Humanized antibodies for CD3
11472880 · 2022-10-18
Assignee
Inventors
- Thomas Tiller (Munich, DE)
- Steffen Runz (Heidelberg, DE)
- Julia Neugebauer (Munich, DE)
- Andreas Bültmann (Planegg, DE)
Cpc classification
C07K2317/41
CHEMISTRY; METALLURGY
C07K16/2809
CHEMISTRY; METALLURGY
C07K2317/33
CHEMISTRY; METALLURGY
C07K2317/73
CHEMISTRY; METALLURGY
C07K2317/24
CHEMISTRY; METALLURGY
C07K2317/64
CHEMISTRY; METALLURGY
C07K2317/70
CHEMISTRY; METALLURGY
C07K2317/92
CHEMISTRY; METALLURGY
International classification
Abstract
The present disclosure provides humanized antibodies that specifically bind to CD3 with an optimized affinity and induce T cell-mediated killing of tumour related target antigen high expressing cells with high potency but have limited killing activity on target antigen low expressing cells. The present disclosure also provides bispecific antibodies comprising a first antigen-binding domain that specifically binds to human CD3 with optimized affinity and a second antigen-binding molecule that specifically binds a tumor-related antigen. The disclosure further relates to methods of generating such humanized antibodies and bispecific antibodies for biological, diagnostic, pharmaceutical and other uses.
Claims
1. An antibody or antibody fragment specific for cluster of differentiation 3 (CD3), wherein said antibody or antibody fragment specifically binds to human CD3 and to non-human primate CD3, wherein said antibody or antibody fragment comprises a heavy chain variable domain of SEQ ID NO: 7 and a light chain variable domain of SEQ ID NO: 17.
2. The antibody or antibody fragment according to claim 1, wherein said antibody or antibody fragment specifically binds to human CD3 epsilon and cynomolgus monkey CD3 epsilon.
3. The antibody or antibody fragment according to claim 1, wherein said antibody or antibody fragment is a humanized or chimeric antibody or antibody fragment thereof.
4. The antibody or antibody fragment according to claim 1, wherein said antibody or antibody fragment is an isolated antibody or antibody fragment.
5. The antibody or antibody fragment according to claim 1, wherein said antibody or antibody fragment is a recombinant antibody or antibody fragment.
6. The antibody or antibody fragment according to claim 1, wherein the antibody is a full-length IgG.
7. The antibody or antibody fragment according to claim 6, wherein the full-length IgG is of an isotype selected from the group consisting of IgG1, IgG2, IgG3, and IgG4.
8. The antibody or antibody fragment according to claim 6, wherein the full-length IgG comprises an Fc region that has reduced effector function relative to that of a wild type Fc-receptor or an Fc region, wherein in at least 5 amino acids in the positions corresponding to positions L234, L235, D237, N330, P331 in a human IgG1 heavy chain, are mutated to A, E, A, S, and S, respectively.
9. The antibody or antibody fragment according to claim 1, wherein the antibody fragment is a Fab fragment.
10. The antibody or antibody fragment according to claim 1, wherein the antibody is a single chain antibody.
11. A pharmaceutical composition comprising the antibody or antibody fragment according to claim 1 and a pharmaceutically acceptable carrier or excipient.
12. A bispecific antibody comprising a first antigen binding domain of an antibody or antibody fragment according to claim 1, and a second antigen binding domain which binds a different target antigen than said first antigen binding region.
13. The bispecific antibody according claim 12, wherein the second binding region specifically binds a cell surface target antigen.
14. The bispecific antibody according to claim 12, wherein said bispecific antibody comprises an Fc region that has reduced effector function relative to that of a wild type Fc-receptor or an Fc region wherein in at least 5 amino acids in the positions corresponding to positions L234, L235, D237, N330, P331 in a human IgG1 heavy chain, are mutated to A, E, A, S, and S, respectively.
15. A method for treating or delaying progression of cancer in a subject in need thereof, said method comprising administering to the subject a bispecific antibody of claim 12 wherein the second antigen binding domain binds a tumor antigen.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
DETAILED DESCRIPTION OF THE DISCLOSURE
Definitions
(10) The term “CD3” refers to an antigen which is expressed on T cells as part of the multi-molecular T cell receptor (TCR) and which consists of a homodimer or heterodimer formed from the association of two of four receptor chains: CD3-epsilon, CD3-delta, CD3-zeta, and CD3-gamma.
(11) Human CD3 Epsilon has the Amino Acid Sequence of UniProt P07766
(12) TABLE-US-00001 (SEQ ID NO: 154) MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTC PQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVC YPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLL VYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQR DLYSGLNQRRI
(13) The extracellular domain of human CD3 epsilon without the signal sequence comprises amino acid residues 23-126 and has the amino acid sequence of as set forth in SEQ ID NO: 1 of TABLE 1.
(14) Cynomolgus CD3 Epsilon has the Amino Acid Sequence of UniProt Q95L15
(15) TABLE-US-00002 (SEQ ID NO: 155) MQSGTRWRVLGLCLLSIGVWGQDGNEEMGSITQTPYQVSISGTTVILTC SQHLGSEAQWQHNGKNKEDSGDRLFLPEFSEMEQSGYYVCYPRGSNPED ASHHLYLKARVCENCMEMDVMAVATIVIVDICITLGLLLLVYYWSKNRK AKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQQDLYSGLNQR RI
(16) The extracellular domain of cynomolgus monkey CD3 epsilon without the signal sequence comprises amino acid residues 22-117 and has the amino acid sequence of as set forth in SEQ ID NO: 2 of TABLE 1.
(17) The term “antibody” as used herein refers to a protein comprising at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds which interacts with an antigen. Each heavy chain is comprised of a heavy chain variable region or domain (abbreviated herein as VH) and a heavy chain constant region. The heavy chain constant region is comprised of three domains, CH1, CH2 and CH3. Each light chain is comprised of a light chain variable region or domain (abbreviated herein as VL) and a light chain constant region. The light chain constant region is comprised of one domain, CL. The VH and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR). Each VH and VL is composed of three CDRs and four FR's arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, and FR4. The variable regions of the heavy and light chains contain a binding domain that interacts with an antigen. The constant regions of the antibodies may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (Clq) of the classical complement system. The term “antibody” includes for example, monoclonal antibodies, human antibodies, humanized antibodies, camelised antibodies and chimeric antibodies. The antibodies can be of any isotype (e.g., IgG, IgE, IgM, IgD, IgA and IgY), class (e.g., IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2) or subclass. Both the light and heavy chains are divided into regions of structural and functional homology.
(18) The phrase “antibody fragment”, as used herein, refers to one or more portions of an antibody that retain the ability to specifically interact with (e.g., by binding, steric hindrance, stabilizing spatial distribution) an antigen. Examples of binding fragments include, but are not limited to, a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CH1 domains; a F(ab)2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; a Fd fragment consisting of the VH and CH1 domains; a Fv fragment consisting of the VL and VH domains of a single arm of an antibody; a dAb fragment (Ward et al., (1989) Nature 341:544-546), which consists of a VH domain; and an isolated complementarity determining region (CDR). Furthermore, although the two domains of the Fv fragment, VL and VH, are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules (known as single chain Fv (scFv); see e.g., Bird et al., (1988) Science 242:423-426; and Huston et al., (1988) Proc. Natl. Acad. Sci. 85:5879-5883). Such single chain antibodies are also intended to be encompassed within the term “antibody fragment”. These antibody fragments are obtained using conventional techniques known to those of skill in the art, and the fragments are screened for utility in the same manner as are intact antibodies. Antibody fragments can also be incorporated into single domain antibodies, maxibodies, minibodies, intrabodies, diabodies, triabodies, tetrabodies, v-NAR and bis-scFv (see, e.g., Hollinger and Hudson, (2005) Nature Biotechnology 23:1126-1136). Antibody fragments can be grafted into scaffolds based on polypeptides such as Fibronectin type III (Fn3) (see U.S. Pat. No. 6,703,199, which describes fibronectin polypeptide monobodies). Antibody fragments can be incorporated into single chain molecules comprising a pair of tandem Fv segments (VH-CH1-VH-CH1) which, together with complementary light chain polypeptides, form a pair of antigen-binding sites (Zapata et al., (1995) Protein Eng. 8:1057-1062; and U.S. Pat. No. 5,641,870).
(19) A “human antibody” or “human antibody fragment”, as used herein, includes antibodies and antibody fragments having variable regions in which both the framework and CDR regions are derived from sequences of human origin. Furthermore, if the antibody contains a constant region, the constant region also is derived from such sequences. Human origin includes, e.g., human germline sequences, or mutated versions of human germline sequences or antibody containing consensus framework sequences derived from human framework sequences analysis, for example, as described in Knappik et al., (2000) J Mol Biol 296:57-86). Thereby said human antibody can be obtained from technology platforms which comprise antibodies derived from human germline genes either generated by PCR-amplification of VHA/L repertoire isolated from B-cells or are generated synthetically. Technology platforms include library based approaches comprising human immunoglobulin genes displayed on phage, ribosome or yeast. Respective display technologies are standard in the scientific community. Furthermore immunization of a transgenic mouse carrying human immunoglobulin repertoire is another approach to generate human antibodies against an antigen of interest. Antibodies or fragments thereof selected from an antibody library based on the MorphoSys HuCAL® concept (Knappik et al., (2000) J Mol Biol 296:57-86) are considered as fully human.
(20) A “humanized antibody” or “humanized antibody fragment” is defined herein as an antibody or antibody fragment which has constant antibody regions derived from sequences of human origin and the variable antibody regions or parts thereof or only the CDRs are derived from another species. For example a humanized antibody can be CDR-grafted, wherein the CDRs of the variable domain are from a non-human origin, while one or more frameworks of the variable domain are of human origin and the constant domain (if any) is of human origin.
(21) The term “chimeric antibody” or “chimeric antibody fragment” is defined herein as an antibody molecule which has constant antibody regions derived from, or corresponding to, sequences found in one species and variable antibody regions derived from another species. Preferably, the constant antibody regions are derived from, or corresponding to, sequences found in humans, and the variable antibody regions (e.g. VH, VL, CDR or FR regions) are derived from sequences found in a non-human animal, e.g. a mouse, rat, rabbit or hamster.
(22) The structures and locations of immunoglobulin variable domains, e.g., CDRs, may be defined using well known numbering schemes, e.g., the Kabat numbering scheme, the Chothia numbering scheme, or a combination of Kabat and Chothia (see, e.g., Sequences of Proteins of Immunological Interest, U.S. Department of Health and Human Services (1991), eds. Kabat et al.; Lazikani et al., (1997) J. Mol. Bio. 273:927-948); Kabat et al., (1991) Sequences of Proteins of Immunological Interest, 5th edit., NIH Publication no. 91-3242 U.S. Department of Health and Human Services; Chothia et al., (1987) J. Mol. Biol. 196:901-917; Chothia et al., (1989) Nature 342:877-883; and Al-Lazikani et al., (1997) J. Mol. Biol. 273:927-948.
(23) The term “isolated” refers to a compound, which can be e.g. an antibody or antibody fragment, that is substantially free of other antibodies or antibody fragments having different antigenic specificities. Thus, in some aspects, antibodies provided are isolated antibodies which have been separated from antibodies with a different specificity. An isolated antibody may be a monoclonal antibody. An isolated antibody may be a recombinant monoclonal antibody. An isolated antibody that specifically binds to an epitope, isoform or variant of a target may, however, have cross-reactivity to other related antigens, e.g., from other species (e.g., species homologs).
(24) The term “recombinant antibody”, as used herein, includes all antibodies that are prepared, expressed, created or segregated by means not existing in nature. For example antibodies isolated from a host cell transformed to express the antibody, antibodies selected and isolated from a recombinant, combinatorial human antibody library, and antibodies prepared, expressed, created or isolated by any other means that involve splicing of all or a portion of a human immunoglobulin gene, sequences to other DNA sequences or antibodies isolated from an animal (e.g., a mouse) that is transgenic or transchromosomal for human immunoglobulin genes or a hybridoma prepared therefrom. Preferably, such recombinant antibodies have variable regions in which the framework and CDR regions are derived from human germline immunoglobulin sequences. In certain embodiments, however, such recombinant human antibodies can be subjected to in vitro mutagenesis (or, when an animal transgenic for human Ig sequences is used, in vivo somatic mutagenesis) and thus the amino acid sequences of the VH and VL regions of the recombinant antibodies are sequences that, while derived from and related to human germline VH and VL sequences, may not naturally exist within the human antibody germline repertoire in vivo. A recombinant antibody may be a monoclonal antibody.
(25) As used herein, the term “monoclonal antibody” refers to an antibody that is derived from a single clone, including any eukaryotic, prokaryotic, or phage clone, and not the method by which it is produced. Monoclonal antibodies as disclosed herein may be made by the hybridoma method as described in Kohler et al.; Nature, 256:495 (1975) or may be isolated from phage libraries using the techniques as described herein, for example. Other methods for the preparation of clonal cell lines and of monoclonal antibodies expressed thereby are well known in the art (see, for example, Chapter 11 in: Short Protocols in Molecular Biology, (2002) 5th Ed., Ausubel et al., eds., John Wiley and Sons, New York). Other exemplary methods of producing other monoclonal antibodies are provided in the Examples herein.
(26) As used herein, an antibody “binds specifically to”, “specifically binds to”, is “specific to/for” or “specifically recognizes” an antigen if such antibody is able to discriminate between such antigen and one or more reference antigen(s), since binding specificity is not an absolute, but a relative property. For example, a standard ELISA assay can be carried out. The scoring may be carried out by standard color development (e.g. secondary antibody with horseradish peroxide and tetramethyl benzidine with hydrogen peroxide). The reaction in certain wells is scored by the optical density, for example, at 450 nm. Typical background (=negative reaction) may be 0.1 OD; typical positive reaction may be 1 OD. This means the difference positive/negative can be more than 10-fold. Typically, determination of binding specificity is performed by using not a single reference antigen, but a set of about three to five unrelated antigens, such as milk powder, BSA, transferrin or the like.
(27) As used herein, “an antibody that binds to CD3” or an “anti-CD3 antibody” or “antibody specific for CD3” includes antibodies and antibody fragments that specifically recognize one or more CD3 subunit (e.g., epsilon, delta, gamma or zeta), as well as antibodies and antibody fragments that specifically recognize a dimeric complex of two CD3 subunits (e.g., gamma/epsilon, delta/epsilon, and zeta/zeta CD3 dimers). The antibodies and antibody fragments of the present disclosure may bind soluble CD3 and/or cell surface expressed CD3. Soluble CD3 includes natural CD3 proteins as well as recombinant CD3 protein variants such as, e.g., monomeric and dimeric CD3 constructs, that lack a transmembrane domain or are otherwise unassociated with a cell membrane.
