldc2 is SEQ ID NO: 17 (ldc2-co1). In certain embodiments, the third polynucleotide comprises, consists of, or consists essentially of P. aeruginosa ldc2 (SEQ ID NO: 3), a fragment thereof, and/or a mutant thereof. When the fourth polypeptides are mutants of Ldc2, they are the same as described supra; and the corresponding fourth polynucleotides are the same as described supra. Examples of the fourth polynucleotides further include, without limitation, polynucleotides encoding Ldc2 (e.g. ldc2, and mutants thereof, such as SEQ ID NO: 17 (ldc2-col)).
[0037] Codon optimization is a technique that may be used to maximize the protein expression in an organism by increasing the translational efficiency of the gene of interest. Different organisms often show particular preferences for one of the several codons that encode the same amino acid due to mutational biases and natural selection. For example, in fast growing microorganisms such as E. coli, optimal codons reflect the composition of their respective genomic tRNA pool. Therefore, the codons of low frequency of an amino acid may be replaced with codons for the same amino acid but of high frequency in the fast growing microorganism. Accordingly, the expression of the optimized DNA sequence is improved in the fast growing microorganism. See, e.g. http://www.guptalab.org/shubhg/pdf/shubhra_codon.pdf for an overview of codon optimization technology, which is incorporated herein by reference in its entirety. As provided herein, polynucleotide sequences may be codon optimized for optimal polypeptide expression in a particular microorganism including, but not limited to, E. coli, H. alvei, and P. aeruginosa.
[0038] In certain embodiments, mutants of a polynucleotide can be obtained from codon optimization of the polynucleotide to decrease the guanine (G) and cytosine (C) polynucleotide content thereof for improved protein expression. A genome is considered GC-rich if about 50% or more of its bases are G or C. A high GC content in the polynucleotide sequence of interest may lead to the formation of secondary structure in the mRNA, which can result in interrupted translation and lower levels of expression. Thus, changing G and C residues in the coding sequence to A and T residues without changing the amino acids may provide higher expression levels.
[0039] P. aeruginosa ldc2 is considered GC-rich since more than 66% of its bases are G or C. In some embodiments, a polynucleotide may be optimized to comprise a guanine and cytosine polynucleotide content that comprises less than about 60%, less than about 55%, less than about 50%, less than about 45%, or less than about 40% of the total polynucleotide content of the polynucleotide. In some embodiments, the polynucleotide that is optimized to comprise a specific guanine and cytosine polynucleotide content may be P. aeruginosa ldc2.
[0040] As further shown herein, heterologous expression of an Ldc2 mutant Ldc2 S111C (SEQ ID NO: 6) has resulted in unexpectedly high cadaverine production, with E. coli expressing the Ldc2 S111C exhibiting higher cadaverine yields than E. coli expressing the E. coli lysine decarboxylase CadA or wild-type Ldc2 (e.g., see Table 3). Although the serine at amino acid position 111 in Ldc2 is conserved across lysine decarboxylases from various species (e.g., see
[0041] In certain embodiments, the polynucleotide encoding Ldc2 S111C comprises, consists of, or consists essentially of a polynucleotide encoding Ldc2 (e.g. ldc2 (SEQ ID NO: 3), a codon optimized ldc2 (e.g. ldc2-co1, SEQ ID NO: 17)) having a mutation at nucleotide position 332. In certain embodiments, the nucleotide at position 332 may be mutated to G (e.g. ldc2-co1 C332G (SEQ ID NO: 18)).
[0042] In certain embodiments, the polynucleotide encoding Ldc2 S111C comprises, consists of, or consists essentially of a polynucleotide encoding Ldc2 (e.g. ldc2 (SEQ ID NO: 3), a codon optimized ldc2 (e.g. ldc2-co1, SEQ ID NO: 17)) with mutations at nucleotide positions 332 and 333. In certain embodiments, the nucleotide at position 332 may be mutated to a G and the nucleotide at position 333 may be mutated to a T or C.
[0043] In certain embodiments, a polynucleotide encoding Ldc2 S111X comprises, consists of, or consists essentially of a polynucleotide encoding Ldc2 (e.g. ldc2 (SEQ ID NO: 3), a codon optimized ldc2 (e.g. ldc2-co1, SEQ ID NO: 17)) having one or more suitable nucleotide mutations selected from the group consisting of a mutation at nucleotide position 331, a mutation at nucleotide position 332, and a mutation at nucleotide position 333.
[0044] In certain embodiments, a polynucleotide encoding Ldc2 S111C or Ldc2 S111X may undergo further codon optimization for optimal polypeptide expression in a particular microorganism (e.g., E. coli, H. alvei, or P. aeruginosa).
[0045] As further shown herein, heterologous expression of another Ldc2 mutant Ldc2 N262T (SEQ ID NO: 11) also resulted in unexpectedly high cadaverine production, with E. coli expressing the codon Ldc2 N262T exhibiting higher cadaverine yields than E. coli expressing the E. coli lysine decarboxylase wild-type Ldc2 (e.g., see Table 4). Although the asparagine at amino acid position 262 in Ldc2 is conserved across lysine decarboxylases from various species (e.g., see
[0046] In certain embodiments, the polynucleotide encoding Ldc2 N262T comprises, consists of, or consists essentially of a polynucleotide encoding Ldc2 (e.g. ldc2 (SEQ ID NO: 3), a codon optimized ldc2 (e.g. ldc2-col, SEQ ID NO: 17)) with a mutation at nucleotide position 785. In certain embodiments, the nucleotide at position 785 may be mutated to a C (e.g. ldc2-col A785C (SEQ ID NO: 19)).
[0047] In certain embodiments, the polynucleotide encoding Ldc2 N262T comprises, consists of, or consists essentially of a polynucleotide encoding Ldc2 (e.g. ldc2 (SEQ ID NO: 3), a codon optimized ldc2 (e.g. ldc2-co1, SEQ ID NO: 17)) having mutations at nucleotide positions 785 and 786. In certain embodiments, the nucleotide at position 785 may be mutated to a C and the nucleotide at position 786 may be mutated to a T, C, A, or G.
[0048] In certain embodiments, a polynucleotide encoding Ldc2 N262X comprises, consists of, or consists essentially of a polynucleotide encoding Ldc2 (e.g. ldc2 (SEQ ID NO: 3), a codon optimized ldc2 (e.g. ldc2-col, SEQ ID NO: 17)) having one or more suitable nucleotide mutations selected from the group consisting of a mutation at nucleotide position 784, a mutation at nucleotide position 785, and a mutation at nucleotide position 786.
[0049] In certain embodiments, a polynucleotide encoding Ldc2 N262T or Ldc2 N262X may undergo further codon optimization for optimal polypeptide expression in a particular microorganism (e.g., E. coli, H. alvei, or P. aeruginosa).
[0050] As further shown herein, heterologous expression of an Ldc2 mutant Ldc2 K265N (SEQ ID NO: 12) also resulted in unexpectedly high cadaverine production, with E. coli expressing the Ldc2 K265N exhibiting higher cadaverine yields than E. coli expressing the wild-type Ldc2 (e.g., see Table 5). Although the lysine at amino acid position 265 in Ldc2 is conserved across lysine decarboxylases from various species (e.g., see
[0051] In certain embodiments, the polynucleotide encoding Ldc2 K265N comprises, consists of, or consists essentially of a polynucleotide encoding Ldc2 (e.g. ldc2 (SEQ ID NO: 3), a codon optimized ldc2 (e.g. ldc2-col, SEQ ID NO: 17)) with a mutation at nucleotide position 795. In certain embodiments, the nucleotide at position 795 may be mutated to a T or C (e.g. ldc2-col A795C (SEQ ID NO: 20)).
[0052] In certain embodiments, a polynucleotide encoding Ldc2 K265X comprises, consists of, or consists essentially of a polynucleotide encoding Ldc2 (e.g. ldc2 (SEQ ID NO: 3), a codon optimized ldc2 (e.g. ldc2-col, SEQ ID NO: 17)) having one or more suitable nucleotide mutations selected from the group consisting of a mutation at nucleotide position 793, a mutation at nucleotide position 794, and a mutation at nucleotide position 795.
[0053] In certain embodiments, a polynucleotide encoding Ldc2 K265N or Ldc2 K265X may undergo further codon optimization for optimal polypeptide expression in a particular microorganism (e.g., E. coli, H. alvei, or P. aeruginosa).
[0054] In certain embodiments, a mutant of Ldc2 (also may be referred to as a Ldc2 mutant) may comprise a mutation at more than one amino acid in the sequence of SEQ ID NO: 4. In certain embodiments, the mutant of Ldc2 is a double mutant comprising SEQ ID NO: 13 (Ldc2 S111C/N262T), which has mutations at amino acid positions 111 and 262. In certain embodiments, the serine at amino acid position 111 and the asparagine at amino acid position 262 in Ldc2 may be mutated to any other amino acid (Ldc2 S111X/N262X). X and X can be the same or different, and are the same as described supra.
[0055] In certain embodiments, the polynucleotide encoding Ldc2 S111C/N262T comprises, consists of, or consists essentially of a polynucleotide encoding Ldc2 (e.g. ldc2 (SEQ ID NO: 3), a codon optimized ldc2 (e.g. SEQ ID NO: 17)) with mutations at nucleotide positions 332 and 785. In certain embodiments, the nucleotide at position 332 may be mutated to a G and the nucleotide at position 785 may be mutated to a C (e.g. ldc2-col C332G/A785C (SEQ ID NO: 21)).
[0056] In certain embodiments, the polynucleotide encoding Ldc2 S111C/N262T comprises, consists of, or consists essentially of a polynucleotide encoding Ldc2 (e.g. ldc2 (SEQ ID NO: 3), a codon optimized ldc2 (e.g. SEQ ID NO: 17)) containing one or more mutations as described supra for the polynucleotides encoding Ldc2 S111C and one or more mutations as described supra for the polynucleotides encoding Ldc2 N262T.
[0057] In certain embodiments, a polynucleotide encoding Ldc2 S111X/N262X comprises, consists of, or consists essentially of a polynucleotide encoding Ldc2 (e.g. ldc2 (SEQ ID NO: 3), a codon optimized ldc2 (e.g. ldc2-co1, SEQ ID NO: 17)) containing one or more suitable nucleotide mutations selected from the group consisting of a mutation at nucleotide position 331, a mutation at nucleotide position 332, a mutation at nucleotide position 333, a mutation at nucleotide position 784, a mutation at nucleotide position 785, and a mutation at nucleotide position 786.
[0058] In certain embodiments, a polynucleotide encoding Ldc2 S111C/N262T or Ldc2 S111X/N262X may undergo further codon optimization for optimal polypeptide expression in a particular microorganism (e.g., E. coli, H. alvei, or P. aeruginosa).
[0059] In certain embodiments, the mutant of Ldc2 is a double mutant comprising SEQ ID NO: 14 (Ldc2 S111C/K265N), which has mutations at amino acid positions 111 and 265. In certain embodiments, the serine at amino acid position 111 and the lysine at amino acid position 265 may be mutated to any other amino acid (Ldc2 S111X/N265X). X and X can be the same or different, and are the same as described supra.
[0060] In certain embodiments, the polynucleotide encoding Ldc2 S111C/K265N comprises, consists of, or consists essentially of a polynucleotide encoding Ldc2 (e.g. ldc2 (SEQ ID NO: 3), a codon optimized ldc2 (e.g. ldc2-co1, SEQ ID NO: 17)) with mutations at nucleotide positions 332 and 795.
[0061] In certain embodiments, the polynucleotide encoding Ldc2 S111C/K265N comprises, consists of, or consists essentially of a polynucleotide encoding Ldc2 (e.g. ldc2 (SEQ ID NO: 3), a codon optimized ldc2 (e.g. ldc2-col, SEQ ID NO: 17)) containing one or more mutations as described supra for the polynucleotides encoding Ldc2 S111C and one or more mutations as described supra for the polynucleotides encoding Ldc2 K265N. In certain embodiments, the nucleotide at position 332 may be mutated to a G and the nucleotide at position 795 may be mutated to a T or C (e.g. ldc2-col C332G/A795C (SEQ ID NO: 22)).
[0062] In certain embodiments, a polynucleotide encoding Ldc2 S111X/K265X comprises, consists of, or consists essentially of a polynucleotide encoding Ldc2 (e.g. ldc2 (SEQ ID NO: 3), a codon optimized ldc2 (e.g. ldc2-col, SEQ ID NO: 17)) having one or more suitable nucleotide mutations selected from the group consisting of a mutation at nucleotide position 331, a mutation at nucleotide position 332, a mutation at nucleotide position 333, a mutation at nucleotide position 793, a mutation at nucleotide position 794, and a mutation at nucleotide position 795.
[0063] In certain embodiments, a polynucleotide encoding Ldc2 S111C/K265N or Ldc2 S111X/K265X may undergo further codon optimization for optimal polypeptide expression in a particular microorganism (e.g., E. coli, H. alvei, or P. aeruginosa).
[0064] In certain embodiments, the mutant of Ldc2 is a double mutant comprising SEQ ID NO: 15 (Ldc2 N262T/K265N), which has mutations at amino acid positions 262 and 265. In certain embodiments, the asparagine at amino acid position 262 and the lysine at amino acid position 265 may be mutated to any other amino acid (Ldc2 N262X/K265X). X and X can be the same or different, and are the same as described supra.
[0065] In certain embodiments, the polynucleotide encoding Ldc2 N262T/K265N comprises, consists of, or consists essentially of a polynucleotide encoding Ldc2 (e.g. ldc2 (SEQ ID NO: 3), a codon optimized ldc2 (e.g. ldc2-col, SEQ ID NO: 17)) with mutations at nucleotide positions 785 and 795. In certain embodiments, the nucleotide at position 785 may be mutated to a C, and the nucleotide at position 795 may be mutated to a T or C (e.g. ldc2-co1 A785C/A795C (SEQ ID NO: 23)).
[0066] In certain embodiments, the polynucleotide encoding Ldc2 N262T/K265N comprises, consists of, or consists essentially of a polynucleotide encoding Ldc2 (e.g. ldc2 (SEQ ID NO: 3), a codon optimized ldc2 (e.g. ldc2-col, SEQ ID NO: 17)) containing one or more mutations as described supra for the polynucleotides encoding Ldc2 N262T and one or more mutations as described supra for the polynucleotides encoding Ldc2 K265N.
[0067] In certain embodiments, a polynucleotide encoding Ldc2 N262X/K265X comprises, consists of, or consists essentially of a polynucleotide encoding Ldc2 (e.g. ldc2 (SEQ ID NO: 3), a codon optimized ldc2 (e.g. ldc2-col, SEQ ID NO: 17)) containing one or more nucleotide mutations selected from the group consisting of a mutation at nucleotide position 784, a mutation at nucleotide position 785, a mutation at nucleotide position 786, a mutation at nucleotide position 793, a mutation at nucleotide position 794, and a mutation at nucleotide position 795.
[0068] In certain embodiments, a polynucleotide encoding Ldc2 N262T/K265N or Ldc2 N262X/K265X may undergo further codon optimization for optimal polypeptide expression in a particular microorganism (e.g., E. coli, H. alvei, or P. aeruginosa).
[0069] In certain embodiments, the mutant of Ldc2 is a triple mutant comprising SEQ ID NO: 16 (Ldc2 S111C/N262T/K265N), which has mutations at amino acid positions 111, 262, and 265. In certain embodiments, the serine at amino acid position 111, the asparagine at amino acid position 262, and the lysine at amino acid position 265, may be mutated to any other amino acid (S111X/N262K/K265X). X, X and X can be the same or different, and are the same as described supra.