(28) As used herein, the term “cell surface-expressed CD3” means one or more CD3 protein(s) that is/are expressed on the surface of a cell in vitro or in vivo, such that at least a portion of a CD3 protein is exposed to the extracellular side of the cell membrane and is accessible to an antigen-binding portion of an antibody. “Cell surface-expressed CD3” includes CD3 proteins contained within the context of a functional T cell receptor in the membrane of a cell. The expression “cell surface-expressed CD3” includes CD3 protein expressed as part of a homodimer or heterodimer on the surface of a cell (e.g., gamma/epsilon, delta/epsilon, and zeta/zeta CD3 dimers). The expression, “cell surface-expressed CD3” also includes a CD3 chain (e.g., CD3-epsilon, CD3-delta or CD3-gamma) that is expressed by itself, without other CD3 chain types, on the surface of a cell. A “cell surface-expressed CD3” can comprise or consist of a CD3 protein expressed on the surface of a cell which normally expresses CD3 protein. Alternatively, “cell surface-expressed CD3” can comprise or consist of CD3 protein expressed on the surface of a cell that normally does not express human CD3 on its surface but has been artificially engineered to express CD3 on its surface.
(29) As used herein, the term “affinity” refers to the strength of interaction between the polypeptide and its target at a single site. Within each site, the binding region of the polypeptide interacts through weak non-covalent forces with its target at numerous sites; the more interactions, the stronger the affinity.
(30) The term “K.sub.D”, as used herein, refers to the dissociation constant, which is obtained from the ratio of K.sub.d to K.sub.a (i.e. K.sub.d/K.sub.a) and is expressed as a molar concentration (M). K.sub.D values for antigen binding moieties like e.g. monoclonal antibodies can be determined using methods well established in the art. Methods for determining the K.sub.D of an antigen binding moiety like e.g. a monoclonal antibody are SET (soluble equilibrium titration) or surface plasmon resonance using a biosensor system such as a Biacore® system. In the present disclosure an antibody specific to the CD3 epsilon polypeptide typically has a dissociation rate constant (K.sub.D) (k.sub.off/k.sub.on) of less than 5×10.sup.−2M, less than 10.sup.−2M, less than 5×10.sup.−3M, less than 10.sup.−3M, less than 5×10.sup.−4M, less than 10.sup.−4M, less than 5×10.sup.−5M, less than 10.sup.−5M, less than 5×10.sup.−6M, less than 10.sup.−6M, less than 5×10.sup.−7M, less than 10.sup.−7M, less than 5×10.sup.−8M, less than 10.sup.−8M, less than 5×10.sup.−9M, less than 10.sup.−9M, less than 5×10.sup.−10M, less than 10.sup.−10M, less than 5×10.sup.−11M, less than 10.sup.−11M, less than 5×10.sup.−12M, less than 10.sup.−12M, less than 5×10.sup.−13M, less than 10.sup.−13M, less than 5×10.sup.−14M, less than 10.sup.−14M, less than 5×10.sup.−15M, or less than 10.sup.−15M or lower.
(31) The term “epitope” includes any proteinacious region which is specifically recognized by an antibody or fragment thereof or a T-cell receptor or otherwise interacts with a molecule. Generally epitopes are of chemically active surface groupings of molecules such as amino acids or carbohydrate or sugar side chains and generally may have specific three-dimensional structural characteristics, as well as specific charge characteristics. As will be appreciated by one of skill in the art, practically anything to which an antibody can specifically bind could be an epitope.
(32) “Binds the same epitope as” means the ability of an antibody, antibody fragment or other antigen-binding moiety to bind to a specific antigen and binding to the same epitope as the exemplified antibody when using the same epitope mapping technique for comparing the antibodies. The epitopes of the exemplified antibody and other antibodies can be determined using epitope mapping techniques. Epitope mapping techniques are well known in the art. For example, conformational epitopes are readily identified by determining spatial conformation of amino acids such as by, e.g., hydrogen/deuterium exchange, x-ray crystallography and two-dimensional nuclear magnetic resonance.
(33) Compositions of the present disclosure may be used for therapeutic or prophylactic applications. The present disclosure, therefore, includes a pharmaceutical composition containing an antibody (or functional antibody fragment) as disclosed herein and a pharmaceutically acceptable carrier or excipient therefor. In a related aspect, the present disclosure provides a method for treating cancer or an inflammatory disorder. Such method contains the steps of administering to a subject in need thereof an effective amount of the pharmaceutical composition that contains an antibody (or functional antibody fragment) as described or contemplated herein.
(34) The present disclosure provides therapeutic methods comprising the administration of a therapeutically effective amount of a humanized CD3 specific antibody or antibody fragment as disclosed to a subject in need of such treatment. A “therapeutically effective amount” or “effective amount”, as used herein, refers to the amount of an anti-CD3 antibody necessary to elicit the desired biological response. In accordance with the disclosure, the therapeutic effective amount is the amount of a CD3 specific antibody or antibody fragment necessary to treat and/or prevent a disease.
(35) “Species”, as used in this context refers to any mammal, including rodents, such as mouse or rat, and primates, such as cynomolgus monkey (Macaca fascicularis), rhesus monkey (Macaca mulatta) or humans (Homo sapiens). Preferably the subject is a primate, most preferably a human.
(36) The “non-chimpanzee primate” species may be understood within the meaning of the disclosure to be a lemur, a tarsier, a gibbon, a marmoset (belonging to New World Monkeys of the family Cebidae) or an Old-World Monkey (belonging to the superfamily Cercopithecoidea).
(37) As used herein, an “Old-World Monkey” comprises any monkey falling in the superfamily Cercopithecoidea, itself subdivided into the families: the Cercopithecinae, which are mainly African but include the diverse genus of macaques which are Asian and North African; and the Colobinae, which include most of the Asian genera but also the African colobus monkeys.
(38) An “acceptor human framework” for the purposes herein is a framework comprising the amino acid sequence of a light chain variable domain (VL) framework or a heavy chain variable domain (VH) framework derived from a human immunoglobulin framework or a human consensus framework, as defined below. An acceptor human framework “derived from” a human immunoglobulin framework or a human consensus framework may comprise the same amino acid sequence thereof, or it may contain amino acid sequence changes. In some embodiments, the number of amino acid changes are 10 or less, 9 or less, 8 or less, 7 or less, 6 or less, 5 or less, 4 or less, 3 or less, or 2 or less. In some embodiments, the VL acceptor human framework is identical in sequence to the VL human immunoglobulin framework sequence or human consensus framework sequence.
(39) A “human consensus framework” is a framework which represents the most commonly occurring amino acid residues in a selection of human immunoglobulin VL or VH framework sequences. Generally, the selection of human immunoglobulin VL or VH sequences is from a subgroup of variable domain sequences. Generally, the subgroup of sequences is a subgroup as in Kabat et at., Sequences of Proteins of Immunological Interest, Fifth Edition, NIH Publication 9 1-3242, Bethesda Md. (1991), vols. 1-3.
(40) A “disorder” is any condition that would benefit from treatment including, but not limited to, chronic and acute disorders or diseases including those pathological conditions which predispose the mammal to the disorder in question.
(41) The terms “cell proliferative disorder” and “proliferative disorder” refer to disorders that are associated with some degree of abnormal cell proliferation. In one embodiment, the cell proliferative disorder is cancer. In one embodiment, the cell proliferative disorder is a tumor.
(42) The terms “cancer” and “cancerous” refer to or describe the physiological condition in mammals that is typically characterized by unregulated cell growth.
(43) “Effector functions” refer to those biological activities attributable to the Fc region of an antibody, which vary with the antibody isotype. Examples of antibody effector functions include: Clq binding and complement dependent cytotoxicity (CDC); Fc receptor binding; antibody-dependent cell-mediated cytotoxicity (ADCC); phagocytosis; down regulation of cell surface receptors (e.g. B cell receptor); and B cell activation.
(44) An “effective amount” of a compound, for example, an CD3 specific antibody of the disclosure or a composition (e.g., pharmaceutical composition) thereof, is at least the minimum amount required to achieve the desired therapeutic or prophylactic result, such as a measurable improvement or prevention of a particular disorder (e.g., a cell proliferative disorder, e.g., cancer). An effective amount herein may vary according to factors such as the disease state, age, sex, and weight of the patient, and the ability of the antibody to elicit a desired response in the individual. An effective amount is also one in which any toxic or detrimental effects of the treatment are outweighed by the therapeutically beneficial effects. For prophylactic use, beneficial or desired results include results such as eliminating or reducing the risk, lessening the severity, or delaying the onset of the disease, including biochemical, histological and/or behavioral symptoms of the disease, its complications and intermediate pathological phenotypes presenting during development of the disease. For therapeutic use, beneficial or desired results include clinical results such as decreasing one or more symptoms resulting from the disease, increasing the quality of life of those suffering from the disease, decreasing the dose of other medications required to treat the disease, enhancing effect of another medication such as via targeting, delaying the progression of the disease, and/or prolonging survival. In the case of cancer or tumor, an effective amount of the drug may have the effect in reducing the number of cancer cells; reducing the tumor size; inhibiting (i.e., slow to some extent or desirably stop) cancer cell infiltration into peripheral organs; inhibit (i.e., slow to some extent and desirably stop) tumor metastasis; inhibiting to some extent tumor growth; and/or relieving to some extent one or more of the symptoms associated with the disorder. An effective amount can be administered in one or more administrations. For purposes of this disclosure, an effective amount of drug, compound, or pharmaceutical composition is an amount sufficient to accomplish prophylactic or therapeutic treatment either directly or indirectly. As is understood in the clinical context, an effective amount of a drug, compound, or pharmaceutical composition may or may not be achieved in conjunction with another drug, compound, or pharmaceutical composition. Thus, an “effective amount” may be considered in the context of administering one or more therapeutic agents, and a single agent may be considered to be given in an effective amount if, in conjunction with one or more other agents, a desirable result may be or is achieved.
(45) As used herein, “delaying progression” of a disorder or disease means to defer, hinder, slow, retard, stabilize, and/or postpone development of the disease or disorder (e.g., a cell proliferative disorder, e.g., cancer). This delay can be of varying lengths of time, depending on the history of the disease and/or individual being treated. As is evident to one skilled in the art, a sufficient or significant delay can, in effect, encompass prevention, in that the individual does not develop the disease. For example, a late stage cancer, such as development of metastasis, may be delayed.
(46) By “reduce” or “inhibit” is meant the ability to cause an overall decrease, for example, of 20% or greater, of 50% or greater, or of 75%, 85%, 90%, 95%, or greater.
(47) By “increase” is meant the ability to cause an overall increase, for example, of 20% or greater, of 50% or greater, or of 75%, 85%, 90%, 95%, or greater.
(48) The term “EC.sub.50”, as used herein, refers to the concentration of an antibody or an antibody fragment which induces a response in an assays half way between the baseline and maximum. It therefore represents the antibody concentration at which 50% of the maximal effect is observed.
(49) The term “IC.sub.50”, as used herein, refers to the concentration of an inhibitor (e.g. an antibody or antibody fragment) that inhibits a response in an assay half way between the maximal response and the baseline. It represents the antibody concentration that reduces a given response by 50%.
(50) The terms “inhibition” or “inhibit” or “reduction” or “reduce” or “neutralization” or “neutralize” refer to a decrease or cessation of any phenotypic characteristic (such as binding, a biological activity or function) or to the decrease or cessation in the incidence, degree, or likelihood of that characteristic. The “inhibition”, “reduction” or “neutralization” needs not to be complete as long as it is detectable using an appropriate assay. In some embodiments, by “reduce” or “inhibit” is meant the ability to cause a decrease of 20% or greater. In another embodiment, by “reduce” or “inhibit” is meant the ability to cause a decrease of 50% or greater. In yet another embodiment, by “reduce” or “inhibit” is meant the ability to cause an overall decrease of 75%, 85%, 90%, 95%, or greater.
(51) “Administration” and “treatment,” as it applies to an animal, human, experimental subject, cell, tissue, organ, or biological fluid, refers to contact of an exogenous pharmaceutical, therapeutic, diagnostic agent, or composition to the animal, human, subject, cell, tissue, organ, or biological fluid. “Administration” and “treatment” can refer, e.g., to therapeutic, pharmacokinetic, diagnostic, research, and experimental methods. Treatment of a cell encompasses contact of a reagent to the cell, as well as contact of a reagent to a fluid, where the fluid is in contact with the cell. “Administration” and “treatment” also means in vitro and ex vivo treatments, e.g., of a cell, by a reagent, diagnostic, binding composition, or by another cell. “Treatment,” as it applies to a human, veterinary, or research subject, refers to therapeutic treatment, prophylactic or preventative measures, to research and diagnostic applications. “Treatment” as it applies to a human, veterinary, or research subject, or cell, tissue, or organ, encompasses contact of an agent with animal subject, a cell, tissue, physiological compartment, or physiological fluid. “Treatment of a cell” also encompasses situations where the agent contacts PILR, e.g., in the fluid phase or colloidal phase, but also situations where the agonist or antagonist does not contact the cell or the receptor.
(52) Bispecific Antigen-Binding Molecules
(53) The CD3 specific antibodies or antibody fragments of the present disclosure can be linked to or co-expressed with another functional molecule, e.g., another peptide or protein. For example, an antibody or antibody fragment thereof can be functionally linked (e.g., by chemical coupling, genetic fusion, noncovalent association or otherwise) to one or more other molecular entities, such as another antibody or antibody fragment to produce a bispecific antibody with a second binding specificity.
(54) The antibodies of the present disclosure may be monospecific or bispecific antibodies. A bispecific antibody may be specific for different epitopes of one target antigen or may contain antigen-binding domains specific for more than one target antigen. See, e.g., Tutt et al., 1991, J. Immunol. 147:60-69; Kufer et al., 2004, Trends Biotechnol. 22:238-244.
(55) Use of the expression “anti-CD3 antibody” or “CD3 specific antibody” herein is intended to include both monospecific CD3 specific antibodies as well as bispecific antibodies. Bispecific antibodies according to the present disclosure were designed using an IgG-scFv format comprising a monoclonal IgG1 binding moiety and a scFv binding moiety, with the N-terminus of each scFv VL domain fused to the C-terminal end of each IgG heavy chain via a peptide linker. Both Fabs arms of the IgG may bind to the cell surface target antigen while the scFv is specific for CD3 (both scFv are identical and display the same specificity for CD3). Alternatively, bispecific antibodies can be generated, wherein the two scFv molecules were specific for cell surface target antigen and the Fab arms of the IgG1 portion are specific for CD3.
(56) The CD3 specific binding domains of the CD3 specific antibodies or antibody fragments of the present disclosure can comprise any of the heavy or light chain variable regions or CDR amino acid sequences as set forth in Tables 3-5 as disclosed herein.
(57) In the context of bispecific antibodies according to the present disclosure, the cell surface target antigen can be a cancer-associated antigen. Non-limiting examples of cancer related antigens include, e.g., an antigen that is expressed on the surface of a tumor.
(58) Any bispecific antibody format or technology may be used to make the bispecific antigen-binding molecules of the present disclosure. For example, an antibody or fragment thereof having a first antigen binding specificity can be functionally linked (e.g., by chemical coupling, genetic fusion, noncovalent association or otherwise) to one or more other molecular entities, such as another antibody or antibody fragment having a second antigen-binding specificity to produce a bispecific antigen-binding molecule.
(59) Specific exemplary bispecific formats that can be used in the context of the present disclosure include, without limitation, e.g., scFv-based or diabody bispecific formats, IgG-scFv fusions, dual variable domain (DVD)-Ig, Quadroma, knobs-into-holes, common light chain (e.g., common light chain with knobs-into-holes, etc.), CrossMab, CrossFab, (SEED)body, leucine zipper, Duobody, IgG1/IgG2, dual acting Fab (DAF)-IgG, and Mab.sup.2 bispecific formats (see, e.g., Klein et al. 2012, mAbs 4:6, 1-11, and references cited therein, for a review of the foregoing formats).
EMBODIMENTS
(60) Humanized antibodies or antibody fragment specific for CD3 according the present disclosure are listed in Table 5-7.
(61) In an embodiment, the present disclosure refers to an monoclonal antibody or antibody fragment specific for CD3 comprising the variable heavy chain (VH) and the variable light chain (VL) of any one of the antibodies disclosed in Table 5. In an embodiment, the present disclosure refers to an monoclonal antibody or antibody fragment specific for CD3 comprising the heavy chain (HC) and the light chain (LC) of any one of the antibodies disclosed in Tables 5-7. In an embodiment, the present disclosure refers to a monoclonal antibody or antibody fragment specific for CD3 comprising 6 CDRs defined by Kabat of any one of the antibodies disclosed in Tables 5. In an embodiment, the present disclosure refers to a monoclonal antibody or antibody fragment specific for CD3 comprising 6 CDRs of any one of the antibodies disclosed in Table 5.
(62) In an embodiment, the present disclosure provides an antibody or antibody fragment specific for cluster of differentiation 3 (CD3), wherein said antibody or antibody fragment specifically binds to human CD3 and to non-human primate CD3, wherein said antibody or antibody fragment comprises the HCDR1 region of SEQ ID NO: 23, the HCDR2 region of SEQ ID NO: 24, the HCDR3 region of SEQ ID NO: 25, the LCDR1 region of SEQ ID NO: 26, the LCDR2 region of SEQ ID NO: 27 and the LCDR3 region of SEQ ID NO: 28 or the HCDR1 region of SEQ ID NO: 23, the HCDR2 region of SEQ ID NO: 24, the HCDR3 region of SEQ ID NO: 25, the LCDR1 region of SEQ ID NO: 26, the LCDR2 region of SEQ ID NO: 65 and the LCDR3 region of SEQ ID NO: 28.
(63) In an embodiment, the present disclosure provides an antibody or antibody fragment specific for CD3, wherein said antibody or antibody fragment specifically binds to human CD3 epsilon and to non-human primate CD3 epsilon, wherein said antibody or antibody fragment comprises the HCDR1 region of SEQ ID NO: 23, the HCDR2 region of SEQ ID NO: 24, the HCDR3 region of SEQ ID NO: 25, the LCDR1 region of SEQ ID NO: 26, the LCDR2 region of SEQ ID NO: 27 and the LCDR3 region of SEQ ID NO: 28 or the HCDR1 region of SEQ ID NO: 23, the HCDR2 region of SEQ ID NO: 24, the HCDR3 region of SEQ ID NO: 25, the LCDR1 region of SEQ ID NO: 26, the LCDR2 region of SEQ ID NO: 65 and the LCDR3 region of SEQ ID NO: 28.
(64) In an embodiment, the present disclosure provides an antibody or antibody fragment specific for CD3, wherein said antibody or antibody fragment specifically binds to human CD3 and to non-human primate CD3, wherein said antibody or antibody fragment comprises the HCDR1 region of SEQ ID NO: 23, the HCDR2 region of SEQ ID NO: 24, the HCDR3 region of SEQ ID NO: 25, the LCDR1 region of SEQ ID NO: 26, the LCDR2 region of SEQ ID NO: 27 and the LCDR3 region of SEQ ID NO: 28
(65) In an embodiment, the present disclosure provides an antibody or antibody fragment specific for CD3, wherein said antibody or antibody fragment specifically binds to human CD3 and to non-human primate CD3, wherein said antibody or antibody fragment comprises the HCDR1 region of SEQ ID NO: 23, the HCDR2 region of SEQ ID NO: 24, the HCDR3 region of SEQ ID NO: 25, the LCDR1 region of SEQ ID NO: 26, the LCDR2 region of SEQ ID NO: 65 and the LCDR3 region of SEQ ID NO: 28.
(66) In an embodiment, the present disclosure provides an antibody or antibody fragment specific for cluster of differentiation 3 (CD3), wherein said antibody or antibody fragment specifically binds to human CD3 and to non-human primate CD3, wherein said antibody or antibody fragment comprises the HCDR1 region comprising the amino acid sequence of SEQ ID NO: 23, the HCDR2 region comprising the amino acid sequence of SEQ ID NO: 24, the HCDR3 region comprising the amino acid sequence of SEQ ID NO: 25, the LCDR1 region comprising the amino acid sequence of SEQ ID NO: 26, the LCDR2 region comprising the amino acid sequence of SEQ ID NO: 27 and the LCDR3 region comprising the amino acid sequence of SEQ ID NO: 28 or the HCDR1 region comprising the amino acid sequence of SEQ ID NO: 23, the HCDR2 region comprising the amino acid sequence of SEQ ID NO: 24, the HCDR3 region comprising the amino acid sequence of SEQ ID NO: 25, the LCDR1 region comprising the amino acid sequence of SEQ ID NO: 26, the LCDR2 region comprising the amino acid sequence of SEQ ID NO: 65 and the LCDR3 region comprising the amino acid sequence of SEQ ID NO: 28.
(67) In one embodiment of the present disclosure, the antibody or antibody fragment specific for CD3 according to the present disclosure is a humanized, chimeric or synthetic antibody or antibody fragment.
(68) In an embodiment, the antibody or antibody fragment according to the present disclosure is an isolated antibody or antibody fragment. In an embodiment, the antibody or antibody fragment according to the present disclosure is a recombinant antibody or antibody fragment. In another embodiment of the present disclosure the antibody or antibody fragment is a monoclonal antibody or antibody fragment. In an embodiment, said antibody or antibody fragment is a humanized monoclonal human antibody or antibody fragment.
(69) In an embodiment, the antibody of the present disclosure is a full-length IgG. In an embodiment, the antibody of the present disclosure is a full-length IgG of an isotype selected from the group consisting of IgG1, IgG2, IgG3, and IgG4. In another embodiment the antibody is of the IgG1 isotype. In an embodiment, the antibody is of the human IgG1 isotype.
(70) In an embodiment, the antibody of the present disclosure comprises a Fc region that has reduced effector function relative to that of a wild type Fc-receptor. In an embodiment, the antibody of the present disclosure comprises a Fc region, wherein in at least 5 amino acids in the positions corresponding to positions L234, L235, D237, N330, P331 in a human IgG1 heavy chain, are mutated to A, E, A, S, and S, respectively.
(71) In one embodiment, the antibody fragment is selected from the group consisting of a Fab, a Fab′, a Fv, a scFv. In an embodiment, the antibody or antibody fragment of the present disclosure is a Fab fragment. In an embodiment, the antibody or antibody fragment of the present disclosure is a single chain antibody.
(72) In an embodiment of the present disclosure, the antibody or antibody fragment specifically binds to human CD3 and cynomolgus CD3. In a further embodiment, the antibody or antibody fragment according to the present disclosure specifically binds to human CD3 epsilon and cynomolgus CD3 epsilon.
(73) In an embodiment, the antibody or antibody fragment according to the present disclosure is a humanized or chimeric antibody or antibody fragment thereof.
(74) In an embodiment, the present disclosure provides an antibody or antibody fragment specific for CD3, wherein said antibody or antibody fragment specifically binds to human CD3 and to non-human primate CD3, wherein said antibody or antibody fragment comprises
(75) the HCDR1 region of SEQ ID NO: 23, the HCDR2 region of SEQ ID NO: 24, the HCDR3 region of SEQ ID NO: 25, the LCDR1 region of SEQ ID NO: 26, the LCDR2 region of SEQ ID NO: 27 and the LCDR3 region of SEQ ID NO: 28, and further comprises the heavy chain variable region having SEQ ID NO: 30 and a light chain variable region having SEQ ID NO: 29
(76) or
(77) the HCDR1 region of SEQ ID NO: 23, the HCDR2 region of SEQ ID NO: 24, the HCDR3 region of SEQ ID NO: 25, the LCDR1 region of SEQ ID NO: 26, the LCDR2 region of SEQ ID NO: 27 and the LCDR3 region of SEQ ID NO: 28, and further comprises the heavy chain variable region having SEQ ID NO: 46 and a light chain variable region having SEQ ID NO: 45
(78) or
(79) the HCDR1 region of SEQ ID NO: 23, the HCDR2 region of SEQ ID NO: 24, the HCDR3 region of SEQ ID NO: 25, the LCDR1 region of SEQ ID NO: 26, the LCDR2 region of SEQ ID NO: 27 and the LCDR3 region of SEQ ID NO: 28, and further comprises the heavy chain variable region having SEQ ID NO: 56 and a light chain variable region having SEQ ID NO: 55
(80) or
(81) the HCDR1 region of SEQ ID NO: 23, the HCDR2 region of SEQ ID NO: 24, the HCDR3 region of SEQ ID NO: 25, the LCDR1 region of SEQ ID NO: 26, the LCDR2 region of SEQ ID NO: 65 and the LCDR3 region of SEQ ID NO: 28, and further comprises the heavy chain variable region having SEQ ID NO: 68 and a light chain variable region having SEQ ID NO: 67
(82) or
(83) the HCDR1 region of SEQ ID NO: 23, the HCDR2 region of SEQ ID NO: 24, the HCDR3 region of SEQ ID NO: 25, the LCDR1 region of SEQ ID NO: 26, the LCDR2 region of SEQ ID NO: 65 and the LCDR3 region of SEQ ID NO: 28, and further comprises the heavy chain variable region having SEQ ID NO: 78 and a light chain variable region having SEQ ID NO: 77
(84) or
(85) the HCDR1 region of SEQ ID NO: 23, the HCDR2 region of SEQ ID NO: 24, the HCDR3 region of SEQ ID NO: 25, the LCDR1 region of SEQ ID NO: 26, the LCDR2 region of SEQ ID NO: 65 and the LCDR3 region of SEQ ID NO: 28, and further comprises the heavy chain variable region having SEQ ID NO: 86 and a light chain variable region having SEQ ID NO: 85
(86) or
(87) the HCDR1 region of SEQ ID NO: 23, the HCDR2 region of SEQ ID NO: 24, the HCDR3 region of SEQ ID NO: 25, the LCDR1 region of SEQ ID NO: 26, the LCDR2 region of SEQ ID NO: 27 and the LCDR3 region of SEQ ID NO: 28, and further comprises the heavy chain variable region having SEQ ID NO: 96 and a light chain variable region having SEQ ID NO: 95.
(88) In an embodiment, the present disclosure provides an antibody or antibody fragment specific for CD3, wherein said antibody or antibody fragment specifically binds to human CD3 and to non-human primate CD3, wherein said antibody or antibody fragment comprises
(89) the HCDR1 region of SEQ ID NO: 23, the HCDR2 region of SEQ ID NO: 24, the HCDR3 region of SEQ ID NO: 25, the LCDR1 region of SEQ ID NO: 26, the LCDR2 region of SEQ ID NO: 27 and the LCDR3 region of SEQ ID NO: 28, and further comprises the heavy chain variable region having SEQ ID NO: 9 and a light chain variable region having SEQ ID NO: 11
(90) or
(91) the HCDR1 region of SEQ ID NO: 23, the HCDR2 region of SEQ ID NO: 24, the HCDR3 region of SEQ ID NO: 25, the LCDR1 region of SEQ ID NO: 26, the LCDR2 region of SEQ ID NO: 27 and the LCDR3 region of SEQ ID NO: 28, and further comprises the heavy chain variable region having SEQ ID NO: 9 and a light chain variable region having SEQ ID NO: 13
(92) or
(93) the HCDR1 region of SEQ ID NO: 23, the HCDR2 region of SEQ ID NO: 24, the HCDR3 region of SEQ ID NO: 25, the LCDR1 region of SEQ ID NO: 26, the LCDR2 region of SEQ ID NO: 27 and the LCDR3 region of SEQ ID NO: 28, and further comprises the heavy chain variable region having SEQ ID NO: 7 and a light chain variable region having SEQ ID NO: 15
(94) or
(95) the HCDR1 region of SEQ ID NO: 23, the HCDR2 region of SEQ ID NO: 24, the HCDR3 region of SEQ ID NO: 25, the LCDR1 region of SEQ ID NO: 26, the LCDR2 region of SEQ ID NO: 65 and the LCDR3 region of SEQ ID NO: 28, and further comprises the heavy chain variable region having SEQ ID NO: 7 and a light chain variable region having SEQ ID NO: 17
(96) or
(97) the HCDR1 region of SEQ ID NO: 23, the HCDR2 region of SEQ ID NO: 24, the HCDR3 region of SEQ ID NO: 25, the LCDR1 region of SEQ ID NO: 26, the LCDR2 region of SEQ ID NO: 65 and the LCDR3 region of SEQ ID NO: 28, and further comprises the heavy chain variable region having SEQ ID NO: 7 and a light chain variable region having SEQ ID NO: 19
(98) or
(99) the HCDR1 region of SEQ ID NO: 23, the HCDR2 region of SEQ ID NO: 24, the HCDR3 region of SEQ ID NO: 25, the LCDR1 region of SEQ ID NO: 26, the LCDR2 region of SEQ ID NO: 65 and the LCDR3 region of SEQ ID NO: 28, and further comprises the heavy chain variable region having SEQ ID NO: 9 and a light chain variable region having SEQ ID NO: 19
(100) or
(101) the HCDR1 region of SEQ ID NO: 23, the HCDR2 region of SEQ ID NO: 24, the HCDR3 region of SEQ ID NO: 25, the LCDR1 region of SEQ ID NO: 26, the LCDR2 region of SEQ ID NO: 27 and the LCDR3 region of SEQ ID NO: 28, and further comprises the heavy chain variable region having SEQ ID NO: 9 and a light chain variable region having SEQ ID NO: 21
(102) In an embodiment, the present disclosure provides an antibody or antibody fragment specific for CD3, wherein said antibody or antibody fragment specifically binds to human CD3 and to non-human primate CD3, wherein said antibody or antibody fragment comprises the HCDR1 region of SEQ ID NO: 23, the HCDR2 region of SEQ ID NO: 24, the HCDR3 region of SEQ ID NO: 25, the LCDR1 region of SEQ ID NO: 26, the LCDR2 region of SEQ ID NO: 65 and the LCDR3 region of SEQ ID NO: 28, and further comprises the heavy chain variable region having SEQ ID NO: 68 and a light chain variable region having SEQ ID NO: 67.