[0070] In certain embodiments, the polynucleotide encoding Ldc2 S111C/N262T/K265N comprises, consists of, or consists essentially of a polynucleotide encoding Ldc2 (e.g. ldc2 (SEQ ID NO: 3), a codon optimized ldc2 (e.g. ldc2-co1, SEQ ID NO: 17)) with mutations at nucleotide positions 332, 785, and 795. In certain embodiments, the nucleotide at position 332 may be mutated to G, the nucleotide at position 785 may be mutated to a C, and the nucleotide at position 795 may be mutated to a T or C.
[0071] In certain embodiments, the polynucleotide encoding Ldc2 S111C/N262T/K265N comprises, consists of, or consists essentially of a polynucleotide encoding Ldc2 (e.g. ldc2 (SEQ ID NO: 3), a codon optimized ldc2 (e.g. ldc2-co1, SEQ ID NO: 17)) containing one or more mutations as described supra for the polynucleotides encoding Ldc2 S111C, one or more mutations as described supra for the polynucleotides encoding Ldc2 N262T, and one or more mutations as described supra for the polynucleotides encoding Ldc2 K265N (e.g. ldc2-col C332G/A785C/A795C (SEQ ID NO: 24)).
[0072] In certain embodiments, a polynucleotide encoding Ldc2 S111X/N262K/K265X comprises, consists of, or consists essentially of a polynucleotide encoding Ldc2 (e.g. ldc2 (SEQ ID NO: 3), a codon optimized ldc2 (e.g. ldc2-col, SEQ ID NO: 17)) containing one or more suitable nucleotide mutations selected from the group consisting of a mutation at nucleotide position 331, a mutation at nucleotide position 332, a mutation at nucleotide position 333, a mutation at nucleotide position 784, a mutation at nucleotide position 785, a mutation at nucleotide position 786, a mutation at nucleotide position 793, a mutation at nucleotide position 794, and a mutation at nucleotide position 795.
[0073] In certain embodiments, a polynucleotide encoding Ldc2 S111C/N262T/K265N or Ldc2 S111X/N262X/K265X may undergo further codon optimization for optimal polypeptide expression in a particular microorganism (e.g., E. coli, H. alvei, or P. aeruginosa).
[0074] In certain embodiments, the mutant of Ldc2 (SEQ ID NO: 4) comprises one or more mutations selected from the group consisting of a mutation at amino acid position 111 to X, a mutation at amino acid position 262 to X, and a mutation at amino acid position 265 to X (i.e. Ldc2 111/262/265). In certain embodiments, X, X, and X are independently selected from the group consisting of alanine, arginine, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine, and valine; and with the proviso that X is not serine, X is not asparagine, and X is not lysine.
[0075] Accordingly, the polynucleotide encoding Ldc2 111/262/265 comprises, consists of, or consists essentially of a polynucleotide encoding Ldc2 (e.g. ldc2 (SEQ ID NO: 3), a codon optimized ldc2 (e.g. ldc2-col, SEQ ID NO: 17)) containing one or more suitable nucleotide mutations selected from the group consisting of a mutation at nucleotide position 331, a mutation at nucleotide position 332, a mutation at nucleotide position 333, a mutation at nucleotide position 784, a mutation at nucleotide position 785, a mutation at nucleotide position 786, a mutation at nucleotide position 793, a mutation at nucleotide position 794, and a mutation at nucleotide position 795.
[0076] In certain embodiments, the polynucleotide described herein may be a recombinant or non-naturally occurring polynucleotide sequence. In certain embodiments, the polynucleotide sequence may be a cDNA.
[0077] Another aspect of the invention relates to a first expression plasmid vector comprising, consisting of, or consisting essentially of a fifth polynucleotide encoding one or more fifth polypeptides comprising, consisting of, or consisting essentially of one or more sixth polypeptides selected from the group consisting of Ldc2, fragments of Ldc2, and mutants of Ldc2; and a backbone plasmid capable of autonomous replication in a host cell. A sixth polynucleotide encodes a sixth polypeptide. In certain embodiments, the fifth polynucleotides are the same as the first polynucleotide as described supra, the fifth polypeptides are the same as the first polypeptide as described supra, the sixth polynucleotides are the same as the second polypeptide as described supra, and the sixth polypeptides are the same as the second polynucleotide as described supra. In certain embodiments, the host cell is a P. aeruginosa cell. In certain embodiments, the host cell is not a P. aeruginosa cell.
[0078] In certain embodiments, the first expression plasmid vector further comprises an antitoxin polynucleotide that counteracts a toxin polypeptide that is harmful to the host cell, and optionally a toxin polynucleotide encoding the toxin polypeptide. The toxin and antitoxin polynucleotides, and the toxin polypeptide are the same as further described below.
[0079] Another aspect of the invention relates to a second expression plasmid vector comprising, consisting of, or consisting essentially of a seventh polynucleotide encoding one or more seventh polypeptides comprising, consisting of, or consisting essentially of one or more eighth polypeptides selected from the group consisting of Ldc2, fragments of Ldc2, and mutants of Ldc2; and a backbone plasmid capable of autonomous replication in a host cell. An eighth polynucleotide encodes an eighth polypeptide. In certain embodiments, the seventh polynucleotides are the same as the third polynucleotide as described supra, the seventh polypeptides are the same as the third polypeptide as described supra, the eighth polynucleotides are the same as the fourth polypeptide as described supra, and the eighth polypeptides are the same as the fourth polynucleotide as described supra. In certain embodiments, the host cell is a P. aeruginosa cell. In certain embodiments, the host cell is not a P. aeruginosa cell.
[0080] In certain embodiments, heterologous expression of Ldc2 using the second expression plasmid vector comprising a mutant ldc2 (e.g. ldc2-col (SEQ ID NO: 17)) results in the same or greater cadaverine production than heterologous expression of Ldc2 using the second expression plasmid vector comprising ldc2. In certain embodiments, a fragment or mutant of Ldc2 exhibits lysine decarboxylase activity and/or increases cadaverine production when expressed in a host cell. In certain embodiments, heterologous expression of the fragment or mutant of Ldc2 in a host cell results in the same or greater cadaverine production than heterologous expression of Ldc2.
[0081] In certain embodiments, the second expression plasmid vector further comprises an antitoxin polynucleotide that counteracts a toxin polypeptide that is harmful to the host cell, and optionally a toxin polynucleotide encoding the toxin polypeptide. The toxin and antitoxin polynucleotides, and the toxin polypeptide are the same as further described below.
[0082] As used herein, the term host cell refers to a microorganism cell that may be any cell that can be transformed with an expression plasmid vector (e.g., Pseudomonas (e.g., P. aeruginosa), Escherichia (e.g., E. coli), Corynebacterium (e.g., Corynebacterium glutamicum), Bacilli, Hafnia (e.g., Hafnia alvei), Brevibacterium, Lactobacillus (e.g., Lactobacillus pentosus, Lactobacillus plantarum, Lactobacillus saerimnen), Lactococcus (e.g., Lactococcus lactis, Lactococcus lactis ssp. cremoris, Lactococcus lactis ssp. lactis), and Streptococcus (e.g., Streptococcus thermophilus)). In certain embodiments, the host cell may be any cell that is not a P. aeruginosa cell.
[0083] An E. coli cell may be any of the E. coli strains derived from E. coli K12 (e.g., MG1655, W3110, DH10b, DH1, BW2952 and strains derived therefrom) or E. coli B, or strains derived therefrom.
[0084] In certain embodiments, the host cell may contain one or more endogenous plasmids. In certain embodiments, the host cell does not contain endogenous plasmids. The term cure as used herein means to remove one or more endogenous plasmids from a host cell. In certain embodiments, a host cell may be cured of all endogenous plasmids by removing all endogenous plasmids from the host cell. In certain embodiments, a host cell may be cured of one or more endogenous plasmids by removing only the one or more endogenous plasmids that is targeted for removal from the cell.
[0085] In certain embodiments, the host cell may be a prokaryotic cell (e.g. is., H. alvei) containing endogenous plasmids that encode specific toxin/antitoxin gene pairs. Such toxin/antitoxin gene pairs play a role in maintenance of the genetic information and response to stress. (See, Wertz et al. Chimeric nature of two plasmids of Hafnia alvei encoding the bacteriocins alveicins A and B. Journal of Bacteriology, (2004) 186: 1598-1605.) As long as the cell has one or more plasmids comprising an antitoxin gene, the toxin is neutralized by the antitoxin that is continuously expressed by the one or more plasmids to keep the cells alive. In certain prokaryotes, the antitoxin protein degrades faster than the toxin protein. If the plasmid comprising the antitoxin gene is lost from the cell, the toxin protein will exist longer than the antitoxin protein in the cell and kill or inhibit the growth of the cell. Therefore, plasmids comprising the antitoxin or the toxin/antitoxin gene are preferably maintained to keep the host cell alive.
[0086] As used herein, a toxin/antitoxin gene pair has two genes, one is a toxin gene which expresses a polypeptide toxic to a host cell, and the other is an antitoxin gene which neutralizes the toxic polypeptide in the host cell. Examples of the toxin/antitoxin gene pair include, without limitation, abt/abi gene pair and aat/aai gene pair, fragments thereof, and mutants thereof. In some embodiments, the toxin polynucleotide sequence comprises, consists of, or consists essentially of the nucleotide sequence of SEQ ID NO: 7 or SEQ ID NO: 9, fragments thereof, or mutants thereof. In some embodiments, the antitoxin polynucleotide sequence comprises, consists of, or consists essentially of the nucleotide sequence of SEQ ID NO: 8 or SEQ ID NO: 10, fragments thereof, or mutants thereof.
[0087] In certain embodiments, the host cell may be any H. alvei strain, e.g., endogenous plasmid-free H. alvei strains or H. alvei strains containing endogenous plasmids. For example, the host cell may be an H. alvei strain containing one or more pAlvA plasmids or the cured strains thereof (pAlvA-strains), or an H. alvei strain containing one or more pAlvB plasmids and the cured strains thereof (pAlvB-strains).
[0088] In certain embodiments, the expression plasmid vector disclosed herein (e.g. the first or the second expression plasmid vector) may further comprise one or more antitoxin genes selected from the group consisting of abi gene, aai gene, mutations and fragments thereof, and/or one or more toxin/antitoxin gene pairs selected from the group consisting of abt/abi gene pair and aat/aai gene pair, and mutations and fragments thereof. For example, in certain embodiments, an expression plasmid vector (e.g. the first or the second expression plasmid vector) may further comprise an antitoxin polynucleotide that counteracts a toxin polypeptide that is harmful to the host cell, and a toxin polynucleotide sequence encoding the toxin polypeptide.
[0089] In certain embodiments, the host cell is an industrial strain suitable for use in industrial-scale or large-scale production. For example, industrial strains may be cultivated in a fermenter. The scale of culture may range from hundreds of liters to millions of liters. On the other hand, a laboratory strain is usually cultivated in a few liters or less. In certain embodiments, an industrial strain may grow in a simpler or more economical medium than laboratory strains.
[0090] A backbone plasmid capable of autonomous replication in a host cell may be any plasmid that can replicate in the host cell. In one embodiment, an expression plasmid vector comprises a backbone plasmid that can replicate in E. coli. In another embodiment, an expression plasmid vector comprises a backbone plasmid that can replicate in H. alvei. Examples of the backbone plasmids include, without limitation, backbone plasmids that can replicate in E. coli strains, e.g. pUC (e.g. pUC18 and pUC19 plasmids), pBR322, pSC101, p15a, pACYC, pET, and pSC101 plasmids, and plasmids derived therefrom.
[0091] In certain embodiments, the mutants of a polynucleotide can be obtained from codon optimization of the polynucleotide for a particular microorganism (e.g., E. coli, H. alvei, or P. aeruginosa) to enhance polypeptide expression.
[0092] A promoter is a region of DNA that initiates transcription of a particular gene. In certain embodiments, an expression plasmid vector may contain one or more promoter polynucleotide sequences. For example, a promoter polynucleotide sequence comprising, consisting of, or consisting essentially of the polynucleotide sequence of SEQ ID NO: 5 may be positioned upstream from the polynucleotide. In certain embodiments, the promoter sequence may be synthesized using the primers psyn-1 and psyn-2 (see
[0093] Another aspect of the invention relates to a first transformant comprising the first expression plasmid vector disclosed herein in a host cell, wherein the first expression plasmid vector comprises, consists, or consists essentially of:
[0094] a fifth polynucleotide encoding one or more fifth polypeptide comprising, consisting of, or consisting essentially of one or more sixth polypeptides selected from the group consisting of Ldc2, fragments of Ldc2, and mutants of Ldc2; and
[0095] a backbone plasmid capable of autonomous replication in the host cell.
[0096] A sixth polynucleotide encodes a sixth polypeptide. The host cell, the fifth polynucleotide, the fifth polypeptides, the sixth polynucleotides and the sixth polypeptides are the same as described supra.
[0097] As used herein, a transformant is a host cell that has been altered by introducing one or more expression plasmid vectors in the host cell. In certain embodiments, the transformant is obtained by introducing an expression plasmid vector through transformation into a host cell displaying competence to the plasmid vector.
[0098] In certain embodiments, the host cell is a P. aeruginosa cell. In one example, the sixth polypeptide is Ldc2, a sixth polynucleotide encodes the sixth polypeptide and is a mutant ldc2, e.g., a codon optimized ldc2 (e.g. ldc2-col) for optimal polypeptide expression in a particular microorganism (e.g., E. coli, H. alvei).
[0099] In certain embodiments, the host cell is not a P. aeruginosa cell.
[0100] Another aspect of the invention relates to a second transformant comprising the second expression plasmid vector in a host cell, wherein the expression plasmid vector comprises, consists, or consists essentially of:
[0101] a seventh polynucleotide encoding one or more seventh polypeptides comprising, consisting of, or consisting essentially of one or more eighth polypeptides selected from the group consisting of Ldc2, fragments of Ldc2, and mutants of Ldc2.
[0102] An eighth polynucleotide encodes an eighth polypeptide. The host cell, the seventh polynucleotide, the seventh polypeptides, the seventh polynucleotides, and the eighth polypeptides are the same as described supra.
[0103] In certain embodiments, the host cell is a P. aeruginosa cell.
[0104] In certain embodiments, the host cell is not a P. aeruginosa cell, the eighth polypeptide is Ldc2, an eighth polynucleotide encodes the eight polypeptide and is not ldc2, e.g. a codon optimized ldc2 (e.g. ldc2-col) for optimal polypeptide expression in a host cell (e.g., E. coli, H. alvei).
[0105] In certain embodiments, the expression plasmid vector (e.g., the first or the second expression plasmid vector) transformed into the transformant disclosed herein (e.g., the first or the second transformant) further comprises an antitoxin polynucleotide that counteracts a toxin polypeptide that is harmful to the host cell, and optionally a toxin polynucleotide sequence encoding the toxin polypeptide, and the transformant may be further altered by introducing an expression plasmid vector into the host cell comprising the toxin polynucleotide sequence encoding the toxin polypeptide, and optionally the antitoxin polynucleotide that counteracts the toxin polypeptide.
[0106] Another aspect of the invention relates to a first mutant host cell comprising a first or third polynucleotide as disclosed herein, wherein the first or third polynucleotide has been integrated into a chromosome of the host cell. The first or third polynucleotide is the same as described supra.