(103) In an embodiment, the present disclosure provides an antibody or antibody fragment specific for CD3, wherein said antibody or antibody fragment specifically binds to human CD3 and to non-human primate CD3, wherein said antibody or antibody fragment comprises the HCDR1 region of SEQ ID NO: 23, the HCDR2 region of SEQ ID NO: 24, the HCDR3 region of SEQ ID NO: 25, the LCDR1 region of SEQ ID NO: 26, the LCDR2 region of SEQ ID NO: 65 and the LCDR3 region of SEQ ID NO: 28, and further comprises the heavy chain variable region having SEQ ID NO: 7 and a light chain variable region having SEQ ID NO: 17.
(104) In further embodiments, the present disclosure provides an antibody or antibody fragment specific for CD3, wherein said antibody or antibody fragment comprises a) a variable light chain selected from the group consisting of SEQ ID NO: 11, SEQ ID NO: 13, SEQ ID NO: 15, SEQ ID NO: 17, SEQ ID NO: 19 and SEQ ID NO: 21 and b) a variable heavy chain selected from the group consisting of SEQ ID NO: 7 and SEQ ID NO: 9.
(105) In an embodiment, the present disclosure refers to an antibody or antibody fragment specific for CD3, wherein said antibody or antibody fragment comprises a) the variable heavy chain of SEQ ID NO: 9 and the variable light chain of SEQ ID NO: 11 or b) the variable heavy chain of SEQ ID NO: 9 and the variable light chain of SEQ ID NO: 13 or c) the variable heavy chain of SEQ ID NO: 7 and the variable light chain of SEQ ID NO: 15 or d) the variable heavy chain of SEQ ID NO: 7 and the variable light chain of SEQ ID NO: 17 or e) the variable heavy chain of SEQ ID NO: 7 and the variable light chain of SEQ ID NO: 19 or f) the variable heavy chain of SEQ ID NO: 9 and the variable light chain of SEQ ID NO: 19 or g) the variable heavy chain of SEQ ID NO: 9 and the variable light chain of SEQ ID NO: 21 or
(106) a variable heavy chain and a variable light chain that has at least 60%, at least 70%, at least 80%, at least 90% or at least 95% identity to the variable heavy chain of SEQ ID NO: 17, 28, 39 or 50 and to the variable light chain of SEQ ID NO: 18, 29, 40 or 51.
(107) In further embodiments, the present disclosure provides an antibody or antibody fragment specific for CD3, wherein the variable heavy chain consists of SEQ ID NO: 7 and the variable light chain consist of SEQ ID NO: 11.
(108) In further embodiments, the present disclosure provides an antibody or antibody fragment specific for CD3, wherein the variable heavy chain consists of SEQ ID NO: 7 and the variable light chain consist of SEQ ID NO: 13.
(109) In further embodiments, the present disclosure provides an antibody or antibody fragment specific for CD3, wherein the variable heavy chain consists of SEQ ID NO: 7 and the variable light chain consist of SEQ ID NO: 15.
(110) In further embodiments, the present disclosure provides an antibody or antibody fragment specific for CD3, wherein the variable heavy chain consists of SEQ ID NO: 7 and the variable light chain consist of SEQ ID NO 17.
(111) In further embodiments, the present disclosure provides an antibody or antibody fragment specific for CD3, wherein the variable heavy chain consists of SEQ ID NO: 7 and the variable light chain consist of SEQ ID NO: 19.
(112) In further embodiments, the present disclosure provides an antibody or antibody fragment specific for CD3, wherein the variable heavy chain consists of SEQ ID NO: 7 and the variable light chain consist of SEQ ID NO: 21.
(113) In further embodiments, the present disclosure provides an antibody or antibody fragment specific for CD3, wherein the variable heavy chain consists of SEQ ID NO: 9 and the variable light chain consist of SEQ ID NO: 11.
(114) In further embodiments, the present disclosure provides an antibody or antibody fragment specific for CD3, wherein the variable heavy chain consists of SEQ ID NO: 9 and the variable light chain consist of SEQ ID NO: 13.
(115) In further embodiments, the present disclosure provides an antibody or antibody fragment specific for CD3, wherein the variable heavy chain consists of SEQ ID NO: 9 and the variable light chain consist of SEQ ID NO: 15.
(116) In further embodiments, the present disclosure provides an antibody or antibody fragment specific for CD3, wherein the variable heavy chain consists of SEQ ID NO: 9 and the variable light chain consist of SEQ ID NO: 17.
(117) In further embodiments, the present disclosure provides an antibody or antibody fragment specific for CD3, wherein the variable heavy chain consists of SEQ ID NO: 9 and the variable light chain consist of SEQ ID NO: 19.
(118) In further embodiments, the present disclosure provides an antibody or antibody fragment specific for CD3, wherein the variable heavy chain consists of SEQ ID NO: 9 and the variable light chain consist of SEQ ID NO: 21.
(119) In further embodiments, the present disclosure provides an antibody or antibody fragment specific for CD3, wherein the variable heavy chain and variable light chain are selected from the group consisting of:
(120) the variable heavy chain domain having SEQ ID NO: 7 and the variable light chain having SEQ ID NO: 15;
(121) the variable heavy chain domain having SEQ ID NO: 7 and the variable light chain having SEQ ID NO: 17 and
(122) the variable heavy chain domain having SEQ ID NO: 7 and the variable light chain having SEQ ID NO: 19.
(123) In an embodiment, the present disclosure provides an antibody or antibody fragment specific for CD3, wherein the variable heavy chain comprises SEQ ID NO: 7 and the variable light chain comprises SEQ ID NO 17 or a sequence having at least 60%, at least 70%, at least 80%, at least 90%, or at least 95% identity with these sequences but which retains the same activity as the said antibody or antibody fragment.
(124) In an embodiment, the present disclosure provides an antibody or antibody fragment specific for CD3, wherein the variable heavy chain comprises SEQ ID NO: 7 and the variable light chain comprises SEQ ID NO 17.
(125) Bispecific Antibodies
(126) In an embodiment, the present disclosure provides a bispecific antibody comprising a first antigen binding domain specific for CD3 and a second binding domain which binds a different target than said first antigen binding region, wherein said first binding domain specific for CD3 comprises
(127) the HCDR1 region of SEQ ID NO: 23, the HCDR2 region of SEQ ID NO: 24, the HCDR3 region of SEQ ID NO: 25, the LCDR1 region of SEQ ID NO: 26, the LCDR2 region of SEQ ID NO: 27 and the LCDR3 region of SEQ ID NO: 28
(128) or
(129) the HCDR1 region of SEQ ID NO: 23, the HCDR2 region of SEQ ID NO: 24, the HCDR3 region of SEQ ID NO: 25, the LCDR1 region of SEQ ID NO: 26, the LCDR2 region of SEQ ID NO: 65 and the LCDR3 region of SEQ ID NO: 28.
(130) In an embodiment, the present disclosure provides a bispecific antibody comprising a first antigen binding domain specific for CD3 and a second binding domain, wherein said second binding domain specifically binds a cell surface target antigen and wherein said binding domain specific for CD3 comprises
(131) the HCDR1 region of SEQ ID NO: 23, the HCDR2 region of SEQ ID NO: 24, the HCDR3 region of SEQ ID NO: 25, the LCDR1 region of SEQ ID NO: 26, the LCDR2 region of SEQ ID NO: 27 and the LCDR3 region of SEQ ID NO: 28
(132) or
(133) the HCDR1 region of SEQ ID NO: 23, the HCDR2 region of SEQ ID NO: 24, the HCDR3 region of SEQ ID NO: 25, the LCDR1 region of SEQ ID NO: 26, the LCDR2 region of SEQ ID NO: 65 and the LCDR3 region of SEQ ID NO: 28.
(134) In an embodiment, the bispecific antibody of the present disclosure binds to CD3 located on an immune effector cell and a cell surface target antigen that is expressed on a target cell other than the immune effector cell, wherein the bispecific antibody comprises an binding domain specific for CD3 comprising
(135) the HCDR1 region of SEQ ID NO: 23, the HCDR2 region of SEQ ID NO: 24, the HCDR3 region of SEQ ID NO: 25, the LCDR1 region of SEQ ID NO: 26, the LCDR2 region of SEQ ID NO: 27 and the LCDR3 region of SEQ ID NO: 28
(136) or
(137) the HCDR1 region of SEQ ID NO: 23, the HCDR2 region of SEQ ID NO: 24, the HCDR3 region of SEQ ID NO: 25, the LCDR1 region of SEQ ID NO: 26, the LCDR2 region of SEQ ID NO: 65 and the LCDR3 region of SEQ ID NO: 28.
(138) In an embodiment, the cell surface target antigen is a tumor antigen. In an embodiment, said immune effector cell is a cytotoxic T-lymphocytes.
(139) In an embodiment, the present disclosure provides a bispecific antibody comprising a first antigen binding domain specific for CD3 and a second binding domain, wherein said second binding domain specifically binds a cell surface target antigen and wherein said bispecific antibody comprises a modified Fc region wherein in at least 5 amino acids in the positions corresponding to positions L234, L235, D237, N330, P331 in a human IgG1 heavy chain, are mutated to A, E, A, S, and S, respectively.
(140) In an embodiment, the present disclosure provides a bispecific antibody comprising a first antigen binding domain specific for CD3 and a second binding domain, wherein said second binding domain specifically binds a cell surface target antigen and wherein said bispecific antibody comprises a modified Fc region wherein in at least 5 amino acids in the positions corresponding to positions L234, L235, D237, N330, P331 in a human IgG1 heavy chain, are mutated to A, E, A, S, and S, respectively and wherein said binding domain specific for CD3 comprises
(141) the HCDR1 region of SEQ ID NO: 23, the HCDR2 region of SEQ ID NO: 24, the HCDR3 region of SEQ ID NO: 25, the LCDR1 region of SEQ ID NO: 26, the LCDR2 region of SEQ ID NO: 27 and the LCDR3 region of SEQ ID NO: 28
(142) or
(143) the HCDR1 region of SEQ ID NO: 23, the HCDR2 region of SEQ ID NO: 24, the HCDR3 region of SEQ ID NO: 25, the LCDR1 region of SEQ ID NO: 26, the LCDR2 region of SEQ ID NO: 65 and the LCDR3 region of SEQ ID NO: 28.
(144) In further embodiment, said bispecific antibody according to the present comprises a first antigen binding domain, wherein said first antigen binding domain comprises an antibody or antibody fragment specific for CD3, wherein said antibody or antibody fragment comprises a) the variable heavy chain of SEQ ID NO: 9 and the variable light chain of SEQ ID NO: 11 or b) the variable heavy chain of SEQ ID NO: 9 and the variable light chain of SEQ ID NO: 13 or c) the variable heavy chain of SEQ ID NO: 7 and the variable light chain of SEQ ID NO: 15 or d) the variable heavy chain of SEQ ID NO: 7 and the variable light chain of SEQ ID NO: 17 or e) the variable heavy chain of SEQ ID NO: 7 and the variable light chain of SEQ ID NO: 19 or f) the variable heavy chain of SEQ ID NO: 9 and the variable light chain of SEQ ID NO: 19 or g) the variable heavy chain of SEQ ID NO: 9 and the variable light chain of SEQ ID NO: 21 or
a variable heavy chain and a variable light chain that has at least 60%, at least 70%, at least 80%, at least 90% or at least 95% identity to the variable heavy chain of SEQ ID NO: 17, 28, 39 or 50 and to the variable light chain of SEQ ID NO: 18, 29, 40 or 51.
(145) In further embodiment, said bispecific antibody according to the present comprises a first antigen binding domain, wherein said first antigen binding domain comprises an antibody or antibody fragment specific for CD3, wherein said antibody or antibody fragment comprises the variable heavy chain of SEQ ID NO: 7 and the variable light chain of SEQ ID NO: 17 or a variable heavy chain and a variable light chain that has at least 60%, at least 70%, at least 80%, at least 90% or at least 95% identity to the variable heavy chain of SEQ ID NO: 7 and to the variable light chain of SEQ ID NO: 17.
(146) In an embodiment, the present disclosure provides a nucleic acid sequence or a plurality of nucleic acid sequences encoding an antibody or antibody fragment according to the present disclosure which specifically binds to CD3.
(147) In an embodiment, the present disclosure provides a nucleic acid composition comprising a nucleic acid sequence or a plurality of nucleic acid sequences encoding the antibody or antibody fragment specific for CD3 according to the present disclosure, wherein said antibody or antibody fragment comprises the
(148) HCDR1 region of SEQ ID NO: 23, the HCDR2 region of SEQ ID NO: 24, the HCDR3 region of SEQ ID NO: 25, the LCDR1 region of SEQ ID NO: 26, the LCDR2 region of SEQ ID NO: 27 and the LCDR3 region of SEQ ID NO: 28
(149) or
(150) the HCDR1 region of SEQ ID NO: 23, the HCDR2 region of SEQ ID NO: 24, the HCDR3 region of SEQ ID NO: 25, the LCDR1 region of SEQ ID NO: 26, the LCDR2 region of SEQ ID NO: 65 and the LCDR3 region of SEQ ID NO: 28.
(151) In another embodiment, the present disclosure refers to an isolated nucleic acid or a plurality of nucleic acid sequences encoding a heavy chain sequence and/or light chain sequence of an antibody or antibody fragment specific for CD3, the nucleic acid comprising a) the HCDR1 region of SEQ ID NO: 33, the HCDR2 region of SEQ ID NO: 34, the HCDR3 region of SEQ ID NO: 35, the LCDR1 region of SEQ ID NO: 36, the LCDR2 region of SEQ ID NO: 37 and the LCDR3 region of SEQ ID NO: 38, or b) the HCDR1 region of SEQ ID NO: 33, the HCDR2 region of SEQ ID NO: 34, the HCDR3 region of SEQ ID NO: 35, the LCDR1 region of SEQ ID NO: 36, the LCDR2 region of SEQ ID NO: 66 and the LCDR3 region of SEQ ID NO: 38,
(152) In another embodiment, the present disclosure refers to an isolated nucleic acid or a plurality of nucleic acid sequences encoding a heavy chain sequence and/or light chain sequence of an antibody or antibody fragment specific for CD3, the nucleic acid comprising a) the HCDR1 region comprising the nucleic acid sequence of SEQ ID NO: 33, the HCDR2 region comprising the nucleic acid sequence of SEQ ID NO: 34, the HCDR3 region comprising the nucleic acid sequence of SEQ ID NO: 35, the LCDR1 region comprising the nucleic acid sequence of SEQ ID NO: 36, the LCDR2 region comprising the nucleic acid sequence of SEQ ID NO: 37 and the LCDR3 region comprising the nucleic acid sequence of SEQ ID NO: 38, or b) the HCDR1 region comprising the nucleic acid sequence of SEQ ID NO: 33, the HCDR2 region comprising the nucleic acid sequence of SEQ ID NO: 34, the HCDR3 region comprising the nucleic acid sequence of SEQ ID NO: 35, the LCDR1 region comprising the nucleic acid sequence of SEQ ID NO: 36, the LCDR2 region comprising the nucleic acid sequence of SEQ ID NO: 66 and the LCDR3 region comprising the nucleic acid sequence of SEQ ID NO: 38,
(153) In an embodiment, the present disclosure refers to a nucleic acid sequence or a plurality of nucleic acid sequences encoding an antibody or antibody fragment specific for CD3, wherein the nucleic acid sequence or plurality of nucleic acid sequences comprises the VH of SEQ ID NO: 70 and/or the VL of SEQ ID NO: 69, or the VH and/or the VL that has at least 60%, at least 70%, at least 80%, at least 90% or at least 95% identity to the VH of SEQ ID NO: 70 and the VL of SEQ ID NO: 69.
(154) In an embodiment, the present disclosure refers to a nucleic acid sequence or a plurality of nucleic acid sequences encoding an antibody or antibody fragment specific for CD3, wherein the nucleic acid sequence or plurality of nucleic acid sequences comprises the VH of SEQ ID NO: 8 and/or the VL of SEQ ID NO: 18, or the VH and/or the VL that has at least 60%, at least 70%, at least 80%, at least 90% or at least 95% identity to the VH of SEQ ID NO: 8 and the VL of SEQ ID NO: 18.
(155) In an embodiment, the present disclosure provides a vector composition comprising a vector or a plurality of vectors comprising the nucleic acid sequence or plurality of nucleic acid sequences encoding an antibody or antibody fragment as disclosed in TABLE 5-7.
(156) In an embodiment, the present disclosure refers to a vector composition comprising a vector or a plurality of vectors comprising a nucleic acid sequence or plurality of nucleic acid sequences disclosed in Tables 3-7. In an embodiment, the present disclosure provides a vector comprising a nucleic acid encoding an antibody or antibody fragment specific for CD3 according to the present disclosure. In an embodiment, the present disclosure provides a vector comprising a nucleic acid disclosed in Tables 3-7. In an embodiment, the present disclosure provides a vector comprising a nucleic acid encoding an antibody or antibody fragment disclosed in Tables 3-7. In one embodiment, the present disclosure refers to a host cell comprising a vector composition comprising a vector or a plurality of vectors comprising the nucleic acid sequence or plurality of nucleic acid sequences encoding an antibody or antibody fragment as disclosed in Tables 5-7.
(157) In an embodiment, the present disclosure provides a host cell comprising a vector comprising a nucleic acid encoding an antibody or antibody fragment specific for CD3 according to the present disclosure. In an embodiment, the present disclosure provides a host cell comprising a nucleic acid encoding an antibody or antibody fragment specific for CD3 of the present disclosure. In another embodiment, the present disclosure provides an isolated host cell comprising a vector comprising a nucleic acid disclosed in Tables 3-7. In an embodiment, the host cell of the present disclosure is a mammalian cell. In an embodiment, the host cell of the present disclosure is a prokaryotic cell.
(158) In certain embodiments of the present disclosure, additional amino acid residues, polypeptides or moieties are added to the antibody or antibody fragment of the present disclosure, for example to aid in the expression or purification or to increase the stability of the antibody or antibody fragment of the present disclosure.
(159) In an embodiment, the present disclosure provides an antibody or antibody fragment specific for CD3 for use in the treatment of a subject in need thereof, wherein said antibody or antibody fragment comprises the
(160) HCDR1 region of SEQ ID NO: 23, the HCDR2 region of SEQ ID NO: 24, the HCDR3 region of SEQ ID NO: 25, the LCDR1 region of SEQ ID NO: 26, the LCDR2 region of SEQ ID NO: 27 and the LCDR3 region of SEQ ID NO: 28
(161) or
(162) the HCDR1 region of SEQ ID NO: 23, the HCDR2 region of SEQ ID NO: 24, the HCDR3 region of SEQ ID NO: 25, the LCDR1 region of SEQ ID NO: 26, the LCDR2 region of SEQ ID NO: 65 and the LCDR3 region of SEQ ID NO: 28.
(163) In an embodiment, said antibody or antibody fragment specific for CD3 comprises a variable heavy chain of SEQ ID NO: 7 and the variable light chain of SEQ ID NO 17 or a sequence having at least 60%, at least 70%, at least 80%, at least 90%, or at least 95% identity with these sequences but which retains the same activity as the said antibody or antibody fragment.
(164) In an embodiment, said antibody or antibody fragment specific for CD3 comprises a variable heavy chain of SEQ ID NO: 7 and the variable light chain of SEQ ID NO 17.
(165) In an embodiment, the present disclosure provides an antibody or antibody fragment specific for CD3 for use as a medicament, wherein said antibody or antibody fragment comprises the
(166) HCDR1 region of SEQ ID NO: 23, the HCDR2 region of SEQ ID NO: 24, the HCDR3 region of SEQ ID NO: 25, the LCDR1 region of SEQ ID NO: 26, the LCDR2 region of SEQ ID NO: 27 and the LCDR3 region of SEQ ID NO: 28
(167) or
(168) the HCDR1 region of SEQ ID NO: 23, the HCDR2 region of SEQ ID NO: 24, the HCDR3 region of SEQ ID NO: 25, the LCDR1 region of SEQ ID NO: 26, the LCDR2 region of SEQ ID NO: 65 and the LCDR3 region of SEQ ID NO: 28.
(169) In an embodiment, said antibody or antibody fragment specific for CD3 comprises a variable heavy chain of SEQ ID NO: 7 and the variable light chain of SEQ ID NO 17.
(170) In an embodiment, the present disclosure provides an antibody or antibody fragment specific for CD3 for use in treating or delaying progression of a cell proliferative disorder or an autoimmune disorder in a subject in need thereof.
(171) In an embodiment, the present disclosure provides an antibody or antibody fragment specific for CD3 for use in treating or delaying progression of a cell proliferative disorder or an autoimmune disorder in a subject in need thereof, wherein said antibody or antibody fragment comprises
(172) the HCDR1 region of SEQ ID NO: 23, the HCDR2 region of SEQ ID NO: 24, the HCDR3 region of SEQ ID NO: 25, the LCDR1 region of SEQ ID NO: 26, the LCDR2 region of SEQ ID NO: 27 and the LCDR3 region of SEQ ID NO: 28
(173) or
(174) the HCDR1 region of SEQ ID NO: 23, the HCDR2 region of SEQ ID NO: 24, the HCDR3 region of SEQ ID NO: 25, the LCDR1 region of SEQ ID NO: 26, the LCDR2 region of SEQ ID NO: 65 and the LCDR3 region of SEQ ID NO: 28.
(175) In an embodiment, said antibody or antibody fragment specific for CD3 comprises a variable heavy chain of SEQ ID NO: 7 and the variable light chain of SEQ ID NO 17.
(176) In an embodiment, the present disclosure provides an antibody or antibody fragment specific for CD3 for use in enhancing immune function in a subject having a cell proliferative disorder or an autoimmune disorder.
(177) In an embodiment, the present disclosure provides an antibody or antibody fragment specific for CD3 for use in enhancing immune function in a subject having a cell proliferative disorder wherein the cell proliferative disorder is a cancer.
(178) In an embodiment, the cancer is selected from the group consisting of esophageal cancer, stomach cancer, small intestine cancer, large intestine cancer, colorectal cancer, breast cancer, non-small cell lung cancer, non-Hodgkin's lymphoma (NHL), B cell lymphoma, B cell leukemia, multiple myeloma, renal cancer, prostate cancer, liver cancer, head and neck cancer, melanoma, ovarian cancer, mesothelioma, glioblastoma, germinal-center B-cell-like (GCB) DLBCL, activated B-cell-like (ABC) DLBCL, follicular lymphoma (FL), mantle cell lymphoma (MCL), acute myeloid leukemia (AML), chronic lymphoid leukemia (CLL), marginal zone lymphoma (MZL), small lymphocytic leukemia (SLL), lymphoplasmacytic lymphoma (LL), Waldenstrom macroglobulinemia (WM), central nervous system lymphoma (CNSL), Burkitt's lymphoma (BL), B-cell prolymphocytic leukemia, Splenic marginal zone lymphoma, Hairy cell leukemia, Splenic lymphoma/leukemia, unclassifiable, Splenic diffuse red pulp small B-cell lymphoma, Hairy cell leukemia variant, Waldenstrom macroglobulinemia, Plasma cell myeloma, Solitary plasmacytoma of bone, Extraosseous plasmacytoma, Extranodal marginal zone lymphoma of mucosa-associated lymphoid tissue (MALT lymphoma), Nodal marginal zone lymphoma, Pediatric nodal marginal zone lymphoma, Pediatric follicular lymphoma, Primary cutaneous follicle centre lymphoma, T-cell/histiocyte rich large B-cell lymphoma, Primary DLBCL of the CNS, Primary cutaneous DLBCL, leg type, EBV-positive DLBCL of the elderly, DLBCL associated with chronic inflammation, Lymphomatoid granulomatosis, Primary mediastinal (thymic) large B-cell lymphoma, Intravascular large B-cell lymphoma, ALK-positive large B-cell lymphoma, Plasmablastic lymphoma, Large B-cell lymphoma arising in HHV8-associated multicentric Castleman disease, Primary effusion lymphoma: B-cell lymphoma, unclassifiable, with features intermediate between diffuse large B-cell lymphoma and Burkitt lymphoma, and B-cell lymphoma, unclassifiable, with features intermediate between diffuse large B-cell lymphoma and classical Hodgkin lymphoma.
(179) In another embodiment, the autoimmune disorder is selected from the group consisting of rheumatoid arthritis, juvenile rheumatoid arthritis, systemic lupus erythematosus (SUE), Wegener's disease, inflammatory bowel disease, idiopathic thrombocytopenic purpura (ITP), thrombotic thrombocytopenic purpura (TTP), autoimmune thrombocytopenia, multiple sclerosis, psoriasis, IgA nephropathy, IgM polyneuropathies, myasthenia gravis, vasculitis, diabetes mellitus, Reynaud's syndrome, Sjorgen's syndrome, glomerulonephritis, Neuromyelitis Optica (NMO) and IgG neuropathy.
(180) The present disclosure also provides methods for treating a subject suffering from a disorder, such as cancer, by administering to said subject an effective amount of an antibody or antibody according to the present disclosure. Preferably said subject is a human.
(181) In an embodiment, said antibody or antibody fragment specific for CD3 comprises a variable heavy chain of SEQ ID NO: 7 and the variable light chain of SEQ ID NO 17.
(182) In an embodiment, the present disclosure provides a pharmaceutical composition comprising an antibody or antibody fragment as disclosed in Tables 5-7 and a pharmaceutically acceptable carrier or excipient. In an embodiment, said antibody or antibody fragment specific for CD3 comprises a variable heavy chain of SEQ ID NO: 7 and the variable light chain of SEQ ID NO 17.
(183) The present disclosure also provides methods for treating a subject suffering from a disorder, such as cancer or an autoimmune disorder, by administering to said subject an effective amount of an antibody or antibody fragment as disclosed in Table 5-7. In an embodiment, said antibody or antibody fragment specific for CD3 comprises a variable heavy chain of SEQ ID NO: 7 and the variable light chain of SEQ ID NO 17.
(184) Preferably said subject is a human.
(185) In certain embodiments, the present disclosure provides an antibody or antibody fragment which specifically binds to human or cynomolgus CD3 epsilon with an EC.sub.50 concentration of greater than 1 pM, 2 pM, 3 pM, 4 pM, 5 pM, 6 pM, 7 pM, 8 pM, 9 pM, 10 pM, 20 pM, 30 pM, 40 pM, 50 pM, 60 pM, 70 pM, 80 pM, 90 pM, 100 pM, 1 nM, 2 nM, 3 nM, 4 nM, 5 nM, 6 nM, 7 nM, 8 nM, 9 nM, 10 nM, 20 nM, 30 nM, 40 nM, 50 nM, 60 nM, 70 nM, 80 nM, 90 nM, 100 nM as determined in an ELISA assay.
(186) In an embodiment, said antibody or antibody fragment specifically binds to human CD3 epsilon with an EC.sub.50 of concentration of greater 500 pM. In an embodiment, said antibody or antibody fragment specifically binds to cynomolgus CD3 epsilon with an EC.sub.50 of concentration of greater 1 nM as determined in an ELISA assay.