[0107] In certain embodiments, the first or third polynucleotide has been codon optimized as described supra. In certain embodiments, the first or third polynucleotide encodes one or more polypeptides comprising, consisting of, or consisting essentially of Ldc2 and/or one or more Ldc2 mutants selected from the group consisting of SEQ ID NO: 6 (Ldc2 S111C), SEQ ID NO: 11 (Ldc2 N262T), SEQ ID NO: 12 (Ldc2 K265N), SEQ ID NO: 13 (Ldc2 S111C/N262T), SEQ ID NO: 14 (Ldc2 S111C/K265N), SEQ ID NO: 15 (Ldc2 N262T/K265N), SEQ ID NO: 16 (Ldc2 S111C/N262T/K265N), and Ldc2 111/262/265.
[0108] In certain embodiments, the first or third polynucleotide may be integrated into the host cell chromosome according to the PCR-mediated gene replacement method (see, e.g. Datsenko, 2000 for an overview of the PCR-mediated gene replacement method, which is incorporated herein by reference in its entirety). Integrated chromosomes may also be produced by other suitable methods.
[0109] Another aspect of the invention relates to a method for producing P. aeruginosa Ldc2, a fragment of Ldc2, or a mutant of Ldc2 comprising:
[0110] obtaining the first transformant, the second transformant, and/or the first mutant host cell as disclosed herein (e.g. the first and/or the second transformant);
[0111] culturing the first transformant, the second transformant and/or the first mutant host cell under conditions effective for the expression of the polypeptide; and
[0112] harvesting the polypeptide.
[0113] The first transformant, the second transformant and/or the first mutant host cell may be cultured using a medium containing carbon sources and non-carbon nutrient sources. Examples of carbon sources include, without limitation, sugar (e.g. carbohydrates such as glucose and fructose), oil and/or fat, fatty acid, and/or derivatives thereof. The oil and fat may contain saturated and/or unsaturated fatty acids having 10 or more carbon atoms, e.g. coconut oil, palm oil, palm kernel oil, and the like. The fatty acid may be a saturated and/or unsaturated fatty acid, e.g. hexanoic acid, octanoic acid, decanoic acid, lauric acid, oleic acid, palmitic acid, linoleic acid, linolenic acid, myristic acid, and the like. Examples of derivatives of a fatty acid include, without limitation, esters and salts thereof. Examples of non-carbon sources include, without limitation, nitrogen sources, inorganic salts, and other organic nutrient sources.
[0114] For example, a medium may contain a carbon source assimilable by the transformant and/or mutant host cell, optionally with one or more other source selected from the group consisting of a nitrogen source, an inorganic salt and another organic nutrient source. In certain embodiments, the weight percentage of the nitrogen source is about 0.01 to about 0.1% of the medium. Examples of the nitrogen source may comprise ammonia, ammonium salts (e.g. ammonium chloride, ammonium sulfate and ammonium phosphate), peptone, meat extract, yeast extract, and the like. Examples of the inorganic salts include, without limitation, potassium dihydrogen phosphate, dipotassium hydrogen phosphate, magnesium phosphate, magnesium sulfate, sodium chloride, and the like. Examples of the other organic nutrient source include, without limitation, amino acids (e.g. glycine, alanine, serine, threonine and proline), vitamins (e.g. vitamin B1, vitamin B12 and vitamin C), and the like.
[0115] The culture may be carried out at any temperature as long as the cells can grow, and preferably at about 20 C. to about 40 C., or about 35 C. The culture period may be about 1, about 2, about 3, about 4, about 5, about 6, about 7, about 8, about 9, or about 10 days.
[0116] In one embodiment, the first transformant, the second transformant and/or the first mutant host cell is cultured in a medium containing peptides, peptones, vitamins (e.g. B vitamins), trace elements (e.g. nitrogen, sulfur, magnesium), and minerals. Examples of such medium include, without limitation, commonly known Lysogeny broth (LB) mediums comprising tryptone, yeast extract and NaCI suspended in water (e.g. distilled or deionized).
[0117] Another aspect of the invention relates to a method for producing cadaverine (1,5-pentanediamine) comprising:
[0118] 1a) cultivating the first transformant, the second transformant and/or the first mutant host cell as disclosed herein;
[0119] 1b) producing cadaverine using culture obtained from step 1a to decarboxylate lysine; and
[0120] 1c) extracting and purifying cadaverine using the culture obtained from step 1b.
[0121] Cultivating the first transformant, the second transformant and/or the first mutant host cell may comprise the steps of culturing the transformant or mutant host cell as described supra.
[0122] As used herein, using the culture obtained from step 1a may comprise further processes of the culture obtained from step 1a. For example, using a buffer solution to dilute the culture; centrifuging the culture to collect the cells; resuspending the cells in a buffer solution; or lysing the cells into cell lysate; or/and purifying lysine decarboxylase from the cell lysate.
[0123] In another embodiment, step 1c of the method further comprises the following steps:
[0124] 1c1) separating the solid and liquid components of the reaction obtained from step 1b;
[0125] 1c2) adjusting the pH of the liquid component obtained from step 1c1 to about 14 or higher;
[0126] 1c3) removing water from the liquid component obtained from step 1c2; and
[0127] 1c4) recovering cadaverine.
[0128] In step 1c1, the separation of the solid and liquid components of the reaction of step 1b may be accomplished by conventional centrifugation and/or filtration.
[0129] In step 1c2, the pH of the liquid component of step 1c1 may be adjusted by adding a base, e.g. NaOH. NaOH may be added as a solid and/or a solution (e.g. an aqueous solution).
[0130] In step 1c3, the water may be removed by distillation at ambient pressure or under vacuum.
[0131] In step 1c4, cadaverine may be recovered by distillation at ambient pressure or under vacuum.
[0132] Another aspect of the invention relates to biobased cadaverine prepared according to the method disclosed herein.
[0133] As used herein, a biobased compound means the compound is considered biobased under Standard ASTM D6866.
[0134] Another aspect of the invention relates to a polyamide having a structure of Structure 1:
##STR00001##
[0135] including stereoisomers thereof, wherein: [0136] m=4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, or 22; [0137] n=4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, or 22; [0138] j=about 100about 1,000,000; and [0139] the polyamide is prepared from one or more diamines having carbon [0140] numbers of m and one or more dicarboxylic acids having carbon numbers of n, at least one of the diamines and dicarboxylic acids comprises biobased carbon under Standard ASTM D6866, and the m or n of each diamine or dicarboxylic acid can be the same or different.
[0141] In one embodiment, the diamine is biobased cadaverine, more preferably biobased cadaverine prepared according to the method disclosed herein. Examples of the dicarboxylic acids include, without limitation, C.sub.10dicarboxylic acid, C.sub.11dicarboxylic acid, C.sub.12dicarboxylic acid, C.sub.13dicarboxylic acid, C.sub.14dicarboxylic acid, C.sub.16dicarboxylic acid, C.sub.18dicarboxylic acid, and any combinations thereof. In certain embodiments, all or part of the C.sub.ndicarboxylic acids are biobased.
[0142] In another embodiment, the polyamide has a structure described above, wherein: [0143] the polyamide is formed by reacting biobased cadaverine with one or more dicarboxylic acids, more preferably the biobased cadaverine is prepared according to the method disclosed herein; [0144] n=4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, or 22; [0145] j=about 100 to about 1,000,000, about 1000 to about 100,000, or about 1000 to about 10,000; and [0146] the dicarboxylic acids comprise biobased carbon under Standard ASTM D6866.
[0147] Another aspect of the invention relates to a method for making the polyamides disclosed herein comprising preparing biobased cadaverine as the C.sub.mdiamine according to the method disclosed herein.
[0148] In one embodiment, the method further comprises preparing one or more biobased C.sub.ndicarboxylic acids.
[0149] In another embodiment, the method further comprises preparing the polyamide by reacting biobased cadaverine with one or more biobased Cndicarboxylic acids.
[0150] Another aspect of the invention relates to a composition comprising one or more polyamides disclosed herein.
[0151] In one embodiment, the diamine is biobased cadaverine, more preferably biobased cadaverine prepared according to the method disclosed herein. Examples of the dicarboxylic acids include, without limitation, C.sub.10dicarboxylic acid, C.sub.11dicarboxylic acid, C.sub.12dicarboxylic acid, C.sub.13dicarboxylic acid, C.sub.14dicarboxylic acid, C.sub.16dicarboxylic acid, C.sub.18dicarboxylic acid, and any combinations thereof. In certain embodiments, all or part of the C.sub.ndicarboxylic acids are biobased.
[0152] In another embodiment, the polyamide has a structure described above, wherein: [0153] the polyamide is formed by reacting biobased cadaverine with one or more dicarboxylic acids, more preferably the biobased cadaverine is prepared according to the method disclosed herein; [0154] n=4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, or 22; [0155] j=about 100 to about 1,000,000, about 1000 to about 100,000, or about 1000 to about 10,000; and [0156] the dicarboxylic acids comprise biobased carbon under Standard ASTM D6866.
[0157] Another aspect of the invention relates to a method for preparing 1,5-diisocyanatopentane comprising: [0158] 2a) preparing biobased cadaverine as disclosed herein; and [0159] 2b) converting biobased cadaverine obtained from step 2a to 1,5-diisocyanatopentane.
[0160] Step 2b may comprise using any known method to convert diamine into isocyanate. An example of said method is the traditional phosgene method, which includes one-step high temperature phosgene method (i.e. mixing phosgene with diamine at high temperature to obtain isocyanate), the improved two-step phosgene method, and the triphosgene method in which triphosgene is used instead of phosgene. There are also other methods that do not use phosgene as a raw material. An example of said method is hexanediamine carbonylation which uses CO.sub.2 instead of phosgene: CO.sub.2 is added into a solution of a primary amine and an organic base, then a proper amount of phosphorus electrophilic reagents is added into the reaction solution to start an exothermic dehydration reaction to obtain isocyanate. Another example is carbamate thermal decomposition method wherein a primary amine is converted to a carbamate, and then the carbamate is heated to decompose and generate isocyanate.
[0161] The abbreviations used for the amino acids, polypeptides, base sequences, and nucleic acids are based on the abbreviations specified in the IUPAC-IUB Communication on Biochemical Nomenclature, Eur. J. Biochem., 138:9 (1984), Guideline for Preparing Specifications Including Base Sequences and Amino Acid Sequences (United States Patent and Trademark Office), and those commonly used in this technical field.
[0162] Unless the context clearly requires otherwise, throughout the description and the claims, the words comprise, comprising, and the like are to be construed in an inclusive sense (i.e., to say, in the sense of including, but not limited to), as opposed to an exclusive or exhaustive sense. The words herein, above, below, supra, and words of similar import; when used in this application, refer to this application as a whole and not to any particular portions of this application. Where the context permits, words in the above Detailed Description using the singular or plural number may also include the plural or singular number respectively. The words or, and and/or in reference to a list of two or more items, covers all of the following interpretations of the word: any of the items in the list, all of the items in the list, and any combination of the items in the list.
[0163] The following examples are intended to illustrate various embodiments of the invention. As such, the specific embodiments discussed are not to be construed as limitations on the scope of the invention. It will be apparent to one skilled in the art that various equivalents, changes, and modifications may be made without departing from the scope of invention, and it is understood that such equivalent embodiments are to be included herein. Further, all references cited in the disclosure are hereby incorporated by reference in their entirety, as if fully set forth herein.
EXAMPLES
Example 1
P. aeruginosa Polypeptide Sequences are not Similar to Escherichia coli CadA or LdcC Lysine Decarboxylase Sequences
[0164] In order to identify novel lysine decarboxylases, E. coli lysine decarboxylase polypeptides CadA and LdcC were used as BLAST queries to identify similar protein sequences from organisms that were not E. coli. The non-redundant (nr) polypeptide sequence database was used, and E. coli (taxid:562) was excluded from the search. The BLAST results showing polypeptides with similar sequences are displayed as protein trees in
Example 2
Construction of P. aeruginosa ldc1 and ldc2 Expression Plasmid Vectors and E. coli Strains
[0165] The genomic DNA of P. aeruginosa PAO1 (Accession: NC_002516) was purchased from DSMZ (Leibniz Institute DSMZ-German Collection of Microorganisms and Cell Cultures) (DSM No. 22644) and used as template DNA for PCR. PCR primers ldc1-1 and ldc1-2 (
[0166] PCR primers ldc2-1 and ldc2-2 (FIG.3) were designed based on a gene from P. aeruginosa RP73 (Accession: WP_014603046.1), which was designated ldc2. The nucleotide sequence for ldc2 is provided in SEQ ID NO: 3 and the Ldc2 protein sequence is provided in SEQ ID NO: 4. The primers ldc2-1 and ldc2-2 were used to amplify ldc2 (SEQ ID NO: 3).
[0167] Recombinant expression plasmid vectors containing either ldc1 or ldc2 genes were constructed. The respective genes were inserted into either a pUC18 plasmid vector or a pUC18 plasmid vector containing a synthetic promoter (pCIB10) (
[0168] Bacterial strains were constructed by transforming pCIB45-48 into E. coli MG1655 K12. pUC18 was transformed into E. coli MG1655 K12 as a negative control.
Example 3
Production of Cadaverine by Heterologous Expression of P. aeruginosa Ldcl and Ldc2 in E. coli
[0169] A single colony of each E. coli strain containing either empty vector or a P. aeruginosa ldc1 or a ldc2 recombinant expression plasmid vector (strains CIB45-46 and CIB 47-48, respectively) was grown overnight in Lysogeny broth (LB) medium with ampicillin (100 g/mL) in a 4 mL culture at 37 C. The following day, each culture was inoculated into 4 mL of fresh LB medium with ampicillin (100 g/mL) to a final optical density (OD) of 0.05, measured at absorbance 600 nm (OD.sub.600). Each culture was grown at 30 C. for 4 hours before adding lysine-HCl and pyridoxal-phosphate (PLP) to a final concentration of 20 g/L and 0.1 mM, respectively. Each culture was grown for an additional 24 hours before measuring the final OD.sub.600 and cadaverine concentration. Cadaverine was identified and quantified using nuclear magnetic resonance (NMR) (Table 1).
TABLE-US-00001 TABLE 1 Production of cadaverine by heterologous expression of P. aeruginosa Ldc1 and Ldc2 in E. coli. Polynucleotide encoding the Strain Host Promoter Enzyme enzyme Cadaverine* .sup.+N.C. E. coli P.sub.lac None None 0.50 CIB45 E. coli P.sub.lac Ldc1 ldc1 0.05 CIB46 E. coli P.sub.synthetic Ldc1 ldc1 0.40 CIB47 E. coli P.sub.synthetic Ldc2 ldc2 1.07 CIB48 E. coli P.sub.lac Ldc2 ldc2 1.32 .sup.+N.C.: negative control pUC18 *g/kg sample weight
[0170] As provided in Table 1, E. coli strains expressing P. aeruginosa Ldc2 (C11347 and 48) showed a higher yield of cadaverine produced compared with the E. coli strains expressing P. aeruginosa Ldc1 (CIB45 and CIB46). The strains expressing Ldc1 all showed a yield of cadaverine production less than that of the negative control (N.C.) (Table 1). Thus, these results demonstrate that heterologous expression of P. aeruginosa Ldc2 in E. coli affected the production of cadaverine.
Example 4
Construction of Codon-Optimized P. aeruginosa ldc2 Recombinant Expression Plasmid Vectors in E. coli and H. alvei Strains
[0171] The nucleotide sequence of the ldc2 gene was codon optimized for expression in E. coli (ldc2-col, SEQ ID NO: 17). The codon-optimized sequence was cloned into pUC18 and pCIB10 using the restriction enzymes Sacl and Xbal to generate the plasmids pCIB65 and pCIB66, respectively. Positive controls were constructed by cloning wild-type E. coli cadA into pUC18 and pCIB10 to generate pCIB60 and pCIB61, respectively. Plasmids pCIB60 and pCIB65 were transformed into E. coli MG1655 K12 to generate strains CIB60 and CIB65. Plasmids pCIB61 and pCIB66 were transformed into H. alvei to generate strains CIB61 and CIB66.