(187) In an embodiment, said antibody or antibody fragment specifically binds to human CD3 epsilon with an EC.sub.50 of concentration of greater 500 pM and to cynomolgus CD3 epsilon with an EC.sub.50 concentration of greater 1 nM as determined in an ELISA assay.
(188) In alternative aspects said antibody or antibody fragment specifically binds to human or cynomolgus CD3 epsilon with an EC.sub.50 of concentration of greater 100 pM, 200 pM, 300 pM, 400 pM, 500 pM, 600 pM, 700 pM, 800 pM, 900 pM, 1 nM or 2 nM as determined in an ELISA assay. In a preferred embodiment, said antibody or antibody fragment specifically binds to human or cynomolgus CD3 epsilon with an EC.sub.50 of concentration of greater 500 pM as determined in an ELISA assay.
(189) In one aspect said antibody or antibody fragment specifically binds to human or cynomolgus CD3 epsilon with an EC.sub.50 of concentration of greater 100 pm as determined in an ELISA assay.
(190) In an embodiment, the present disclosure provides an antibody or antibody fragment which specifically binds to human or cynomolgus CD3 epsilon with an EC.sub.50 concentration which is higher compared to the EC.sub.50 concentration of any one of reference antibodies RefMAb #1 or SP34 as determined in an ELISA assay.
(191) In certain embodiments, the present disclosure provides an antibody or antibody fragment which specifically binds to human or cynomolgus CD3 epsilon with an EC.sub.50 concentration which is at least 0.5 fold or higher, 1 fold or higher, 1.5 fold or higher, 2 fold or higher, 3 fold or higher, 4 fold or higher, 5 fold or higher, 6 fold or higher, 7 fold or higher. 8 fold or higher, 9 fold or higher, 10 fold or higher, 20 fold or higher, 50 fold or higher, 100 fold or higher as the EC.sub.50 concentration of any one of reference antibodies RefMAb #1 or SP34 as determined in an ELISA assay.
(192) In certain embodiments, the present disclosure provides an antibody or antibody fragment which specifically binds to recombinant human or cynomolgus CD3 epsilon with an EC.sub.50 concentration of greater than 1 pM, 2 pM, 3 pM, 4 pM, 5 pM, 6 pM, 7 pM, 8 pM, 9 pM, 10 pM, 20 pM, 30 pM, 40 pM, 50 pM, 60 pM, 70 pM, 80 pM, 90 pM, 100 pM, 1 nM, 2 nM, 3 nM, 4 nM, 5 nM, 6 nM, 7 nM, 8 nM, 9 nM, 10 nM, 20 nM, 30 nM, 40 nM, 50 nM, 60 nM, 70 nM, 80 nM, 90 nM, 100 nM as determined in an ELISA assay.
(193) In alternative aspects said antibody or antibody fragment specifically binds to recombinant human or cynomolgus CD3 epsilon with an EC.sub.50 of concentration of greater 100 pM, 200 pM, 300 pM, 400 pM, 500 pM, 600 pM, 700 pM, 800 pM, 900 pM, 1 nM or 2 nM as determined in an ELISA assay.
(194) In one aspect said antibody or antibody fragment specifically binds to recombinant human or cynomolgus CD3 epsilon with an EC.sub.50 of concentration of greater 100 pm as determined in an ELISA assay.
(195) In certain embodiments, the present disclosure provides an antibody or antibody fragment which specifically binds to recombinant human or cynomolgus CD3 epsilon with an EC.sub.50 concentration which is at least 0.5 fold or higher, 1 fold or higher, 1.5 fold or higher, 2 fold or higher, 3 fold or higher, 4 fold or higher, 5 fold or higher, 10 fold or higher, 20 fold or higher, 50 fold or higher, 100 fold or higher as the EC.sub.50 concentration of any one of reference antibodies RefMAb #1 or SP34 as determined in an ELISA assay.
(196) In an embodiment, said antibody or antibody fragment specific for CD3 comprises
(197) a) the HCDR1 region of SEQ ID NO: 23, the HCDR2 region of SEQ ID NO: 24, the HCDR3 region of SEQ ID NO: 25, the LCDR1 region of SEQ ID NO: 26, the LCDR2 region of SEQ ID NO: 27 and the LCDR3 region of SEQ ID NO: 28
(198) or
(199) b) the HCDR1 region of SEQ ID NO: 23, the HCDR2 region of SEQ ID NO: 24, the HCDR3 region of SEQ ID NO: 25, the LCDR1 region of SEQ ID NO: 26, the LCDR2 region of SEQ ID NO: 65 and the LCDR3 region of SEQ ID NO: 28.
(200) In a further embodiment, said antibody or antibody fragment specific for CD3, comprises a) the variable heavy chain of SEQ ID NO: 9 and the variable light chain of SEQ ID NO: 11 or b) the variable heavy chain of SEQ ID NO: 9 and the variable light chain of SEQ ID NO: 13 or c) the variable heavy chain of SEQ ID NO: 7 and the variable light chain of SEQ ID NO: 15 or d) the variable heavy chain of SEQ ID NO: 7 and the variable light chain of SEQ ID NO: 17 or e) the variable heavy chain of SEQ ID NO: 7 and the variable light chain of SEQ ID NO: 19 or f) the variable heavy chain of SEQ ID NO: 9 and the variable light chain of SEQ ID NO: 19 or g) the variable heavy chain of SEQ ID NO: 9 and the variable light chain of SEQ ID NO: 21.
(201) In an embodiment, said antibody or antibody fragment specific for CD3, comprises the variable heavy chain of SEQ ID NO: 7 and the variable light chain of SEQ ID NO: 17.
(202) In some embodiments, said human CD3 epsilon is hCD3 epsilon 22-49/Fc. In some embodiments, said cynomolgus CD3 epsilon is cyCD3 epsilon 22-49/Fc. In embodiments, said EC.sub.50 concentration is determined by an ELISA assay as described herein in Example 4 using soluble CD3 epsilon/Fc.
(203) In certain embodiments, the present disclosure provides an antibody or antibody fragment which specifically binds to CD3 expressed on cells with an EC.sub.50 concentration of greater than 1 pM, 2 pM, 3 pM, 4 pM, 5 pM, 6 pM, 7 pM, 8 pM, 9 pM, 10 pM, 20 pM, 30 pM, 40 pM, 50 pM, 60 pM, 70 pM, 80 pM, 90 pM, 100 pM, 1 nM, 2 nM, 3 nM, 4 nM, 5 nM, 6 nM, 7 nM, 8 nM, 9 nM, 10 nM, 20 nM, 30 nM, 40 nM, 50 nM, 60 nM, 70 nM, 80 nM, 90 nM, 100 nM as determined in an FACS assay.
(204) In alternative aspects, said antibody or antibody fragment which specifically binds to CD3 expressed on cells with an EC.sub.50 of concentration of greater 0.5 nM, 1 nM, 2.5 nM, 5 nM, 10 nM or 20 nM or 100 nM as determined in a FACS assay.
(205) In one aspect said antibody or antibody fragment specifically binds to CD3 expressed on cells with an EC.sub.50 of concentration of greater 0.9 nM as determined in an FACS assay.
(206) In one aspect said antibody or antibody fragment specifically binds to CD3 expressed on cells with an EC.sub.50 of concentration of greater 40 nM as determined in an FACS assay.
(207) In certain aspect said CD3 is human CD3. In other aspect said CD3 is cynomolgus CD3. In other aspects said cell is an immune cell. In an embodiment, said cells is a Jurkat cells. In embodiments, said EC.sub.50 concentration is determined by an FACS assay as described herein in Example 5 or Example 9 using Jurkat cells.
(208) In certain embodiment, the present disclosure provides an antibody or antibody fragment which specifically binds to CD3 expressed on cells with an EC.sub.50 concentration which is higher as the EC.sub.50 concentration of any one of the control antibodies RefMab #1, BsAB #RefMab #1 or SP34 as determined in a FACS assay.
(209) In certain embodiments the present disclosure provides an antibody or antibody fragment which specifically binds to CD3 expressed on cells with an EC.sub.50 concentration which is at least 0.4 fold or higher, 1 fold or higher, 2 fold or higher, 3 fold or higher, 4 fold or higher, 5 fold or higher, 10 fold or higher, 20 fold or higher, 50 fold or higher, 100 fold or higher as the EC.sub.50 concentration of any one of the control antibodies RefMab #1, BsAB #RefMab #1 or SP34 as determined in a FACS assay.
(210) In a further embodiment, said antibody or antibody fragment specific for CD3, comprises a) the variable heavy chain of SEQ ID NO: 9 and the variable light chain of SEQ ID NO: 11 or b) the variable heavy chain of SEQ ID NO: 9 and the variable light chain of SEQ ID NO: 13 or c) the variable heavy chain of SEQ ID NO: 7 and the variable light chain of SEQ ID NO: 15 or d) the variable heavy chain of SEQ ID NO: 7 and the variable light chain of SEQ ID NO: 17 or e) the variable heavy chain of SEQ ID NO: 7 and the variable light chain of SEQ ID NO: 19 or f) the variable heavy chain of SEQ ID NO: 9 and the variable light chain of SEQ ID NO: 19 or g) the variable heavy chain of SEQ ID NO: 9 and the variable light chain of SEQ ID NO: 21.
(211) In an embodiment, said antibody or antibody fragment specific for CD3, comprises the variable heavy chain of SEQ ID NO: 7 and the variable light chain of SEQ ID NO: 17. In certain embodiments, said CD3 is human CD3. In certain embodiments, said CD3 is human CD3 epsilon. In embodiments, said EC.sub.50 concentration is determined by an FACS assay as described herein in Example 5 using Jurkat cells.
(212) In some embodiments, the present disclosure provides an antibody or antibody fragment which specifically binds to CD3 with a K.sub.D of 1 nM or higher, 10 nM or higher, 20 nM or higher, 30 nM or higher, 40 nM or higher, 50 nM or higher, 60 nM or higher, 70 nM or higher, 80 nM or higher, 90 nM or higher, 100 nM or higher, 250 nM or higher, 500 nM or higher.
(213) In certain embodiments, the present disclosure provides an antibody or antibody fragment which specifically binds to CD3 with a K.sub.D of 1 nM or higher. In certain embodiments, the present disclosure provides an antibody or antibody fragment which specifically binds to CD3 with a K.sub.D of 50 nM or higher.
(214) In certain embodiments, the present disclosure provides an antibody or antibody fragment which specifically binds to CD3 with a K.sub.D which is higher when compared to the K.sub.D of any one of the control antibodies RefMab #1, BsAB #RefMab #1 or SP34.
(215) In certain embodiments, the present disclosure provides an antibody or antibody fragment which specifically binds to CD3 with a K.sub.D which is at least 0 fold or higher, 1 fold or higher, 2 fold or higher, 3 fold or higher, 4 fold or higher, 5 fold or higher, 10 fold or higher, 20 fold or higher, 30 fold or higher, 40 fold or higher, 50 fold or higher, 100 fold or higher of any one of the control antibodies RefMab #1, BsAB #RefMab #1 or SP34.
(216) In some embodiments, the K.sub.D is determined by Biacore®. In some embodiments, said K.sub.D is determined by Biacore® as described herein in Example 6 or Example 14. In some embodiments, the human CD3 is human CD3 epsilon. In some embodiments, the human CD3 is hCD epsilon 22-49 Fc. In some embodiments, the human CD3 is hCD3e(22-118)_F-chLys_avi.
(217) In certain embodiments, said antibody or antibody fragment specific for CD3 is an antibody or antibody fragment as disclosed in Tables 5-7.
(218) In certain embodiments, said antibody or antibody fragment specific for CD3, comprises a) the variable heavy chain of SEQ ID NO: 9 and the variable light chain of SEQ ID NO: 11 or b) the variable heavy chain of SEQ ID NO: 9 and the variable light chain of SEQ ID NO: 13 or c) the variable heavy chain of SEQ ID NO: 7 and the variable light chain of SEQ ID NO: 15 or d) the variable heavy chain of SEQ ID NO: 7 and the variable light chain of SEQ ID NO: 17 or e) the variable heavy chain of SEQ ID NO: 7 and the variable light chain of SEQ ID NO: 19 or f) the variable heavy chain of SEQ ID NO: 9 and the variable light chain of SEQ ID NO: 19 or g) the variable heavy chain of SEQ ID NO: 9 and the variable light chain of SEQ ID NO: 21.
(219) In one embodiment, said antibody or antibody fragment specific for CD3, comprises the variable heavy chain of SEQ ID NO: 7 and the variable light chain of SEQ ID NO: 17.
(220) In certain embodiments, the present disclosure provides an antibody or antibody fragment which specifically binds to CD3 expressed on immune effector cells and does not activate T-cells.
(221) In certain embodiments, the present disclosure provides an antibody or antibody fragment which specifically binds to CD3 expressed on immune effector cells and does not activate T-cells in the absence of a cell surface target antigen expressing cell. In certain embodiments, said antibody or antibody fragment binds bivalently to CD3 expressed on immune effector cells. In certain embodiments, said antibody or antibody fragment binds bivalently to CD3 expressed on immune effector cells.
(222) In certain aspects of the disclosure, the activation of T-cells can be determined by the method as described herein in Example 11.
(223) In certain embodiments, the present disclosure provides an antibody or antibody fragment which specifically binds to CD3 expressed on immune effector cells and does not induce upregulation of CD69 expression on CD4 positive and/or CD8 positive T cells
(224) In certain embodiments, the present disclosure provides an antibody or antibody fragment which specifically binds to CD3 expressed on immune effector cells and does not induce upregulation of CD69 expression on CD4 positive and CD8 positive T cells in the absence of a cell surface target antigen expressing cell. In certain embodiments, the present disclosure provides an antibody or antibody fragment which specifically binds to CD3 expressed on immune effector cells and does not induce upregulation of CD69 expression on CD4 positive T cells in the absence of a cell surface target antigen expressing cell. In certain embodiments, the present disclosure provides an antibody or antibody fragment which specifically binds to CD3 expressed on immune effector cells and does not induce upregulation of CD69 expression on CD8 positive T cells in the absence of a cell surface target antigen expressing cell. In certain embodiments, said antibody or antibody fragment binds bivalently to CD3 expressed said immune effector cells In certain embodiments, said antibody or antibody fragment binds monovalently to CD3 expressed on said immune effector cells
(225) In certain embodiments, the present disclosure provides an antibody or antibody fragment which specifically binds to CD3 expressed on immune effector cells and induces lower extent of upregulation of CD69 expression on CD4 positive and/or CD8 positive T cells in the absence of a cell surface target antigen expressing cell when compared to any one of the control antibodies RefMab #1, BsAB #RefMab #1 or SP34. In certain embodiments, said antibody or antibody fragment binds bivalently and/or monovalently to CD3 expressed on said immune effector cells
(226) In certain embodiments, the present disclosure provides an antibody or antibody fragment which specifically binds to CD3 expressed on immune effector cells and induces upregulation of CD69 expression in a lower number of CD4 positive and/or CD8 positive T cells in the absence of a cell surface target antigen expressing cell when compared to any one of the control antibodies RefMab #1, BsAB #RefMab #1 or SP34. In certain embodiments, said antibody or antibody fragment binds bivalently and/or monovalently to CD3 expressed on said immune effector cells
(227) In certain aspects of the disclosure, the upregulation of CD69 expression can be determined by the method as described herein in Example 11.