Example 5
Production of Cadaverine by P. aeruginosa Ldc2 and E. coli CadA Expressed in E. coli and H. alvei
[0172] A single colony of each E. coli and H. alvei strain (strains CIB48, CIB60, CIB61, CIB65, and CIB66) was grown overnight in LB medium with ampicillin (100 g/mL) in a 2.5 mL culture at 29 C. E. coli and H. alvei transformed with the empty vector pUC18 were used as negative controls. The following day, minimal medium with ampicillin (100 g/mL), and lysine-HCl and PLP to a final concentration of 20 g/L and 0.1 mM, respectively. Each culture was incubated at 37 C. for 5 hours. One milliliter of sample was taken from each culture to quantify cadaverine production using NMR.
TABLE-US-00002 TABLE 2 Cadaverine produced by P. aeruginosa Ldc2 and E. coli CadA expressed in E. coli and H. alvei. Polynucleotide encoding the Strain Host Enzyme enzyme Cadaverine* E. coli none none 0.20 CIB60 E. coli CadA cadA 5.81 1.5 CIB48 E. coli Ldc2 ldc2 6.02 1.67 CIB65 E. coli Ldc2 ldc2-co1 6.54 0.022 H. alvei none none 1.27 CIB61 H. alvei CadA cadA 6.62 0.46 CIB66 H. alvei Ldc2 ldc2-co1 9.60 1.7 *g/kg sample weight
[0173] As provided in Table 2, E. coli cells expressing the Ldc2 protein, produced from ldc2 or ldc2-co1 DNA, showed higher yields of cadaverine production (6.02 g/kg and 6.54 g/kg) compared to E. coli cells expressing the CadA protein (5.81 g/kg). Notably, E. coli cells expressing the Ldc2 protein produced from ldc2-col DNA showed higher yields of cadaverine production (6.54 g/kg) compared to E. coli cells expressing the Ldc2 protein produced from ldc2 DNA (6.02 g/kg). Additionally, H. alvei cells expressing the Ldc2 protein (produced from ldc2-co1 DNA) showed higher yields of cadaverine production (9.60 g/kg) compared to H. alvei cells expressing the CadA protein (6.62 g/kg).
Example 6
Construction and Expression of the P. aeruginosa Ldc2 S111C Mutant
[0174] The serine at amino acid position 111 in P. aeruginosa Ldc2 is conserved across lysine decarboxylases from various species, including E. coli, Shigella sonnei, and Salmonella enterica as indicated by the sequence alignment provided in
TABLE-US-00003 TABLE 3 Cadaverine produced by P. aeruginosa Ldc2 S111C and E. coli CadA expressed in E. coli and H. alvei. Polynucleotide encoding the Strain Host Enzyme enzyme Cadaverine* E. coli none none 0.20 CIB65 E. coli Ldc2 ldc2-co1 6.54 0.022 CIB67 E. coli Ldc2 S111C ldc2-co1 C332G 9.88 5.7 H. alvei none none 1.27 CIB66 H. alvei Ldc2 ldc2-co1 9.60 1.7 CIB68 H. alvei Ldc2 S111C ldc2-co1 C332G 8.58 0.73 *g/kg sample weight
[0175] As indicated in Table 3, E. coli cells expressing the Ldc2 S111C mutant protein showed a much higher yield of cadaverine production (9.88 g/kg) as compared to E. coli cells expressing the wild-type Ldc2 protein (6.54 g/kg).
Example 7
Construction and Expression of the P. aeruginosa Ldc2 N262T Mutant
[0176] The asparagine at amino acid position 262 in P. aeruginosa Ldc2 is conserved across lysine decarboxylases from various species, including E. coli, Shigella sonnei, Salmonella enterica as indicated by the sequence alignment provided in
[0177] Experiments to determine production were performed as described in Example 5. Briefly, a single colony of each strain was grown overnight in LB medium with ampicillin (100 g/mL) in a 2.5 mL culture at 29 C. The following day, 2.5 mL minimal medium supplemented with 100 g/mL ampicillin, and lysine-HCl and PLP to a final concentration of 20 g/L and 0.1 mM, respectively. Each culture was incubated at 37 C. for 5 hours. One milliliter of sample was taken from each culture to quantify cadaverine production using NMR.
TABLE-US-00004 TABLE 4 Cadaverine produced by P. aeruginosa Ldc2 N262T expressed in E. coli. Polynucleotide encoding the Strain Host Enzyme enzyme Cadaverine* E. coli none none 2.46 1.4 CIB65 E. coli Ldc2 ldc2-co1 6.25 0.87 CIB75 E. coli Ldc2 N262T ldc2-co1 A785C 14.5 4.2 *g/kg sample weight
[0178] As indicated in Table 4, E. coli strains expressing the Ldc2 N262T mutant protein showed a much higher yield of cadaverine production (14.5 g/kg) as compared to E. coli strains expressing the wild-type Ldc2 protein (6.25 g/kg).
Example 8
Construction and Expression of the P. aeruginosa Ldc2 K265N Mutant
[0179] The lysine at amino acid position 265 in P. aeruginosa Ldc2 is conserved across lysine decarboxylases from various species, including E. coli, Shigella sonnei, Salmonella enterica as indicated by the sequence alignment provided in
[0180] Experiments to determine production were performed as described in Example 5. Briefly, a single colony of each strain was grown overnight in LB medium with ampicillin (100 g/mL) in a 2.5 mL culture at 29 C. The following day, 2.5 mL minimal medium supplemented with 100 g/mL ampicillin, and lysine-HCl and PLP to a final concentration of 20 g/L and 0.1 mM, respectively. Each culture was incubated at 37 C. for 5 hours. One milliliter of sample was taken from each culture to quantify cadaverine production using NMR.
TABLE-US-00005 TABLE 5 Cadaverine produced by P. aeruginosa Ldc2 K265N expressed in E. coli. Polynucleotide Strain Host Enzyme encoding the enzyme Cadaverine* E. coli none none 1.89 0.74 CIB65 E. coli Ldc2 ldc2-co1 4.73 0.94 CIB76 E. coli Ldc2 K265N ldc2-co1 A795C 10.1 6.5 *g/kg sample weight
[0181] As indicated in Table 5, E. coli cells expressing the Ldc2 K265N mutant protein showed a much higher yield of cadaverine production (10.1 g/kg) as compared to cells expressing the wild-type Ldc2 protein (4.73 g/kg).
Example 9
Integration of ldc2 into the E. coli Chromosome and Expression of Ldc2
[0182] Integration of ldc2 into the E. coli chromosome was performed according to the PCR-mediated gene replacement method as described in Datsenko et al, 2000. The ldc2-co1 gene of P. aeruginosa (SEQ ID NO: 17) was integrated into the E. coli MG1655 chromosome at the locus of the recA gene. This knock-out cassette was constructed by using sewing PCR to fuse four fragments together: 1) the 400 bp region upstream of recA, 2) ldc2 gene, 3) the cat gene that enables chloramphenicol resistance, and 4) the 400 bp region downstream of recA. The knockout cassette was transformed into MG1655 harboring the pKD46 Red recombinase expression plasmid. Transformants were grown on chloramphenicol plates to identify successful integrations, and gene disruptions were verified using colony PCR and sequencing. One clone that was isolated with the desired integration was labeled CIB96.
[0183] Experiments to verify integration and expression of Ldc2 from the chromosome demonstrating cadaverine production were performed as described in Example 5. Briefly, a single colony was grown overnight in LB medium with chloramphenicol (25 g/mL) in a 2.5 mL culture at 29 C. The following day, 2.5 mL minimal medium supplemented with 25 g/mL chloramphenicol, and lysine-HCl and PLP to a final concentration of 20 g/L and 0.1 mM, respectively. Each culture was incubated overnight at 37 C. One milliliter of sample was taken from each culture to quantify cadaverine production using NMR.
TABLE-US-00006 TABLE 6 Cadaverine produced by P. aeruginosa Ldc2 expressed in E. coli. with ldc2 integrated chromosome. Polynucleotide encoding the Strain Host Enzyme enzyme Cadaverine* E. coli none none 0.10 0.09 CIB96 E. coli Ldc2 ldc2-co1 5.98 0.05 *g/kg sample weight
[0184] As indicated in Table 6, E. coli cells containing ldc2-co1 integrated into the chromosome and expressing the Ldc2 protein showed a much higher yield of cadaverine production (5.98 g/kg) as compared to the negative control (E. coli cells with no integrated chromosome) (0.10 g/kg).
TABLE-US-00007 SEQUENCELISTINGS SEQID:NO1(Idc1DNAsequence) ATGCCCTACGAAGCCGATGACTATCTTTCCCGGCACTTCCAGACCAGCGGCACCGACCTG GCGCGGAAGGTCGACGAACTGGCGGCCCTTGCGGCTCCCGGCGACAGCCCCAATCTCGC GCTCTACCGCGAGATGCTCTTCACCGTGACGCGCATGGCCCAGGCCGACCGCAACCGCT GGGACGCCAAGATCATGCTGCAGACCCTGCGCGAGATGGAGCATGCCTTCAGCGTCCTC GAGCAGTTCAAGCGGCGACGCAAGGTCACCGTGTTCGGCTCGGCGCGCACGCCGGTCGA ACATCCGGTCTATGCCCTGGCGCGCAAGCTGGGCGAGGAACTGGCCCGCTACGACCTGA TGGTGATCACCGGCGCCGGCGGCGGCATCATGGCCGCCGCCCACGAAGGCGCCGGGCT GGAGAACAGCCTGGGCTTCAACATCACCCTGCCCTTCGAGCAGCACGCCAACCATACGGT GGACGGCAGCGGCAACCTGCTGTCGTTCCACTTTTTCTTCCTGCGCAAGCTGTTCTTCGTC AAGGAAGCCGACGCCCTGGTGCTCTGCCCCGGCGGCTTCGGCACCCTCGACGAGGCACT GGAAGTGCTGACCCTGGTACAGACCGGCAAGAGTCCGCTGGTGCCGATCGTGCTGCTCG ACCAGCCGGGCGGCCGCTACTGGGAACACGCCCTGGAGTTCATGCAGGAACAGTTGCTG GAGAATCACTATATCCTGCCGGCCGACATGCGCCTGATGCGCCTGGTGCATTCGGCCGAA GACGCGGTGAAGGAAATCGCCCAGTTCTACCGCAACTTCCACTCCAGCCGCTGGCTGAAA GGCACTTTCGTGATTCGCCTGAACCACGCCCTGAACGAAGCCGCGCTGGCGCACCTGCAC GAACACTTCGCCAGCCTCTGCCTGAGCGGCGGCTTCCAGCAGCAGGCCTACAGCGAGCA GGAACAGGACGAACCGGAGTTCCGCAACCTGACCCGCCTCGCCTTCGTGTTCAACGGGC GCGACCAGGGGCGGCTGCGGGAATTGCTGGACTACATCAACCTGCCGGAAAACTGGGAC TGA SEQID:NO2(Ldc1proteinsequence) MAALDELRQVAPSIPLFLLFRQLRIEQLSSQLLDEVQGCFNLAAGPARFIAERIDSDLRE WRAPAGPRRLRDYAPPVPRTPVSARYNGRARLDLAPAKQWRIGSGSTAERLATPLNDLST AYRKTSAGAPAAHAGDIAEAFRRALWEAAARLAREDGDTWFFEILRGNPGPGIEAGRETP AKRWHGLAETLDSSPRLDPLRVALSAPGLDSRGRPASFGVPAAVVCRYLRRHGIAPLRTG DYRFLLLFPQGARAEHAQPLVDRLCEFKRRHDDDAPLKQVLPELLDSSPLYRYIGLRELC AMIHEASLRLHLTALADAAARTAGHAALAPATVYGHLVRDETEAVAIDRLGGRVVASLVG VHPAATPLLLPGERVAEESPALIDYLLALQAFGEHFPGFAPELQGIEIDERGRYRVRCVR PAALARGSVLRLATRRPD SEQID:NO3(Idc2DNAsequence) ATGTATAAAGACCTCAAATTTCCCGTCCTCATCGTCCATCGCGACATCAAGGCCGACACCG TTGCCGGCGAACGCGTGCGGGGCATCGCCCACGAACTGGAGCAGGACGGCTTCAGCATT CTCTCCACCGCCAGCTCCGCCGAGGGGCGCATCGTCGCTTCCACCCACCACGGCCTGGC CTGCATTCTGGTCGCCGCCGAAGGTGCCGGGGAAAACCAGCGCCTGCTGCAGGATGTGG TCGAACTGATCCGCGTGGCCCGCGTGCGGGCGCCGCAATTGCCGATCTTCGCCCTCGGC GAGCAGGTGACCATCGAGAACGCGCCGGCCGAGTCCATGGCCGACCTGCACCAGTTGCG CGGCATCCTCTACCTGTTCGAAGACACCGTGCCGTTCCTCGCCCGCCAGGTCGCCCGGG CGGCGCGCAACTACCTGGCCGGGCTGCTGCCGCCATTCTTCCGTGCGCTGGTCGAGCAC ACCGCGCAGTCCAACTATTCCTGGCATACGCCGGGCCACGGCGGCGGTGTCGCCTATCG CAAGAGTCCGGTGGGACAGGCGTTCCACCAGTTCTTCGGGGAGAACACGCTGCGTTCCG ACCTGTCGGTCTCGGTCCCCGAGCTGGGATCGCTGCTCGACCATACCGGCCCCCTGGCC GAGGCCGAGGACCGTGCCGCGCGCAATTTCGGCGCCGACCATACCTTCTTCGTGATCAAT GGCACTTCCACCGCGAACAAGATCGTCTGGCACTCCATGGTCGGTCGCGAAGACCTGGTG CTGGTGGACCGCAACTGCCACAAGTCGATCCTCCACTCGATCATCATGACCGGGGCGATA CCGCTCTACCTGACTCCGGAACGCAACGAACTGGGGATCATCGGGCCGATCCCGCTGAG CGAATTCAGCAAGCAGTCGATCGCCGCGAAGATCGCCGCCAGCCCGCTGGCGCGCGGCC GCGAGCCGAAGGTGAAGCTGGCGGTGGTGACTAACTCCACCTACGACGGCCTGTGCTAC AACGCCGAGCTGATCAAGCAGACCCTCGGCGACAGCGTCGAGGTGTTGCACTTCGACGA GGCTTGGTACGCCTATGCCGCGTTCCACGAGTTCTACGACGGACGCTATGGCATGGGCAC CTCGCGCAGCGAGGAGGGACCCCTGGTGTTCGCCACCCACTCCACGCACAAGATGCTCG CCGCCTTCAGCCAGGCCTCGATGATCCACGTGCAGGATGGCGGGACCCGGAAGCTGGAC GTGGCGCGCTTCAACGAAGCCTTCATGATGCACATCTCGACCTCGCCGCAGTACGGCATC ATCGCTTCGCTGGACGTGGCTTCGGCGATGATGGAAGGGCCCGCCGGGCGTTCGCTGAT CCAGGAGACCTTCGACGAGGCCCTCAGCTTCCGCCGGGCCCTGGCCAACGTACGGCAGA ACCTGGACCGGAACGACTGGTGGTTCGGCGTCTGGCAGCCGGAGCAGGTGGAGGGCAC CGACCAGGTCGGCACCCATGACTGGGTGCTGGAGCCGAGCGCCGACTGGCACGGCTTCG GCGATATCGCCGAAGACTACGTGCTGCTCGACCCGATCAAGGTCACCCTGACCACCCCGG GCCTGAGCGCTGGCGGCAAGCTCAGCGAGCAGGGGATTCCGGCCGCCATCGTCAGCCG CTTCCTCTGGGAGCGCGGGCTGGTGGTGGAGAAAACCGGTCTCTACTCCTTCCTGGTGCT GTTCTCGATGGGCATCACCAAGGGCAAGTGGAGCACCCTGGTCACCGAACTGCTCGAATT CAAGCGCTGTTACGACGCCAACCTGCCGCTGCTTGACGTCTTGCCCTCCGTGGCCCAGGC CGGCGGCAAGCGCTACAACGGAGTGGGCCTGCGCGACCTCAGCGACGCCATGCACGCCA GCTACCGCGACAACGCCACGGCGAAGGCCATGAAGCGCATGTACACGGTGCTGCCGGAG GTCGCGATGCGGCCGTCCGAGGCCTACGACAAGCTGGTGCGCGGCGAGGTCGAGGCGG TACCGATCGCTCGGTTGGAAGGGCGCATCGCGGCCGTCATGCTGGTACCCTATCCGCCG GGTATCCCGCTGATCATGCCGGGTGAGCGCTTCACCGAGGCGACCCGCTCGATCCTCGA CTATCTCGAGTTCGCGCGGACCTTCGAGCGCGCCTTCCCTGGTTTCGACTCCGATGTGCA TGGCCTGCAGCATCAGGACGGACCGTCCGGGCGCTGCTATACCGTTGAATGCATAAAGGA ATGA SEQID:NO4(Ldc2proteinsequence) MYKDLKFPVLIVHRDIKADTVAGERVRGIAHELEQDGFSILSTASSAEGRIVASTHHGLACILVAA EGAGENQRLLQDVVELIRVARVRAPQLPIFALGEQVTIENAPAESMADLHQLRGILYLFEDTVPF LARQVARAARNYLAGLLPPFFRALVEHTAQSNYSWHTPGHGGGVAYRKSPVGQAFHQFFGE NTLRSDLSVSVPELGSLLDHTGPLAEAEDRAARNFGADHTFFVINGTSTANKIVWHSMVGRED LVLVDRNCHKSILHSIIMTGAIPLYLTPERNELGIIGPIPLSEFSKQSIAAKIAASPLARGREPKVKL AVVTNSTYDGLCYNAELIKQTLGDSVEVLHFDEAWYAYAAFHEFYDGRYGMGTSRSEEGPLVF ATHSTHKMLAAFSQASMIHVQDGGTRKLDVARFNEAFMMHISTSPQYGIIASLDVASAMMEGP AGRSLIQETFDEALSFRRALANVRQNLDRNDWWFGVWQPEQVEGTDQVGTHDWVLEPSAD WHGFGDIAEDYVLLDPIKVTLTTPGLSAGGKLSEQGIPAAIVSRFLWERGLVVEKTGLYSFLVLF SMGITKGKWSTLVTELLEFKRCYDANLPLLDVLPSVAQAGGKRYNGVGLRDLSDAMHASYRD NATAKAMKRMYTVLPEVAMRPSEAYDKLVRGEVEAVPIARLEGRIAAVMLVPYPPGIPLIMPGE RFTEATRSILDYLEFARTFERAFPGFDSDVHGLQHQDGPSGRCYTVECIKE SEQID:NO5(syntheticpromoter) agtttattcttgacatgtagtgagggggctggtataat SEQID:NO6(Ldc2S111Cproteinsequence) MYKDLKFPVLIVHRDIKADTVAGERVRGIAHELEQDGFSILSTASSAEGRIVASTHHGLACILVAA EGAGENQRLLQDVVELIRVARVRAPQLPIFALGEQVTIENAPAECMADLHQLRGILYLFEDTVPF LARQVARAARNYLAGLLPPFFRALVEHTAQSNYSWHTPGHGGGVAYRKSPVGQAFHQFFGE NTLRSDLSVSVPELGSLLDHTGPLAEAEDRAARNFGADHTFFVINGTSTANKIVWHSMVGRED LVLVDRNCHKSILHSIIMTGAIPLYLTPERNELGIIGPIPLSEFSKQSIAAKIAASPLARGREPKVKL AVVTNSTYDGLCYNAELIKQTLGDSVEVLHFDEAWYAYAAFHEFYDGRYGMGTSRSEEGPLVF ATHSTHKMLAAFSQASMIHVQDGGTRKLDVARFNEAFMMHISTSPQYGIIASLDVASAMMEGP AGRSLIQETFDEALSFRRALANVRQNLDRNDWWFGVWQPEQVEGTDQVGTHDWVLEPSAD WHGFGDIAEDYVLLDPIKVTLTTPGLSAGGKLSEQGIPAAIVSRFLWERGLVVEKTGLYSFLVLF SMGITKGKWSTLVTELLEFKRCYDANLPLLDVLPSVAQAGGKRYNGVGLRDLSDAMHASYRD NATAKAMKRMYTVLPEVAMRPSEAYDKLVRGEVEAVPIARLEGRIAAVMLVPYPPGIPLIMPGE RFTEATRSILDYLEFARTFERAFPGFDSDVHGLQHQDGPSGRCYTVECIKE SEQIDNO:7(aatDNAsequence) >gb|AY271828.1|:385-1717H.alveiplasmidpAlvA,completesequence 1 ttgactttgttaaaagtcaggcataagatcaaaatactgtatatataacaatgtatttat 61 atacagtattttatactttttatctaacgtcagagagggcaatattatgagtggtggaga 121 tggcaagggtcacaatagtggagcacatgattccggtggcagcattaatggaacttctgg 181 gaaaggtgggccatcaagcggaggagcatcagataattctgggtggagttcggaaaataa 241 cccgtggggcggtggtaactcgggaatgattggtggcagtcaaggaggtaacggagctaa 301 tcatggtggcgaaaatacatcttctaactatgggaaagatgtatcacgccaaatcggtga 361 tgcgatagccagaaaggaaggcatcaatccgaaaatattcactgggtactttatccgttc 421 agatggatatttgatcggaataacgccacttgtcagtggtgatgcctttggcgttaatct 481 tggcctgttcaataacaatcaaaatagtagtagtgaaaataagggatggaatggaaggaa 541 tggagatggcattaaaaatagtagccaaggtggatggaagattaaaactaatgaacttac 601 ttcaaaccaagtagctgctgctaaatccgttccagaacctaaaaatagtaaatattataa 661 gtccatgagagaagctagcgatgaggttattaattctaatttaaaccaagggcatggagt 721 tggtgaggcagctagagctgaaagagattacagagaaaaagtaaagaacgcaatcaatga 781 taatagtcccaatgtgctacaggatgctattaaatttacagcagatttttataaggaagt 841 ttttaacgcttacggagaaaaagccgaaaaactagccaagttattagctgatcaagctaa 901 aggtaaaaagatccgcaatgtagaagatgcattgaaatcttatgaaaaacacaaggctaa 961 cattaacaaaaaaatcaatgcgaaagatcgcgaagctatcgccaaggctttggagtctat 1021 ggatgtagaaaaagccgcaaaaaatatatccaagttcagcaaaggactaggttgggttgg 1081 cccagctatcgatataactgattggtttacagaattatacaaagcagtgaaaactgataa 1141 ttggagatctctttatgttaaaactgaaactattgcagtagggctagctgcaacccatgt 1201 caccgccttagcattcagtgctgtcttgggtgggcctataggtattttaggttatggttt 1261 gattatggctggggttggggcgttagttaacgagacaatagttgacgaggcaaataaggt 1321 cattgggatttaa SEQIDNO:8(aaiDNAsequence) >gb|AY271828.1|:1734-2069H.alveiplasmidpAlvA,completesequence 1 ctatattttagcggtcacattttttatttcaaaacaaacagaaagaacaccaataggaat 61 tgatgtcataaaaataaaaataaaatacaaagtcattaaatatgtttttggcacaccatc 121 cttaaaaaaacctgttttccaaaattcttttttcgtatatctaagcgctgctttctctat 181 tagaaaccgagagaaaggaaatagaatagcgctagccaaaccaaagattctgagcgcaat 241 tattttaggttcgtcatcaccataactggcgtaaagaatacaagcagccataaagtatcc 301 ccaaaacatattatgtatgtaatatttccttgtcat SEQIDNO:9(abtDNAsequence) >gb|AY271829.1|:384-1566H.alveiplasmidpAlvB,completesequence 1 atgagtggtggagacggtaaaggtcacaatagtggagcacatgattccggtggcagcatt 61 aatggaacttcggggaaaggtggacctgattctggtggcggatattgggacaaccatcca 121 catattacaatcaccggtggacgggaagtaggtcaagggggagctggtatcaactggggt 181 ggtggttctggtcatggtaacggcgggggctcagttgccatccaagaatataacacgagt 241 aaatatcctaacacgggaggatttcctcctcttggagacgctagctggctgttaaatcct 301 ccaaaatggtcggttattgaagtaaaatcagaaaactcagcatggcgctcttatattact 361 catgttcaaggtcatgtttacaaattgacttttgatggtacgggtaagctcattgatacc 421 gcgtatgttaattatgaacccagtgatgatactcgttggagcccgcttaaaagttttaaa 481 tataataaaggaaccgctgaaaaacaggttagggatgccattaacaatgaaaaagaagca 541 gttaaggacgctgttaaatttactgcagacttctataaagaggtttttaaggtttacgga 601 gaaaaagccgagaagctcgctaagttattagcagatcaagctaaaggcaaaaaggttcgc 661 aacgtagaagatgccttgaaatcttatgaaaaatataagactaacattaacaaaaaaatc 721 aatgcgaaagatcgcgaagctattgctaaagccttggagtctatggatgtaggaaaagcc 781 gcaaaaaatatagccaagttcagtaaaggactaggttgggttggccctgctatcgatata 841 actgattggtttacagaattatacaaggcagtggaaactgataattggagatctttttat 901 gttaaaactgaaactattgcagtagggctagctgcaacccatgttgccgccttggcattc 961 agcgctgtcttgggtgggcctgtaggtattttgggttatggtttgattatggctggggtt 1021 ggggcgttagttaatgagacaatagttgacgaggcaaataaggttattgggctttaa