(228) In certain embodiments, said antibody is a bispecific antibody. In certain embodiments, said bispecific antibody binds bivalently and/or monovalently to CD3 expressed on immune effector cells In certain embodiments, said bispecific antibody binds bivalently to CD3 expressed on immune effector cells
(229) In certain embodiments, the present disclosure provides a bispecific antibody comprising an antibody or antibody fragment which specifically binds to CD3 expressed on immune effector cells and wherein the bispecific antibody does not activate T-cells in the absence of a target antigen expressing cells. In certain embodiments, said antibody or antibody fragment binds bivalently and/or monovalently to CD3 expressed on immune effector cells In certain embodiments, said antibody or antibody fragment binds bivalently to CD3 expressed on immune effector cells.
(230) In certain embodiments, the present disclosure provides a bispecific antibody comprising an antibody or antibody fragment which specifically binds to CD3 expressed on immune effector cells and wherein the bispecific antibody does not induce upregulation of CD69 expression on CD4 positive and CD8 positive T cells in the absence of a target antigen expressing cell. In certain embodiments, the present disclosure provides a bispecific antibody comprising an antibody or antibody fragment, which specifically binds to CD3 expressed on immune effector cells and wherein the bispecific antibody does not induce upregulation of CD69 expression on CD4 positive and/or CD8 positive T cells in the absence of a target antigen expressing cell.
(231) In certain embodiments, the present disclosure provides a bispecific antibody which specifically binds to CD3 expressed on immune effector cells and induces lower extent of upregulation of CD69 expression on CD4 positive and/or CD8 positive T cells in the absence of a cell surface target antigen expressing cell when compared to any one of the control antibodies RefMab #1, BsAB #RefMab #1 or SP34. In certain embodiments, said antibody or antibody fragment binds bivalently or monovalently to CD3 expressed on immune effector cells In certain embodiments, said antibody or antibody fragment binds bivalently to CD3 expressed on immune effector cells
(232) In certain embodiments, the present disclosure provides a bispecific antibody which specifically binds to CD3 expressed on immune effector cells and induces upregulation of CD69 expression in a lower number of CD4 positive and/or CD8 positive T cells in the absence of a cell surface target antigen expressing cell when compared to any one of the control antibodies RefMab #1, BsAB #RefMab #1 or SP34. In certain embodiments, said antibody or antibody fragment binds bivalently and/or monovalently to CD3 expressed on said immune effector cells
(233) In certain embodiments, said bispecific antibody is a bispecific antibody as disclosed in TABLE 6 and TABLE 7.
(234) In certain embodiments, said antibody or antibody fragment specific for CD3 is an antibody or antibody fragment as disclosed in Tables 5-7,
(235) In certain embodiments, said antibody or antibody fragment specific for CD3, comprises a) the variable heavy chain of SEQ ID NO: 9 and the variable light chain of SEQ ID NO: 11 or b) the variable heavy chain of SEQ ID NO: 9 and the variable light chain of SEQ ID NO: 13 or c) the variable heavy chain of SEQ ID NO: 7 and the variable light chain of SEQ ID NO: 15 or d) the variable heavy chain of SEQ ID NO: 7 and the variable light chain of SEQ ID NO: 17 or e) the variable heavy chain of SEQ ID NO: 7 and the variable light chain of SEQ ID NO: 19 or f) the variable heavy chain of SEQ ID NO: 9 and the variable light chain of SEQ ID NO: 19 or g) the variable heavy chain of SEQ ID NO: 9 and the variable light chain of SEQ ID NO: 21.
(236) In one embodiment, said antibody or antibody fragment specific for CD3, comprises the variable heavy chain of SEQ ID NO: 7 and the variable light chain of SEQ ID NO: 17.
(237) In certain aspects of the disclosure, the upregulation of CD69 expression can be determined by the method as described herein in Example 11.
(238) In certain embodiments, the present disclosure provides a bispecific antibody comprising an antibody or antibody fragment which specifically binds to CD3 expressed on immune effector cells and wherein said bispecific antibody induces human T cell proliferation in the presence of a cell surface target antigen expressing cell.
(239) In certain embodiments, the present disclosure provides a bispecific antibody comprising an antibody or antibody fragment which specifically binds to CD3 expressed on immune effector cells wherein the bispecific antibody mediates target cell killing of target antigen high expressing cells.
(240) In certain embodiments, the present disclosure provides a bispecific antibody comprising a first antigen binding domain, wherein said first antigen binding domain specifically binds to CD3 expressed on immune effector cells and a second antigen binding domain, wherein said second antigen binding domain binds a cell surface target antigen, wherein said bispecific antibody mediates target cell killing, wherein the target cell killing of target antigen low expressing cells is significant (at least 2 fold) weaker when compared to the target cell killing of target antigen high expressing cells.
(241) In certain embodiments, said target cell killing of target antigen low expressing cells is at least 1.5 fold weaker, at least 2 fold weaker, at least 3 fold weaker, at least 5 fold weaker when compared to the target cell killing mediated by BsAB #RefMab #1 or to a bispecific antibody comprising the CD3 specific antigen binding domains of SP34.
(242) In certain embodiments, the present disclosure provides a bispecific antibody comprising an antibody or antibody fragment which specifically binds to CD3 expressed on immune effector cells wherein the bispecific antibody mediates target cell killing of target antigen high expressing cells similar to BsAB #RefMab #1 or a bispecific antibody comprising the CD3 specific antigen binding domains of SP34 but which mediates a significant weaker target cell killing of target antigen low expressing cells compared to BsAB #RefMab #1 or to a bispecific antibody comprising the CD3 specific antigen binding domains of SP34.
(243) In certain aspects, target cell killing can be determined by the method as described herein in Example 12.
(244) In certain embodiments, the present disclosure provides a bispecific antibody comprising an antibody or antibody fragment which specifically binds to CD3 expressed on immune effector cells and wherein the bispecific antibody mediates killing of target antigen low expressing cells with an IC.sub.50 concentration which is at least 100 fold or lower, 50 fold or lower, 40 fold or lower, 30 fold or lower, 20 fold or lower, 10 fold or lower, 5 fold or lower, 4 fold or lower, 3 fold or lower, 2 fold or lower, 1 fold lower as the IC.sub.50 concentration of any one of control antibodies RefMab #1, BsAB #RefMab #1 or SP34 as determined in Example 12 or Example 13.
(245) In certain embodiments, the present disclosure provides a bispecific antibody comprising an antibody or antibody fragment which specifically binds to CD3 expressed on immune effector cells and wherein the bispecific antibody mediates killing of target antigen low expressing cells with an IC.sub.50 concentration which is at least 1 fold higher, 2 fold higher, 3 fold higher, 4 fold higher, 5 fold or higher, 10 fold or higher, 15 fold higher, 20 fold higher, 30 fold higher, 40 fold higher, 50 fold higher, or 100 fold higher as the IC.sub.50 concentration of any one of control antibodies RefMab #1, BsAB #RefMab #1 or SP34 as determined in Example 12 or Example 13.
(246) In certain embodiments, the present disclosure provides a bispecific antibody comprising an antibody or antibody fragment which specifically binds to CD3 expressed on immune effector cells, wherein said bispecific antibody induces interferon gamma release by T-cells in the presence target high expressing cells but not in the presence of target low expressing cells.
(247) In certain embodiments, the present disclosure provides a bispecific antibody comprising an antibody or antibody fragment which specifically binds to CD3 expressed on immune effector cells and wherein the bispecific antibody induces interferon gamma release by T-cells in the presence of target antigen low expressing cells with an IC.sub.50 concentration which is at least 100 fold or lower, 50 fold or lower, 40 fold or lower, 30 fold or lower, 20 fold or lower, 10 fold or lower, 5 fold or lower, 4 fold or lower, 3 fold or lower, 2 fold or lower, 1 fold lower as the IC.sub.50 concentration of any one of control antibodies RefMab #1, BsAB #RefMab #1 or SP34 as determined in Example 12.
(248) In another embodiment said bispecific antibody comprises an antibody or antibody fragment which specifically binds to CD3 expressed on immune effector cells comprising the the HCDR1 region of SEQ ID NO: 23, the HCDR2 region of SEQ ID NO: 24, the HCDR3 region of SEQ ID NO: 25, the LCDR1 region of SEQ ID NO: 26, the LCDR2 region of SEQ ID NO: 27 and the LCDR3 region of SEQ ID NO: 28 or the HCDR1 region of SEQ ID NO: 23, the HCDR2 region of SEQ ID NO: 24, the HCDR3 region of SEQ ID NO: 25, the LCDR1 region of SEQ ID NO: 26, the LCDR2 region of SEQ ID NO: 65 and the LCDR3 region of SEQ ID NO: 28.
(249) In certain embodiments, said bispecific antibody is a bispecific antibody as disclosed in TABLE 6 and 7.
(250) In other embodiments, said bispecific antibody comprises an antibody or antibody fragment which specifically binds to CD3 expressed on immune effector cells comprising a variable heavy chain selected from the group of SEQ ID NO: 7 and SEQ ID NO: 9 and a variable light chain selected from the group of SEQ ID NO: 11, SEQ ID NO: 13, SEQ ID NO: 15, SEQ ID NO: 17, SEQ ID NO: 19, SEQ ID NO: 21 or a variable heavy chain and a variable light chain that has at least 60%, at least 70%, at least 80%, at least 90% or at least 95% identity to the variable heavy chain of SEQ ID NO: 7 and 9 and to the variable light chain of SEQ ID NO: 11, 13, 15, 17, 19, 21.
(251) In an embodiment the disclosed antibody or antibody fragment is specific for human CD3 epsilon encoded by the amino acid sequence of SEQ ID NO: 1. In one embodiment the disclosed antibody or antibody fragment is specific for a polypeptide comprising the amino acid sequence of SEQ ID NO: 1. In a further embodiment said monoclonal antibody or antibody fragment is a monoclonal antibody or antibody fragment specific for a polypeptide consisting of the amino acid sequence of SEQ ID NO: 1.
(252) In an embodiment, the antibody or antibody fragment of the present disclosure is cross-reactive to cynomolgus monkey CD3. In one embodiments, the antibody or antibody fragment according to the present disclosure is specific for cynomolgus monkey CD3. In an embodiment, the antibody or antibody fragment according to the present disclosure is specific for human and cynomolgus monkey CD3. In one embodiment, the disclosure refers to an isolated antibody or antibody fragment specific for CD3, wherein said antibody or antibody fragment binds to human CD3 and to cynomolgus monkey CD3. In an embodiment, the present disclosure refers to an humanized antibody or antibody fragment specific for CD3, wherein said antibody or antibody fragment binds to human CD3 and to cynomolgus CD3. In an embodiment, said CD3 is CD3 epsilon.
(253) In one embodiment the disclosed antibody or antibody fragment specific for CD3 epsilon is a monoclonal antibody or antibody fragment. In one embodiment the disclosed antibody or antibody fragment specific for CD3 epsilon is a humanized or chimeric antibody. In certain embodiments, said antibody or antibody fragment specific for CD3 epsilon is an isolated antibody or antibody fragment. In another embodiment said antibody or antibody fragment is a recombinant antibody or antibody fragment. In a further embodiment said antibody or antibody fragment is a recombinant human antibody or antibody fragment. In a further embodiment said recombinant human antibody or antibody fragment is an isolated recombinant human antibody or antibody fragment. In a further embodiment said recombinant human antibody or antibody fragment or isolated recombinant human antibody or antibody fragment is monoclonal.
(254) In one embodiment, the present disclosure refers to an antibody or antibody fragment comprising 6 CDRs defined by Kabat of any of the antibodies in Table 5. In another aspect, the disclosure pertains to an isolated monoclonal antibody or fragment thereof comprising 6 CDRs defined by Kabat of each of the antibodies in Table 5.
(255) In one embodiment, the disclosure pertains to an isolated monoclonal antibody or fragment comprising a VH and a VL of any of the antibodies in Table 5.
(256) In another embodiment, the disclosure pertains to an isolated monoclonal antibody or fragment comprising a heavy chain and a light chain of any of the antibodies in Table 5.
(257) In another embodiment, the disclosure pertains to a scFv antibody having an amino acid sequence as disclosed in Table 5.
(258) In another embodiment, the disclosure pertains to a scFv antibody having a nucleotide sequence as disclosed in Table 5.
(259) In another embodiment, the disclosure refers to a nucleic acid encoding an antibody or antibody fragment thereof wherein the nucleic acid comprises a VH and a VL of any of the antibodies in Table 5.
(260) In another embodiment, the disclosure refers to a nucleic acid encoding an antibody or fragment thereof wherein the nucleic acid comprises a heavy chain and a light chain of any of the antibodies in Table 5.
(261) In another embodiment, the disclosure refers to a nucleic acid encoding a scFv antibody wherein the scFv comprises a nucleic acid comprising a sequence as disclosed in Table 5.
(262) In another embodiment, the disclosure refers to a method of producing an isolated monoclonal antibody or fragment thereof of any of the antibodies in Table 5.
(263) Methods and techniques for identifying CDRs within heavy chain variable regions and light chain variable region amino acid sequences are well known in the art and can be used to identify CDRs within the specified within heavy chain variable regions and light chain variable region amino acid sequences disclosed herein. Exemplary conventions that can be used to identify the boundaries of CDRs include, e.g., the Kabat definition, the Chothia definition, and the AbM definition. In general terms, the Kabat definition is based on sequence variability, the Chothia definition is based on the location of the structural loop regions, and the AbM definition is a compromise between the Kabat and Chothia approaches. See, e.g., Kabat, “Sequences of Proteins of Immunological Interest,” National Institutes of Health, Bethesda, Md. (1991); Al-Lazikani et al., J. Mol. Biol. 273:927-948 (1997); and Martin et al., Proc. Natl. Acad. Sci. USA 86:9268-9272 (1989). Public databases are also available for identifying CDR sequences within an antibody.