SEQIDNO:10(abiDNAsequence) >gb|AY271829.1|:1583-1918H.alveiplasmidpAlvB,completesequence 1 ctataatttagcggtcacattttttatttcaaaaaaaacagaaataacacctataggaat 61 tgatgtcataaaaataaaaattaaatacaaagtcattaaatatgtttttggcacgccatc 121 cttaaaaaaaccagtttcccaaaattcttttttcgtatatctaagcgcggttttctctat 181 taaaaaccgagagaaagggaataggatagcactagccaaaccaaagattctgagcgcaat 241 tattttaggttcgttatccccataactggcgtaaagaatacaaacagccataaagtaccc 301 ccaaaacatattatgtatataatatttccttgtcat SEQID:NO11(Ldc2N262Tproteinsequence) MYKDLKFPVLIVHRDIKADTVAGERVRGIAHELEQDGFSILSTASSAEGRIVASTHHGLACILVAA EGAGENQRLLQDVVELIRVARVRAPQLPIFALGEQVTIENAPAESMADLHQLRGILYLFEDTVPF LARQVARAARNYLAGLLPPFFRALVEHTAQSNYSWHTPGHGGGVAYRKSPVGQAFHQFFGE NTLRSDLSVSVPELGSLLDHTGPLAEAEDRAARNFGADHTFFVINGTSTANKIVWHSMVGRED LVLVDRTCHKSILHSIIMTGAIPLYLTPERNELGIIGPIPLSEFSKQSIAAKIAASPLARGREPKVKLA VVTNSTYDGLCYNAELIKQTLGDSVEVLHFDEAWYAYAAFHEFYDGRYGMGTSRSEEGPLVFA THSTHKMLAAFSQASMIHVQDGGTRKLDVARFNEAFMMHISTSPQYGIIASLDVASAMMEGPA GRSLIQETFDEALSFRRALANVRQNLDRNDWWFGVWQPEQVEGTDQVGTHDWVLEPSADW HGFGDIAEDYVLLDPIKVTLTTPGLSAGGKLSEQGIPAAIVSRFLWERGLVVEKTGLYSFLVLFS MGITKGKWSTLVTELLEFKRCYDANLPLLDVLPSVAQAGGKRYNGVGLRDLSDAMHASYRDN ATAKAMKRMYTVLPEVAMRPSEAYDKLVRGEVEAVPIARLEGRIAAVMLVPYPPGIPLIMPGER FTEATRSILDYLEFARTFERAFPGFDSDVHGLQHQDGPSGRCYTVECIKE SEQID:NO12(Ldc2K265Nproteinsequence) MYKDLKFPVLIVHRDIKADTVAGERVRGIAHELEQDGFSILSTASSAEGRIVASTHHGLACILVAA EGAGENQRLLQDVVELIRVARVRAPQLPIFALGEQVTIENAPAESMADLHQLRGILYLFEDTVPF LARQVARAARNYLAGLLPPFFRALVEHTAQSNYSWHTPGHGGGVAYRKSPVGQAFHQFFGE NTLRSDLSVSVPELGSLLDHTGPLAEAEDRAARNFGADHTFFVINGTSTANKIVWHSMVGRED LVLVDRNCHNSILHSIIMTGAIPLYLTPERNELGIIGPIPLSEFSKQSIAAKIAASPLARGREPKVKL AVVTNSTYDGLCYNAELIKQTLGDSVEVLHFDEAWYAYAAFHEFYDGRYGMGTSRSEEGPLVF ATHSTHKMLAAFSQASMIHVQDGGTRKLDVARFNEAFMMHISTSPQYGIIASLDVASAMMEGP AGRSLIQETFDEALSFRRALANVRQNLDRNDWWFGVWQPEQVEGTDQVGTHDWVLEPSAD WHGFGDIAEDYVLLDPIKVTLTTPGLSAGGKLSEQGIPAAIVSRFLWERGLVVEKTGLYSFLVLF SMGITKGKWSTLVTELLEFKRCYDANLPLLDVLPSVAQAGGKRYNGVGLRDLSDAMHASYRD NATAKAMKRMYTVLPEVAMRPSEAYDKLVRGEVEAVPIARLEGRIAAVMLVPYPPGIPLIMPGE RFTEATRSILDYLEFARTFERAFPGFDSDVHGLQHQDGPSGRCYTVECIKE SEQID:NO13(Ldc2S111C/N262Tproteinsequence) MYKDLKFPVLIVHRDIKADTVAGERVRGIAHELEQDGFSILSTASSAEGRIVASTHHGLACILVAA EGAGENQRLLQDVVELIRVARVRAPQLPIFALGEQVTIENAPAECMADLHQLRGILYLFEDTVPF LARQVARAARNYLAGLLPPFFRALVEHTAQSNYSWHTPGHGGGVAYRKSPVGQAFHQFFGE NTLRSDLSVSVPELGSLLDHTGPLAEAEDRAARNFGADHTFFVINGTSTANKIVWHSMVGRED LVLVDRTCHKSILHSIIMTGAIPLYLTPERNELGIIGPIPLSEFSKQSIAAKIAASPLARGREPKVKLA VVTNSTYDGLCYNAELIKQTLGDSVEVLHFDEAWYAYAAFHEFYDGRYGMGTSRSEEGPLVFA THSTHKMLAAFSQASMIHVQDGGTRKLDVARFNEAFMMHISTSPQYGIIASLDVASAMMEGPA GRSLIQETFDEALSFRRALANVRQNLDRNDWWFGVWQPEQVEGTDQVGTHDWVLEPSADW HGFGDIAEDYVLLDPIKVTLTTPGLSAGGKLSEQGIPAAIVSRFLWERGLVVEKTGLYSFLVLFS MGITKGKWSTLVTELLEFKRCYDANLPLLDVLPSVAQAGGKRYNGVGLRDLSDAMHASYRDN ATAKAMKRMYTVLPEVAMRPSEAYDKLVRGEVEAVPIARLEGRIAAVMLVPYPPGIPLIMPGER FTEATRSILDYLEFARTFERAFPGFDSDVHGLQHQDGPSGRCYTVECIKE SEQID:NO14(Ldc2S111C/K265Nproteinsequence) MYKDLKFPVLIVHRDIKADTVAGERVRGIAHELEQDGFSILSTASSAEGRIVASTHHGLACILVAA EGAGENQRLLQDVVELIRVARVRAPQLPIFALGEQVTIENAPAECMADLHQLRGILYLFEDTVPF LARQVARAARNYLAGLLPPFFRALVEHTAQSNYSWHTPGHGGGVAYRKSPVGQAFHQFFGE NTLRSDLSVSVPELGSLLDHTGPLAEAEDRAARNFGADHTFFVINGTSTANKIVWHSMVGRED LVLVDRNCHNSILHSIIMTGAIPLYLTPERNELGIIGPIPLSEFSKQSIAAKIAASPLARGREPKVKL AVVTNSTYDGLCYNAELIKQTLGDSVEVLHFDEAWYAYAAFHEFYDGRYGMGTSRSEEGPLVF ATHSTHKMLAAFSQASMIHVQDGGTRKLDVARFNEAFMMHISTSPQYGIIASLDVASAMMEGP AGRSLIQETFDEALSFRRALANVRQNLDRNDWWFGVWQPEQVEGTDQVGTHDWVLEPSAD WHGFGDIAEDYVLLDPIKVTLTTPGLSAGGKLSEQGIPAAIVSRFLWERGLVVEKTGLYSFLVLF SMGITKGKWSTLVTELLEFKRCYDANLPLLDVLPSVAQAGGKRYNGVGLRDLSDAMHASYRD NATAKAMKRMYTVLPEVAMRPSEAYDKLVRGEVEAVPIARLEGRIAAVMLVPYPPGIPLIMPGE RFTEATRSILDYLEFARTFERAFPGFDSDVHGLQHQDGPSGRCYTVECIKE SEQID:NO15(Ldc2N262T/K265Nproteinsequence) MYKDLKFPVLIVHRDIKADTVAGERVRGIAHELEQDGFSILSTASSAEGRIVASTHHGLACILVAA EGAGENQRLLQDVVELIRVARVRAPQLPIFALGEQVTIENAPAESMADLHQLRGILYLFEDTVPF LARQVARAARNYLAGLLPPFFRALVEHTAQSNYSWHTPGHGGGVAYRKSPVGQAFHQFFGE NTLRSDLSVSVPELGSLLDHTGPLAEAEDRAARNFGADHTFFVINGTSTANKIVWHSMVGRED LVLVDRTCHNSILHSIIMTGAIPLYLTPERNELGIIGPIPLSEFSKQSIAAKIAASPLARGREPKVKL AVVTNSTYDGLCYNAELIKQTLGDSVEVLHFDEAWYAYAAFHEFYDGRYGMGTSRSEEGPLVF ATHSTHKMLAAFSQASMIHVQDGGTRKLDVARFNEAFMMHISTSPQYGIIASLDVASAMMEGP AGRSLIQETFDEALSFRRALANVRQNLDRNDWWFGVWQPEQVEGTDQVGTHDWVLEPSAD WHGFGDIAEDYVLLDPIKVTLTTPGLSAGGKLSEQGIPAAIVSRFLWERGLWEKTGLYSFLVLF SMGITKGKWSTLVTELLEFKRCYDANLPLLDVLPSVAQAGGKRYNGVGLRDLSDAMHASYRD NATAKAMKRMYTVLPEVAMRPSEAYDKLVRGEVEAVPIARLEGRIAAVMLVPYPPGIPLIMPGE RFTEATRSILDYLEFARTFERAFPGFDSDVHGLQHQDGPSGRCYTVECIKE SEQID:NO16(Ldc2S111C/N262T/K265Nproteinsequence) MYKDLKFPVLIVHRDIKADTVAGERVRGIAHELEQDGFSILSTASSAEGRIVASTHHGLACILVAA EGAGENQRLLQDVVELIRVARVRAPQLPIFALGEQVTIENAPAECMADLHQLRGILYLFEDTVPF LARQVARAARNYLAGLLPPFFRALVEHTAQSNYSWHTPGHGGGVAYRKSPVGQAFHQFFGE NTLRSDLSVSVPELGSLLDHTGPLAEAEDRAARNFGADHTFFVINGTSTANKIVWHSMVGRED LVLVDRTCHNSILHSIIMTGAIPLYLTPERNELGIIGPIPLSEFSKQSIAAKIAASPLARGREPKVKL AVVTNSTYDGLCYNAELIKQTLGDSVEVLHFDEAWYAYAAFHEFYDGRYGMGTSRSEEGPLVF ATHSTHKMLAAFSQASMIHVQDGGTRKLDVARFNEAFMMHISTSPQYGIIASLDVASAMMEGP AGRSLIQETFDEALSFRRALANVRQNLDRNDWWFGVWQPEQVEGTDQVGTHDWVLEPSAD WHGFGDIAEDYVLLDPIKVTLTTPGLSAGGKLSEQGIPAAIVSRFLWERGLVVEKTGLYSFLVLF SMGITKGKWSTLVTELLEFKRCYDANLPLLDVLPSVAQAGGKRYNGVGLRDLSDAMHASYRD NATAKAMKRMYTVLPEVAMRPSEAYDKLVRGEVEAVPIARLEGRIAAVMLVPYPPGIPLIMPGE RFTEATRSILDYLEFARTFERAFPGFDSDVHGLQHQDGPSGRCYTVECIKE SEQID:NO17(Idc2-co1DNAsequence) ATGTACAAAGATCTGAAATTCCCTGTTCTGATTGTACACCGCGATATCAAGGCGGACACGG TAGCCGGCGAGCGTGTTCGCGGTATTGCCCACGAACTCGAACAAGACGGCTTTAGCATTC TCTCTACGGCGTCTTCTGCGGAAGGCCGCATTGTGGCTAGCACGCACCACGGTCTCGCCT GCATCCTCGTGGCAGCTGAGGGTGCGGGTGAGAATCAGCGTCTGCTCCAAGACGTGGTT GAGCTGATCCGTGTAGCTCGCGTCCGTGCGCCACAGCTCCCGATCTTCGCGCTGGGCGA ACAGGTGACTATTGAAAACGCGCCTGCCGAATCTATGGCCGACCTGCACCAGCTCCGCGG CATTCTGTATCTCTTCGAGGATACTGTCCCGTTCCTGGCACGTCAGGTTGCACGCGCAGC GCGTAACTACCTCGCTGGCCTCCTCCCGCCATTCTTCCGTGCACTCGTGGAGCACACGGC CCAAAGCAATTACTCTTGGCACACCCCGGGTCACGGTGGTGGTGTCGCTTACCGTAAATCT CCGGTAGGTCAAGCTTTCCACCAGTTCTTTGGCGAGAATACCCTCCGCTCTGACCTGTCTG TTAGCGTTCCAGAGCTGGGCAGCCTGCTGGATCACACTGGCCCTCTCGCGGAAGCAGAG GATCGTGCCGCTCGCAATTTCGGTGCGGACCACACCTTCTTTGTCATCAATGGTACCTCTA CTGCGAACAAAATCGTTTGGCACTCTATGGTTGGTCGCGAGGACCTGGTGCTGGTCGATC GTAACTGTCACAAATCTATTCTGCACTCCATTATCATGACGGGTGCTATCCCACTGTACCTG ACTCCGGAACGCAACGAACTGGGTATTATCGGCCCTATTCCACTCTCCGAGTTTTCTAAAC AATCTATCGCAGCAAAAATTGCCGCCTCCCCACTCGCGCGTGGTCGTGAACCGAAAGTTAA ACTGGCTGTCGTTACCAACTCTACCTATGACGGTCTGTGTTACAACGCGGAACTGATCAAA CAAACCCTCGGCGACTCTGTCGAGGTACTGCATTTCGACGAGGCTTGGTATGCTTATGCG GCGTTTCACGAGTTCTACGACGGCCGCTACGGTATGGGCACTTCTCGTTCCGAAGAGGGT CCGCTGGTCTTTGCTACCCATTCTACCCACAAGATGCTCGCGGCTTTTTCCCAAGCTAGCA TGATTCACGTTCAGGATGGTGGTACGCGCAAGCTGGACGTCGCCCGCTTTAACGAAGCCT TTATGATGCACATCAGCACCTCTCCACAGTACGGCATCATTGCGTCTCTCGATGTCGCAAG CGCTATGATGGAAGGTCCTGCCGGTCGTAGCCTGATCCAAGAGACGTTCGATGAGGCGCT GTCCTTCCGTCGTGCTCTGGCGAATGTCCGTCAGAACCTGGACCGTAATGATTGGTGGTT CGGTGTCTGGCAACCGGAGCAGGTTGAGGGCACCGACCAGGTAGGTACTCACGACTGGG TTCTCGAGCCTAGCGCGGACTGGCATGGTTTTGGTGACATTGCGGAGGATTACGTTCTCCT CGATCCTATCAAAGTTACCCTGACCACCCCAGGTCTGAGCGCTGGCGGTAAACTCTCTGAA CAAGGCATCCCGGCAGCTATCGTTAGCCGTTTCCTGTGGGAACGTGGTCTGGTGGTCGAG AAAACGGGTCTGTACTCTTTCCTGGTTCTGTTCTCCATGGGTATCACGAAAGGCAAATGGT CTACTCTGGTTACCGAGCTGCTCGAATTCAAACGCTGTTACGACGCGAATCTGCCACTCCT GGATGTGCTGCCTTCTGTAGCGCAGGCGGGTGGTAAACGCTATAACGGTGTAGGTCTGCG TGATCTGTCCGATGCCATGCACGCTTCTTATCGTGACAATGCCACGGCGAAGGCCATGAA GCGTATGTATACGGTGCTCCCGGAAGTAGCCATGCGCCCGTCCGAAGCTTATGATAAGCT CGTACGCGGTGAAGTCGAAGCTGTTCCTATTGCACGTCTCGAGGGTCGTATTGCGGCGGT TATGCTGGTTCCGTACCCGCCAGGTATCCCGCTCATTATGCCGGGTGAACGTTTTACTGAA GCTACCCGCTCCATTCTGGACTATCTGGAGTTTGCCCGTACCTTCGAGCGCGCGTTCCCG GGCTTTGACTCTGATGTTCACGGCCTCCAACATCAAGATGGCCCGTCTGGCCGTTGTTATA CCGTTGAATGCATCAAGGAATAA SEQID:NO18(Idc2-co1C332GDNAsequence) ATGTACAAAGATCTGAAATTCCCTGTTCTGATTGTACACCGCGATATCAAGGCGGACACGG TAGCCGGCGAGCGTGTTCGCGGTATTGCCCACGAACTCGAACAAGACGGCTTTAGCATTC TCTCTACGGCGTCTTCTGCGGAAGGCCGCATTGTGGCTAGCACGCACCACGGTCTCGCCT GCATCCTCGTGGCAGCTGAGGGTGCGGGTGAGAATCAGCGTCTGCTCCAAGACGTGGTT GAGCTGATCCGTGTAGCTCGCGTCCGTGCGCCACAGCTCCCGATCTTCGCGCTGGGCGA ACAGGTGACTATTGAAAACGCGCCTGCCGAATGTATGGCCGACCTGCACCAGCTCCGCGG CATTCTGTATCTCTTCGAGGATACTGTCCCGTTCCTGGCACGTCAGGTTGCACGCGCAGC GCGTAACTACCTCGCTGGCCTCCTCCCGCCATTCTTCCGTGCACTCGTGGAGCACACGGC CCAAAGCAATTACTCTTGGCACACCCCGGGTCACGGTGGTGGTGTCGCTTACCGTAAATCT CCGGTAGGTCAAGCTTTCCACCAGTTCTTTGGCGAGAATACCCTCCGCTCTGACCTGTCTG TTAGCGTTCCAGAGCTGGGCAGCCTGCTGGATCACACTGGCCCTCTCGCGGAAGCAGAG GATCGTGCCGCTCGCAATTTCGGTGCGGACCACACCTTCTTTGTCATCAATGGTACCTCTA CTGCGAACAAAATCGTTTGGCACTCTATGGTTGGTCGCGAGGACCTGGTGCTGGTCGATC GTAACTGTCACAAATCTATTCTGCACTCCATTATCATGACGGGTGCTATCCCACTGTACCTG ACTCCGGAACGCAACGAACTGGGTATTATCGGCCCTATTCCACTCTCCGAGTTTTCTAAAC AATCTATCGCAGCAAAAATTGCCGCCTCCCCACTCGCGCGTGGTCGTGAACCGAAAGTTAA ACTGGCTGTCGTTACCAACTCTACCTATGACGGTCTGTGTTACAACGCGGAACTGATCAAA CAAACCCTCGGCGACTCTGTCGAGGTACTGCATTTCGACGAGGCTTGGTATGCTTATGCG GCGTTTCACGAGTTCTACGACGGCCGCTACGGTATGGGCACTTCTCGTTCCGAAGAGGGT CCGCTGGTCTTTGCTACCCATTCTACCCACAAGATGCTCGCGGCTTTTTCCCAAGCTAGCA TGATTCACGTTCAGGATGGTGGTACGCGCAAGCTGGACGTCGCCCGCTTTAACGAAGCCT TTATGATGCACATCAGCACCTCTCCACAGTACGGCATCATTGCGTCTCTCGATGTCGCAAG CGCTATGATGGAAGGTCCTGCCGGTCGTAGCCTGATCCAAGAGACGTTCGATGAGGCGCT GTCCTTCCGTCGTGCTCTGGCGAATGTCCGTCAGAACCTGGACCGTAATGATTGGTGGTT CGGTGTCTGGCAACCGGAGCAGGTTGAGGGCACCGACCAGGTAGGTACTCACGACTGGG TTCTCGAGCCTAGCGCGGACTGGCATGGTTTTGGTGACATTGCGGAGGATTACGTTCTCCT CGATCCTATCAAAGTTACCCTGACCACCCCAGGTCTGAGCGCTGGCGGTAAACTCTCTGAA CAAGGCATCCCGGCAGCTATCGTTAGCCGTTTCCTGTGGGAACGTGGTCTGGTGGTCGAG AAAACGGGTCTGTACTCTTTCCTGGTTCTGTTCTCCATGGGTATCACGAAAGGCAAATGGT CTACTCTGGTTACCGAGCTGCTCGAATTCAAACGCTGTTACGACGCGAATCTGCCACTCCT GGATGTGCTGCCTTCTGTAGCGCAGGCGGGTGGTAAACGCTATAACGGTGTAGGTCTGCG TGATCTGTCCGATGCCATGCACGCTTCTTATCGTGACAATGCCACGGCGAAGGCCATGAA GCGTATGTATACGGTGCTCCCGGAAGTAGCCATGCGCCCGTCCGAAGCTTATGATAAGCT CGTACGCGGTGAAGTCGAAGCTGTTCCTATTGCACGTCTCGAGGGTCGTATTGCGGCGGT TATGCTGGTTCCGTACCCGCCAGGTATCCCGCTCATTATGCCGGGTGAACGTTTTACTGAA GCTACCCGCTCCATTCTGGACTATCTGGAGTTTGCCCGTACCTTCGAGCGCGCGTTCCCG GGCTTTGACTCTGATGTTCACGGCCTCCAACATCAAGATGGCCCGTCTGGCCGTTGTTATA CCGTTGAATGCATCAAGGAATAA SEQID:NO19(Idc2-co1A785CDNAsequence) ATGTACAAAGATCTGAAATTCCCTGTTCTGATTGTACACCGCGATATCAAGGCGGACACGG TAGCCGGCGAGCGTGTTCGCGGTATTGCCCACGAACTCGAACAAGACGGCTTTAGCATTC TCTCTACGGCGTCTTCTGCGGAAGGCCGCATTGTGGCTAGCACGCACCACGGTCTCGCCT GCATCCTCGTGGCAGCTGAGGGTGCGGGTGAGAATCAGCGTCTGCTCCAAGACGTGGTT GAGCTGATCCGTGTAGCTCGCGTCCGTGCGCCACAGCTCCCGATCTTCGCGCTGGGCGA ACAGGTGACTATTGAAAACGCGCCTGCCGAATCTATGGCCGACCTGCACCAGCTCCGCGG CATTCTGTATCTCTTCGAGGATACTGTCCCGTTCCTGGCACGTCAGGTTGCACGCGCAGC GCGTAACTACCTCGCTGGCCTCCTCCCGCCATTCTTCCGTGCACTCGTGGAGCACACGGC CCAAAGCAATTACTCTTGGCACACCCCGGGTCACGGTGGTGGTGTCGCTTACCGTAAATCT CCGGTAGGTCAAGCTTTCCACCAGTTCTTTGGCGAGAATACCCTCCGCTCTGACCTGTCTG TTAGCGTTCCAGAGCTGGGCAGCCTGCTGGATCACACTGGCCCTCTCGCGGAAGCAGAG GATCGTGCCGCTCGCAATTTCGGTGCGGACCACACCTTCTTTGTCATCAATGGTACCTCTA CTGCGAACAAAATCGTTTGGCACTCTATGGTTGGTCGCGAGGACCTGGTGCTGGTCGATC GTACCTGTCACAAATCTATTCTGCACTCCATTATCATGACGGGTGCTATCCCACTGTACCTG ACTCCGGAACGCAACGAACTGGGTATTATCGGCCCTATTCCACTCTCCGAGTTTTCTAAAC AATCTATCGCAGCAAAAATTGCCGCCTCCCCACTCGCGCGTGGTCGTGAACCGAAAGTTAA ACTGGCTGTCGTTACCAACTCTACCTATGACGGTCTGTGTTACAACGCGGAACTGATCAAA CAAACCCTCGGCGACTCTGTCGAGGTACTGCATTTCGACGAGGCTTGGTATGCTTATGCG GCGTTTCACGAGTTCTACGACGGCCGCTACGGTATGGGCACTTCTCGTTCCGAAGAGGGT CCGCTGGTCTTTGCTACCCATTCTACCCACAAGATGCTCGCGGCTTTTTCCCAAGCTAGCA TGATTCACGTTCAGGATGGTGGTACGCGCAAGCTGGACGTCGCCCGCTTTAACGAAGCCT TTATGATGCACATCAGCACCTCTCCACAGTACGGCATCATTGCGTCTCTCGATGTCGCAAG CGCTATGATGGAAGGTCCTGCCGGTCGTAGCCTGATCCAAGAGACGTTCGATGAGGCGCT GTCCTTCCGTCGTGCTCTGGCGAATGTCCGTCAGAACCTGGACCGTAATGATTGGTGGTT CGGTGTCTGGCAACCGGAGCAGGTTGAGGGCACCGACCAGGTAGGTACTCACGACTGGG TTCTCGAGCCTAGCGCGGACTGGCATGGTTTTGGTGACATTGCGGAGGATTACGTTCTCCT CGATCCTATCAAAGTTACCCTGACCACCCCAGGTCTGAGCGCTGGCGGTAAACTCTCTGAA CAAGGCATCCCGGCAGCTATCGTTAGCCGTTTCCTGTGGGAACGTGGTCTGGTGGTCGAG AAAACGGGTCTGTACTCTTTCCTGGTTCTGTTCTCCATGGGTATCACGAAAGGCAAATGGT CTACTCTGGTTACCGAGCTGCTCGAATTCAAACGCTGTTACGACGCGAATCTGCCACTCCT GGATGTGCTGCCTTCTGTAGCGCAGGCGGGTGGTAAACGCTATAACGGTGTAGGTCTGCG TGATCTGTCCGATGCCATGCACGCTTCTTATCGTGACAATGCCACGGCGAAGGCCATGAA GCGTATGTATACGGTGCTCCCGGAAGTAGCCATGCGCCCGTCCGAAGCTTATGATAAGCT CGTACGCGGTGAAGTCGAAGCTGTTCCTATTGCACGTCTCGAGGGTCGTATTGCGGCGGT TATGCTGGTTCCGTACCCGCCAGGTATCCCGCTCATTATGCCGGGTGAACGTTTTACTGAA GCTACCCGCTCCATTCTGGACTATCTGGAGTTTGCCCGTACCTTCGAGCGCGCGTTCCCG GGCTTTGACTCTGATGTTCACGGCCTCCAACATCAAGATGGCCCGTCTGGCCGTTGTTATA CCGTTGAATGCATCAAGGAATAA SEQID:NO20(Idc2-co1A795CDNAsequence) ATGTACAAAGATCTGAAATTCCCTGTTCTGATTGTACACCGCGATATCAAGGCGGACACGG TAGCCGGCGAGCGTGTTCGCGGTATTGCCCACGAACTCGAACAAGACGGCTTTAGCATTC TCTCTACGGCGTCTTCTGCGGAAGGCCGCATTGTGGCTAGCACGCACCACGGTCTCGCCT GCATCCTCGTGGCAGCTGAGGGTGCGGGTGAGAATCAGCGTCTGCTCCAAGACGTGGTT GAGCTGATCCGTGTAGCTCGCGTCCGTGCGCCACAGCTCCCGATCTTCGCGCTGGGCGA ACAGGTGACTATTGAAAACGCGCCTGCCGAATCTATGGCCGACCTGCACCAGCTCCGCGG CATTCTGTATCTCTTCGAGGATACTGTCCCGTTCCTGGCACGTCAGGTTGCACGCGCAGC GCGTAACTACCTCGCTGGCCTCCTCCCGCCATTCTTCCGTGCACTCGTGGAGCACACGGC CCAAAGCAATTACTCTTGGCACACCCCGGGTCACGGTGGTGGTGTCGCTTACCGTAAATCT CCGGTAGGTCAAGCTTTCCACCAGTTCTTTGGCGAGAATACCCTCCGCTCTGACCTGTCTG TTAGCGTTCCAGAGCTGGGCAGCCTGCTGGATCACACTGGCCCTCTCGCGGAAGCAGAG GATCGTGCCGCTCGCAATTTCGGTGCGGACCACACCTTCTTTGTCATCAATGGTACCTCTA CTGCGAACAAAATCGTTTGGCACTCTATGGTTGGTCGCGAGGACCTGGTGCTGGTCGATC GTAACTGTCACAACTCTATTCTGCACTCCATTATCATGACGGGTGCTATCCCACTGTACCTG ACTCCGGAACGCAACGAACTGGGTATTATCGGCCCTATTCCACTCTCCGAGTTTTCTAAAC AATCTATCGCAGCAAAAATTGCCGCCTCCCCACTCGCGCGTGGTCGTGAACCGAAAGTTAA ACTGGCTGTCGTTACCAACTCTACCTATGACGGTCTGTGTTACAACGCGGAACTGATCAAA CAAACCCTCGGCGACTCTGTCGAGGTACTGCATTTCGACGAGGCTTGGTATGCTTATGCG GCGTTTCACGAGTTCTACGACGGCCGCTACGGTATGGGCACTTCTCGTTCCGAAGAGGGT CCGCTGGTCTTTGCTACCCATTCTACCCACAAGATGCTCGCGGCTTTTTCCCAAGCTAGCA TGATTCACGTTCAGGATGGTGGTACGCGCAAGCTGGACGTCGCCCGCTTTAACGAAGCCT TTATGATGCACATCAGCACCTCTCCACAGTACGGCATCATTGCGTCTCTCGATGTCGCAAG CGCTATGATGGAAGGTCCTGCCGGTCGTAGCCTGATCCAAGAGACGTTCGATGAGGCGCT GTCCTTCCGTCGTGCTCTGGCGAATGTCCGTCAGAACCTGGACCGTAATGATTGGTGGTT CGGTGTCTGGCAACCGGAGCAGGTTGAGGGCACCGACCAGGTAGGTACTCACGACTGGG TTCTCGAGCCTAGCGCGGACTGGCATGGTTTTGGTGACATTGCGGAGGATTACGTTCTCCT CGATCCTATCAAAGTTACCCTGACCACCCCAGGTCTGAGCGCTGGCGGTAAACTCTCTGAA CAAGGCATCCCGGCAGCTATCGTTAGCCGTTTCCTGTGGGAACGTGGTCTGGTGGTCGAG AAAACGGGTCTGTACTCTTTCCTGGTTCTGTTCTCCATGGGTATCACGAAAGGCAAATGGT CTACTCTGGTTACCGAGCTGCTCGAATTCAAACGCTGTTACGACGCGAATCTGCCACTCCT GGATGTGCTGCCTTCTGTAGCGCAGGCGGGTGGTAAACGCTATAACGGTGTAGGTCTGCG TGATCTGTCCGATGCCATGCACGCTTCTTATCGTGACAATGCCACGGCGAAGGCCATGAA GCGTATGTATACGGTGCTCCCGGAAGTAGCCATGCGCCCGTCCGAAGCTTATGATAAGCT CGTACGCGGTGAAGTCGAAGCTGTTCCTATTGCACGTCTCGAGGGTCGTATTGCGGCGGT TATGCTGGTTCCGTACCCGCCAGGTATCCCGCTCATTATGCCGGGTGAACGTTTTACTGAA GCTACCCGCTCCATTCTGGACTATCTGGAGTTTGCCCGTACCTTCGAGCGCGCGTTCCCG GGCTTTGACTCTGATGTTCACGGCCTCCAACATCAAGATGGCCCGTCTGGCCGTTGTTATA CCGTTGAATGCATCAAGGAATAA SEQID:NO21(Idc2-co1C332G/A785CDNAsequence) ATGTACAAAGATCTGAAATTCCCTGTTCTGATTGTACACCGCGATATCAAGGCGGACACGG TAGCCGGCGAGCGTGTTCGCGGTATTGCCCACGAACTCGAACAAGACGGCTTTAGCATTC TCTCTACGGCGTCTTCTGCGGAAGGCCGCATTGTGGCTAGCACGCACCACGGTCTCGCCT GCATCCTCGTGGCAGCTGAGGGTGCGGGTGAGAATCAGCGTCTGCTCCAAGACGTGGTT GAGCTGATCCGTGTAGCTCGCGTCCGTGCGCCACAGCTCCCGATCTTCGCGCTGGGCGA ACAGGTGACTATTGAAAACGCGCCTGCCGAATGTATGGCCGACCTGCACCAGCTCCGCGG CATTCTGTATCTCTTCGAGGATACTGTCCCGTTCCTGGCACGTCAGGTTGCACGCGCAGC GCGTAACTACCTCGCTGGCCTCCTCCCGCCATTCTTCCGTGCACTCGTGGAGCACACGGC CCAAAGCAATTACTCTTGGCACACCCCGGGTCACGGTGGTGGTGTCGCTTACCGTAAATCT CCGGTAGGTCAAGCTTTCCACCAGTTCTTTGGCGAGAATACCCTCCGCTCTGACCTGTCTG TTAGCGTTCCAGAGCTGGGCAGCCTGCTGGATCACACTGGCCCTCTCGCGGAAGCAGAG GATCGTGCCGCTCGCAATTTCGGTGCGGACCACACCTTCTTTGTCATCAATGGTACCTCTA CTGCGAACAAAATCGTTTGGCACTCTATGGTTGGTCGCGAGGACCTGGTGCTGGTCGATC GTACCTGTCACAAATCTATTCTGCACTCCATTATCATGACGGGTGCTATCCCACTGTACCTG ACTCCGGAACGCAACGAACTGGGTATTATCGGCCCTATTCCACTCTCCGAGTTTTCTAAAC AATCTATCGCAGCAAAAATTGCCGCCTCCCCACTCGCGCGTGGTCGTGAACCGAAAGTTAA ACTGGCTGTCGTTACCAACTCTACCTATGACGGTCTGTGTTACAACGCGGAACTGATCAAA CAAACCCTCGGCGACTCTGTCGAGGTACTGCATTTCGACGAGGCTTGGTATGCTTATGCG GCGTTTCACGAGTTCTACGACGGCCGCTACGGTATGGGCACTTCTCGTTCCGAAGAGGGT CCGCTGGTCTTTGCTACCCATTCTACCCACAAGATGCTCGCGGCTTTTTCCCAAGCTAGCA TGATTCACGTTCAGGATGGTGGTACGCGCAAGCTGGACGTCGCCCGCTTTAACGAAGCCT TTATGATGCACATCAGCACCTCTCCACAGTACGGCATCATTGCGTCTCTCGATGTCGCAAG CGCTATGATGGAAGGTCCTGCCGGTCGTAGCCTGATCCAAGAGACGTTCGATGAGGCGCT GTCCTTCCGTCGTGCTCTGGCGAATGTCCGTCAGAACCTGGACCGTAATGATTGGTGGTT CGGTGTCTGGCAACCGGAGCAGGTTGAGGGCACCGACCAGGTAGGTACTCACGACTGGG TTCTCGAGCCTAGCGCGGACTGGCATGGTTTTGGTGACATTGCGGAGGATTACGTTCTCCT CGATCCTATCAAAGTTACCCTGACCACCCCAGGTCTGAGCGCTGGCGGTAAACTCTCTGAA CAAGGCATCCCGGCAGCTATCGTTAGCCGTTTCCTGTGGGAACGTGGTCTGGTGGTCGAG AAAACGGGTCTGTACTCTTTCCTGGTTCTGTTCTCCATGGGTATCACGAAAGGCAAATGGT CTACTCTGGTTACCGAGCTGCTCGAATTCAAACGCTGTTACGACGCGAATCTGCCACTCCT GGATGTGCTGCCTTCTGTAGCGCAGGCGGGTGGTAAACGCTATAACGGTGTAGGTCTGCG TGATCTGTCCGATGCCATGCACGCTTCTTATCGTGACAATGCCACGGCGAAGGCCATGAA GCGTATGTATACGGTGCTCCCGGAAGTAGCCATGCGCCCGTCCGAAGCTTATGATAAGCT CGTACGCGGTGAAGTCGAAGCTGTTCCTATTGCACGTCTCGAGGGTCGTATTGCGGCGGT TATGCTGGTTCCGTACCCGCCAGGTATCCCGCTCATTATGCCGGGTGAACGTTTTACTGAA GCTACCCGCTCCATTCTGGACTATCTGGAGTTTGCCCGTACCTTCGAGCGCGCGTTCCCG GGCTTTGACTCTGATGTTCACGGCCTCCAACATCAAGATGGCCCGTCTGGCCGTTGTTATA CCGTTGAATGCATCAAGGAATAA SEQID:NO22(Idc2-co1C332G/A795CDNAsequence) ATGTACAAAGATCTGAAATTCCCTGTTCTGATTGTACACCGCGATATCAAGGCGGACACGG TAGCCGGCGAGCGTGTTCGCGGTATTGCCCACGAACTCGAACAAGACGGCTTTAGCATTC TCTCTACGGCGTCTTCTGCGGAAGGCCGCATTGTGGCTAGCACGCACCACGGTCTCGCCT GCATCCTCGTGGCAGCTGAGGGTGCGGGTGAGAATCAGCGTCTGCTCCAAGACGTGGTT GAGCTGATCCGTGTAGCTCGCGTCCGTGCGCCACAGCTCCCGATCTTCGCGCTGGGCGA ACAGGTGACTATTGAAAACGCGCCTGCCGAATGTATGGCCGACCTGCACCAGCTCCGCGG CATTCTGTATCTCTTCGAGGATACTGTCCCGTTCCTGGCACGTCAGGTTGCACGCGCAGC GCGTAACTACCTCGCTGGCCTCCTCCCGCCATTCTTCCGTGCACTCGTGGAGCACACGGC CCAAAGCAATTACTCTTGGCACACCCCGGGTCACGGTGGTGGTGTCGCTTACCGTAAATCT CCGGTAGGTCAAGCTTTCCACCAGTTCTTTGGCGAGAATACCCTCCGCTCTGACCTGTCTG TTAGCGTTCCAGAGCTGGGCAGCCTGCTGGATCACACTGGCCCTCTCGCGGAAGCAGAG GATCGTGCCGCTCGCAATTTCGGTGCGGACCACACCTTCTTTGTCATCAATGGTACCTCTA CTGCGAACAAAATCGTTTGGCACTCTATGGTTGGTCGCGAGGACCTGGTGCTGGTCGATC GTAACTGTCACAACTCTATTCTGCACTCCATTATCATGACGGGTGCTATCCCACTGTACCTG ACTCCGGAACGCAACGAACTGGGTATTATCGGCCCTATTCCACTCTCCGAGTTTTCTAAAC AATCTATCGCAGCAAAAATTGCCGCCTCCCCACTCGCGCGTGGTCGTGAACCGAAAGTTAA ACTGGCTGTCGTTACCAACTCTACCTATGACGGTCTGTGTTACAACGCGGAACTGATCAAA CAAACCCTCGGCGACTCTGTCGAGGTACTGCATTTCGACGAGGCTTGGTATGCTTATGCG GCGTTTCACGAGTTCTACGACGGCCGCTACGGTATGGGCACTTCTCGTTCCGAAGAGGGT CCGCTGGTCTTTGCTACCCATTCTACCCACAAGATGCTCGCGGCTTTTTCCCAAGCTAGCA TGATTCACGTTCAGGATGGTGGTACGCGCAAGCTGGACGTCGCCCGCTTTAACGAAGCCT TTATGATGCACATCAGCACCTCTCCACAGTACGGCATCATTGCGTCTCTCGATGTCGCAAG CGCTATGATGGAAGGTCCTGCCGGTCGTAGCCTGATCCAAGAGACGTTCGATGAGGCGCT GTCCTTCCGTCGTGCTCTGGCGAATGTCCGTCAGAACCTGGACCGTAATGATTGGTGGTT CGGTGTCTGGCAACCGGAGCAGGTTGAGGGCACCGACCAGGTAGGTACTCACGACTGGG TTCTCGAGCCTAGCGCGGACTGGCATGGTTTTGGTGACATTGCGGAGGATTACGTTCTCCT CGATCCTATCAAAGTTACCCTGACCACCCCAGGTCTGAGCGCTGGCGGTAAACTCTCTGAA CAAGGCATCCCGGCAGCTATCGTTAGCCGTTTCCTGTGGGAACGTGGTCTGGTGGTCGAG AAAACGGGTCTGTACTCTTTCCTGGTTCTGTTCTCCATGGGTATCACGAAAGGCAAATGGT CTACTCTGGTTACCGAGCTGCTCGAATTCAAACGCTGTTACGACGCGAATCTGCCACTCCT GGATGTGCTGCCTTCTGTAGCGCAGGCGGGTGGTAAACGCTATAACGGTGTAGGTCTGCG TGATCTGTCCGATGCCATGCACGCTTCTTATCGTGACAATGCCACGGCGAAGGCCATGAA GCGTATGTATACGGTGCTCCCGGAAGTAGCCATGCGCCCGTCCGAAGCTTATGATAAGCT CGTACGCGGTGAAGTCGAAGCTGTTCCTATTGCACGTCTCGAGGGTCGTATTGCGGCGGT TATGCTGGTTCCGTACCCGCCAGGTATCCCGCTCATTATGCCGGGTGAACGTTTTACTGAA GCTACCCGCTCCATTCTGGACTATCTGGAGTTTGCCCGTACCTTCGAGCGCGCGTTCCCG GGCTTTGACTCTGATGTTCACGGCCTCCAACATCAAGATGGCCCGTCTGGCCGTTGTTATA CCGTTGAATGCATCAAGGAATAA SEQID:NO23(Idc2-co1A785C/A795CDNAsequence) ATGTACAAAGATCTGAAATTCCCTGTTCTGATTGTACACCGCGATATCAAGGCGGACACGG TAGCCGGCGAGCGTGTTCGCGGTATTGCCCACGAACTCGAACAAGACGGCTTTAGCATTC TCTCTACGGCGTCTTCTGCGGAAGGCCGCATTGTGGCTAGCACGCACCACGGTCTCGCCT GCATCCTCGTGGCAGCTGAGGGTGCGGGTGAGAATCAGCGTCTGCTCCAAGACGTGGTT GAGCTGATCCGTGTAGCTCGCGTCCGTGCGCCACAGCTCCCGATCTTCGCGCTGGGCGA ACAGGTGACTATTGAAAACGCGCCTGCCGAATCTATGGCCGACCTGCACCAGCTCCGCGG CATTCTGTATCTCTTCGAGGATACTGTCCCGTTCCTGGCACGTCAGGTTGCACGCGCAGC GCGTAACTACCTCGCTGGCCTCCTCCCGCCATTCTTCCGTGCACTCGTGGAGCACACGGC CCAAAGCAATTACTCTTGGCACACCCCGGGTCACGGTGGTGGTGTCGCTTACCGTAAATCT CCGGTAGGTCAAGCTTTCCACCAGTTCTTTGGCGAGAATACCCTCCGCTCTGACCTGTCTG TTAGCGTTCCAGAGCTGGGCAGCCTGCTGGATCACACTGGCCCTCTCGCGGAAGCAGAG GATCGTGCCGCTCGCAATTTCGGTGCGGACCACACCTTCTTTGTCATCAATGGTACCTCTA CTGCGAACAAAATCGTTTGGCACTCTATGGTTGGTCGCGAGGACCTGGTGCTGGTCGATC GTACCTGTCACAACTCTATTCTGCACTCCATTATCATGACGGGTGCTATCCCACTGTACCTG ACTCCGGAACGCAACGAACTGGGTATTATCGGCCCTATTCCACTCTCCGAGTTTTCTAAAC AATCTATCGCAGCAAAAATTGCCGCCTCCCCACTCGCGCGTGGTCGTGAACCGAAAGTTAA ACTGGCTGTCGTTACCAACTCTACCTATGACGGTCTGTGTTACAACGCGGAACTGATCAAA CAAACCCTCGGCGACTCTGTCGAGGTACTGCATTTCGACGAGGCTTGGTATGCTTATGCG GCGTTTCACGAGTTCTACGACGGCCGCTACGGTATGGGCACTTCTCGTTCCGAAGAGGGT CCGCTGGTCTTTGCTACCCATTCTACCCACAAGATGCTCGCGGCTTTTTCCCAAGCTAGCA TGATTCACGTTCAGGATGGTGGTACGCGCAAGCTGGACGTCGCCCGCTTTAACGAAGCCT TTATGATGCACATCAGCACCTCTCCACAGTACGGCATCATTGCGTCTCTCGATGTCGCAAG CGCTATGATGGAAGGTCCTGCCGGTCGTAGCCTGATCCAAGAGACGTTCGATGAGGCGCT GTCCTTCCGTCGTGCTCTGGCGAATGTCCGTCAGAACCTGGACCGTAATGATTGGTGGTT CGGTGTCTGGCAACCGGAGCAGGTTGAGGGCACCGACCAGGTAGGTACTCACGACTGGG TTCTCGAGCCTAGCGCGGACTGGCATGGTTTTGGTGACATTGCGGAGGATTACGTTCTCCT CGATCCTATCAAAGTTACCCTGACCACCCCAGGTCTGAGCGCTGGCGGTAAACTCTCTGAA CAAGGCATCCCGGCAGCTATCGTTAGCCGTTTCCTGTGGGAACGTGGTCTGGTGGTCGAG AAAACGGGTCTGTACTCTTTCCTGGTTCTGTTCTCCATGGGTATCACGAAAGGCAAATGGT CTACTCTGGTTACCGAGCTGCTCGAATTCAAACGCTGTTACGACGCGAATCTGCCACTCCT GGATGTGCTGCCTTCTGTAGCGCAGGCGGGTGGTAAACGCTATAACGGTGTAGGTCTGCG TGATCTGTCCGATGCCATGCACGCTTCTTATCGTGACAATGCCACGGCGAAGGCCATGAA GCGTATGTATACGGTGCTCCCGGAAGTAGCCATGCGCCCGTCCGAAGCTTATGATAAGCT CGTACGCGGTGAAGTCGAAGCTGTTCCTATTGCACGTCTCGAGGGTCGTATTGCGGCGGT TATGCTGGTTCCGTACCCGCCAGGTATCCCGCTCATTATGCCGGGTGAACGTTTTACTGAA GCTACCCGCTCCATTCTGGACTATCTGGAGTTTGCCCGTACCTTCGAGCGCGCGTTCCCG GGCTTTGACTCTGATGTTCACGGCCTCCAACATCAAGATGGCCCGTCTGGCCGTTGTTATA CCGTTGAATGCATCAAGGAATAA SEQID:NO24(Idc2-co1C332G/A785C/A795CDNAsequence) ATGTACAAAGATCTGAAATTCCCTGTTCTGATTGTACACCGCGATATCAAGGCGGACACGG TAGCCGGCGAGCGTGTTCGCGGTATTGCCCACGAACTCGAACAAGACGGCTTTAGCATTC TCTCTACGGCGTCTTCTGCGGAAGGCCGCATTGTGGCTAGCACGCACCACGGTCTCGCCT GCATCCTCGTGGCAGCTGAGGGTGCGGGTGAGAATCAGCGTCTGCTCCAAGACGTGGTT GAGCTGATCCGTGTAGCTCGCGTCCGTGCGCCACAGCTCCCGATCTTCGCGCTGGGCGA ACAGGTGACTATTGAAAACGCGCCTGCCGAATGTATGGCCGACCTGCACCAGCTCCGCGG CATTCTGTATCTCTTCGAGGATACTGTCCCGTTCCTGGCACGTCAGGTTGCACGCGCAGC GCGTAACTACCTCGCTGGCCTCCTCCCGCCATTCTTCCGTGCACTCGTGGAGCACACGGC CCAAAGCAATTACTCTTGGCACACCCCGGGTCACGGTGGTGGTGTCGCTTACCGTAAATCT CCGGTAGGTCAAGCTTTCCACCAGTTCTTTGGCGAGAATACCCTCCGCTCTGACCTGTCTG TTAGCGTTCCAGAGCTGGGCAGCCTGCTGGATCACACTGGCCCTCTCGCGGAAGCAGAG GATCGTGCCGCTCGCAATTTCGGTGCGGACCACACCTTCTTTGTCATCAATGGTACCTCTA CTGCGAACAAAATCGTTTGGCACTCTATGGTTGGTCGCGAGGACCTGGTGCTGGTCGATC GTACCTGTCACAACTCTATTCTGCACTCCATTATCATGACGGGTGCTATCCCACTGTACCTG ACTCCGGAACGCAACGAACTGGGTATTATCGGCCCTATTCCACTCTCCGAGTTTTCTAAAC AATCTATCGCAGCAAAAATTGCCGCCTCCCCACTCGCGCGTGGTCGTGAACCGAAAGTTAA ACTGGCTGTCGTTACCAACTCTACCTATGACGGTCTGTGTTACAACGCGGAACTGATCAAA CAAACCCTCGGCGACTCTGTCGAGGTACTGCATTTCGACGAGGCTTGGTATGCTTATGCG GCGTTTCACGAGTTCTACGACGGCCGCTACGGTATGGGCACTTCTCGTTCCGAAGAGGGT CCGCTGGTCTTTGCTACCCATTCTACCCACAAGATGCTCGCGGCTTTTTCCCAAGCTAGCA TGATTCACGTTCAGGATGGTGGTACGCGCAAGCTGGACGTCGCCCGCTTTAACGAAGCCT TTATGATGCACATCAGCACCTCTCCACAGTACGGCATCATTGCGTCTCTCGATGTCGCAAG CGCTATGATGGAAGGTCCTGCCGGTCGTAGCCTGATCCAAGAGACGTTCGATGAGGCGCT GTCCTTCCGTCGTGCTCTGGCGAATGTCCGTCAGAACCTGGACCGTAATGATTGGTGGTT CGGTGTCTGGCAACCGGAGCAGGTTGAGGGCACCGACCAGGTAGGTACTCACGACTGGG TTCTCGAGCCTAGCGCGGACTGGCATGGTTTTGGTGACATTGCGGAGGATTACGTTCTCCT CGATCCTATCAAAGTTACCCTGACCACCCCAGGTCTGAGCGCTGGCGGTAAACTCTCTGAA CAAGGCATCCCGGCAGCTATCGTTAGCCGTTTCCTGTGGGAACGTGGTCTGGTGGTCGAG AAAACGGGTCTGTACTCTTTCCTGGTTCTGTTCTCCATGGGTATCACGAAAGGCAAATGGT CTACTCTGGTTACCGAGCTGCTCGAATTCAAACGCTGTTACGACGCGAATCTGCCACTCCT GGATGTGCTGCCTTCTGTAGCGCAGGCGGGTGGTAAACGCTATAACGGTGTAGGTCTGCG TGATCTGTCCGATGCCATGCACGCTTCTTATCGTGACAATGCCACGGCGAAGGCCATGAA GCGTATGTATACGGTGCTCCCGGAAGTAGCCATGCGCCCGTCCGAAGCTTATGATAAGCT CGTACGCGGTGAAGTCGAAGCTGTTCCTATTGCACGTCTCGAGGGTCGTATTGCGGCGGT TATGCTGGTTCCGTACCCGCCAGGTATCCCGCTCATTATGCCGGGTGAACGTTTTACTGAA GCTACCCGCTCCATTCTGGACTATCTGGAGTTTGCCCGTACCTTCGAGCGCGCGTTCCCG GGCTTTGACTCTGATGTTCACGGCCTCCAACATCAAGATGGCCCGTCTGGCCGTTGTTATA CCGTTGAATGCATCAAGGAATAA
REFERENCES
[0185] The references, patents and published patent applications listed below, and all references cited in the specification above are hereby incorporated by reference in their entirety, as if fully set forth herein. [0186] 1. West S E and Iglewski B H (1988). Codon usage in Pseudomonas aeruginosa. Nucleic Acids Res 16: 9323-9335. [0187] 2. Wertz et al. Chimeric nature of two plasmids of H. alvei encoding the bacteriocins alveicins A and B. Journal of Bacteriology, (2004) 186: 1598-1605. [0188] 3. Datsenko K A & Wanner B L (2000). One-step inactivation of chromosomal genes in Escherichia coli K-12 using PCR products. PNAS: 6640-6645. [0189] 4. Papadakis et al., Promoters and Control Elements: Designing Expression Cassettes for Gene Therapy. Current Gene Therapy (2004), 4, 89-113.