(264) The coding sequences for the heavy and light chains of the antibody or antibody fragment of the present disclosure can be recombinant DNA molecules, which are introduced into expression vectors by operatively linking the DNA to the necessary expression control regions (e.g. regulatory regions) required for gene expression The skilled man will realize that the polynucleotides encoding the heavy or light chain can be cloned into different vectors or in the same vector. In a preferred embodiment, said polynucleotides are cloned in the same vector. The vectors can be introduced into the appropriate host cells such as prokaryotic (e.g., bacterial) or eukaryotic (e.g., yeast or mammalian) cells by methods well known in the art (see e.g., “Current Protocol in Molecular Biology”, Ausubel et al. (eds.), Greene Publishing Assoc. and John Wiley Interscience, New York, 1989 and 1992). Numerous cloning vectors are known to those of skill in the art, and the selection of an appropriate cloning vector is a matter of choice. The gene can be placed under the control of a promoter, ribosome binding site (for bacterial expression) and, optionally, an operator (collectively referred to herein as “control” elements), so that the DNA sequence encoding the desired protein is transcribed into RNA in the host cell transformed by a vector containing this expression construction. The coding sequence may or may not contain a signal peptide or leader sequence. Upon expression in host cells, the antibody or antibody fragment of the present disclosure is obtained.
(265) These steps can be achieved in different ways, as will be known by the person skilled in the art. In general, such steps typically include transforming or transfecting a suitable host cell with a nucleic acid or vector or an infectious particle which encodes the Fab molecule. Further, such steps typically include culturing said host cells under conditions suitable for the proliferation (multiplication, growth) of said host cells and a culturing step under conditions suitable for the production (expression, synthesis) of the encoded antibody or antibody fragments. The culturing of host cells under conditions suitable for proliferation or expression is typically accomplished in the presence of media comprising components suitable for cell growth or induction of expression. In particular embodiments, the methods for the production of antibody or antibody fragments of the present disclosure further comprise the step of isolating the produced antibody or antibody fragments from the host cells or medium. Depending on the expression system and host selected, the antibody or antibody fragment of the present disclosure are produced by growing host cells transformed by an expression vector described above under conditions whereby the protein of interest is expressed. The protein is then isolated from the host cells and purified. If the expression system secretes the protein into growth media, the protein can be purified directly from the media. If the protein is not secreted, it is isolated from cell lysates or recovered from the cell membrane fraction. The selection of the appropriate growth conditions and recovery methods are within the skill of the art.
(266) The antibody or antibody fragment of the present disclosure can then be purified by a number of techniques as known to the person skilled in the art. It should be noted that Fabs of the disclosure are not naturally occurring proteins. Typically, the antibody or antibody fragment of the present disclosure is recombinant, synthetic or semi-synthetic amino acid sequence, polypeptide or protein.
(267) The present disclosure also provides recombinant expression vectors capable of expressing a polypeptide comprising a heavy or light chain variable region of an antibody or antibody fragment specific for CD3 according to the present disclosure. For example, the present disclosure includes recombinant expression vectors comprising any of the nucleic acid molecules mentioned in Table 5-7, i.e., nucleic acid molecules encoding any of the VH, VL, and/or CDR sequences as set forth in Table 5.
(268) Also included within the scope of the present disclosure are host cells into which such vectors have been introduced, as well as methods of producing the antibodies or portions thereof by culturing the host cells under conditions permitting production of the antibodies or antibody fragments, and recovering the antibodies and antibody fragments so produced.
(269) The present disclosure includes antibodies or antibody fragments specific for CD3 having a modified glycosylation pattern. In some embodiments, modification to remove undesirable glycosylation sites may be useful, or an antibody lacking a fucose moiety present on the oligosaccharide chain, for example, to increase antibody dependent cellular cytotoxicity (ADCC) function (see Shield et al. (2002) JBC 277:26733). In other applications, modification of galactosylation can be made in order to modify complement dependent cytotoxicity (CDC).
(270) In another aspect, the disclosure provides a pharmaceutical composition comprising a humanized antibody or fragment which specifically binds to CD3 and a pharmaceutically acceptable carrier.
(271) In a related aspect, the disclosure features a composition which is a combination of an antibody or antibody fragment which specifically binds to CD3 and a second therapeutic agent. In one embodiment, the second therapeutic agent is any agent that is advantageously combined with an antibody which specifically binds to CD3. Exemplary agents that may be advantageously combined with an antibody or antibody fragment of the present disclosure include, without limitation, other agents that bind and/or activate CD3 signaling (including other antibodies or antigen-binding fragments thereof, etc.) and/or agents which do not directly bind CD3 but nonetheless activate or stimulate immune cell activation. Additional combination therapies and co-formulations involving the CD3 specific antibodies of the present disclosure are disclosed elsewhere herein.
(272) In yet another aspect, the disclosure provides therapeutic methods for stimulating T cell activation using an antibody or antibody fragment which specifically binds to CD3, wherein the therapeutic methods comprise administering a therapeutically effective amount of a pharmaceutical composition comprising an antibody or antibody fragment according to the present disclosure to a subject in need thereof.
(273) The disorder treated is any disease or condition which is improved, ameliorated, inhibited or prevented by stimulation of CD3 activity or signaling.
(274) In some aspects, the antibody or antibody fragment of the present disclosure which can be for use as a medicament.
(275) In an embodiment, the present disclosure refers to an antibody or antibody fragments according to the present disclosure for use in medicine. In an embodiment, the present disclosure refers to an antibody or antibody fragment according to the present disclosure for use in the preparation of a medicament.
(276) In some embodiments, the antibody or antibody fragment of the present disclosure can be for use in treating or delaying progression of a cell proliferative disorder or an autoimmune disorder in a subject in need thereof.
(277) In some embodiments, the antibody or antibody fragment of the present disclosure can used in enhancing immune function in a subject having a cell proliferative disorder or an autoimmune disorder.
(278) In some aspects, the present disclosure provides the use of an antibody or antibody fragment as disclosed herein for the manufacture of a medicament for treating or delaying progression of a cell proliferative disorder or an autoimmune disorder.
(279) In some aspects, the present disclosure provides the use of an antibody or antibody fragment as discloses herein for the manufacture of a medicament for enhancing immune function in a subject having a cell proliferative disorder or an autoimmune disorder
(280) In certain aspects, the present disclosure provides the use of an antibody or antibody fragment as disclosed herein for the manufacture of a medicament.
(281) In certain aspect, the disclosure provides a method of treating a subject in need thereof with an antibody or antibody fragment as disclosed herein.
(282) A further aspect of the disclosure provides a method of treating or delaying the progression of a cell proliferative disorder or an autoimmune disorder in a subject in need thereof, the method comprising administering to the subject an effective amount any one of the antibody or antibody fragment as disclosed herein.
(283) A further aspect of the disclosure provides a method of enhancing immune function in a subject having a cell proliferative disorder or an autoimmune disorder, the method comprising administering to the subject any one of the antibody or antibody fragment as disclosed herein.
(284) In some embodiments, bispecific antibody of the present disclosure binds to a) a CD3 molecule expressed on an immune effector cell and b) a second molecule located on a target cell other than the immune effector cell. In some embodiments, said bispecific antibody activates the immune effector cell following binding to (a) and (b). In some embodiments, the activated immune effector cell is capable of exerting a cytotoxic effect and/or an apoptotic effect on the target cell.
(285) In some embodiments, the antibody or antibody fragment according to the present disclosure is administered to the subject in a dosage of 0.01 mg/kg to 10 mg/kg. In some embodiments, the antibody or antibody fragment according to the present disclosure is administered to the subject in a dosage of 0.1 mg/kg to 10 mg/kg. In some embodiments, the antibody or antibody fragment is administered to the subject in a dosage of 1 mg/kg.
(286) In some embodiments, the antibody or antibody fragment according to the present disclosure is administered subcutaneously, intravenously, intramuscularly, topically, orally, transdermally, intraperitoneally, intraorbitally, by implantation, by inhalation, intrathecally, intraventricularly, or intranasally. In some embodiments, the antibody or antibody fragment according to the present disclosure is administered subcutaneously. In some embodiments, the antibody specific for CD3 is administered intravenously.
(287) The compositions of the present disclosure are preferably pharmaceutical compositions comprising an antibody or antibody fragment specific for CD3 as disclosed herein and a pharmaceutically acceptable carrier, diluent or excipient, for the treatment of an autoimmune disorders or cancer. Such carriers, diluents and excipients are well known in the art, and the skilled artisan will find a formulation and a route of administration best suited to treat a subject with the antibodies or antibody fragments specific for CD3 of the present disclosure.
(288) TABLE-US-00003 TABLE 1 Amino acid sequences of the extracellular domain of human and cynomolgus CD3 epsilon without signal sequences. Target SEQ ID protein NO: [aa] Mature human SEQ ID DGNEEMGGITQTPYKVSISGTTVI CD3e (23-126) NO: 1 LTCPQYPGSEILWQHNDKNIGGDE DDKNIGSDEDHLSLKEFSELEQSG YYVCYPRGSKPEDANFYLYLRARV CENCMEMD Mature SEQ ID QDGNEEMGSITQTPYQVSISGTTV cynomolgus NO: 2 ILTCSQHLGSEAQWQHNGKNKEDS CD3e (22-117) GDRLFLPEFSEMEQSGYYVCYPRG SNPEDASHHLYLKARVCENCMEMD Human CD3e SEQ ID QDGNEEMGGITQTPYKVSISGTTV (22-49)-Fc2 NO: 149 ILTCDIKTHTCPPCPAPELLGGPS (K105-K330) VFLFPPKPKDTLMISRTPEVTCVV VDVSHEDPEVKFNWYVDGVEVHNA KTKPREEQYNSTYRVVSVLTVLHQ DWLNGKEYKCKVSNKALPAPIEKT ISKAKGQPREPQVYTLPPSREEMT KNQVSLTCLVKGFYPSDIAVEWES NGQPENNYKTTPPVLDSDGSFFLY SKLTVDKSRWQQGNVFSCSVMHEA LHNHYTQKSLSLSPGK Cyno CD3e SEQ ID QDGNEEMGSITQTPYQVSISGTTV (22-49-Fc2 NO: 150 ILTCDIKTHTCPPCPAPELLGGPS (K105-K330) VFLFPPKPKDTLMISRTPEVTCVV VDVSHEDPEVKFNWYVDGVEVHNA KTKPREEQYNSTYRVVSVLTVLHQ DWLNGKEYKCKVSNKALPAPIEKT ISKAKGQPREPQVYTLPPSREEMT KNQVSLTCLVKGFYPSDIAVEWES NGQPENNYKTTPPVLDSDGSFFLY SKLTVDKSRWQQGNVFSCSVMHEA LHNHYTQKSLSLSPGK Human CD3e SEQ ID QDGNEEMGGITQTPYKVSISGTTV (22-118) NO: 151 ILTCPQYPGSEILWQHNDKNIGGD Flag_chLys_ EDDKNIGSDEDHLSLKEFSELEQS avi GYYVCYPRGSKPEDANFYLYLRAR VDIDYKDDDDKIEGRMDKVFGRCE LAAAMKRHGLDNYRGYSLGNWVCA AKFESNFNTQATNRNTDGSTDYGI LQINSRWWCNDGRTPGSRNLCNIP CSALLSSDITASVNCAKKIVSDGN GMNAWVAWRNRCKGTDVQAWIRGC RLVNSRGLNDIFEAQKIEWHE
(289) TABLE-US-00004 TABLE 2 Amino acid sequences of the VH and VL of SP34 and RefMab#1 SEQ ID Antibody Chain NO: [aa] SP34_VH VH SEQ ID EVQLVESGGGLVQPKGSLKLSC NO: 3 AASGFTFNTYAMNWVRQAPGKG LEWVARIRSKYNNYATYYADSV KDRFTISRDDSQSILYLQMNNL KTEDTAMYYCVRHGNFGNSYVS WFAYWGQGTLVTVSS SP34_VL VL SEQ ID QAVVTQESALTTSPGETVTLTC NO: 4 RSSTGAVTTSNYANWVQEKPDH LFTGLIGGTNKRAPGVPARFSG SLIGDKAALTITGAQTEDEAIY FCALWYSNLWVFGGGTKLTVLG Q RefmAb#01_VH VH SEQ ID EVQLVESGGGLVQPGGSLKLSC NO: 5 AASGFTFNKYAMNWVRQAPGKG LEWVARIRSKYNNYATYYADSV KDRFTISRDDSKNTAYLQMNNL KTEDTAVYYCVRHGNFGNSYIS YWAYWGQGTLVTVSS RefmAb#1_VL VL SEQ ID QTVVTQEPSLTVSPGGTVTLTC NO: 6 GSSTGAVTSGNYPNWVQQKPGQ APRGLIGGTKFLAPGTPARFSG SLLGGKAALTLSGVQPEDEAEY YCVLWYSNRWVFGGGTKLTVLG Q RefmAb_2_VH VH SEQ ID QVQLVESGGGLVQPGGSLRLSC NO: 152 AASGFNIKDTYIHWVRQAPGKG LEWVARIYPTNGYTRYADSVKG RFTISADTSKNTAYLQMNSLRA EDTAVYYCSRWGGDGFYAMDYW GQGTLVTVSS RefmAb_2_VL VL SEQ ID DIQMTQSPSSLSASVGDRVTIT NO: 153 CRASQDVNTAVAWYQQKPGKAP KLLIYSASFLYSGVPSRFSGSR SGTDFTLTISSLQPEDFATYYC QQHYTTPPTFGQGTKVEIKRT
(290) TABLE-US-00005 TABLE 3 Humanized variable heavy chain (VH) amino acid and nucleotide sequences of SP34 SEQ ID Construct Chain NO: [aa]/[nt] mAb#2_VH VH SEQ ID EVQLVESGGGLVKPGGSLRLSC NO: 7 AASGFTFNTYAMNWVRQAPGKG LEWVGRIRSKYNNYATYYADSV KDRFTISRDDSKNTLYLQMNSL KTEDTAVYYCTTHGNFGNSYVS WFAYWGQGTLVTVSS mAb#2_VH VH SEQ ID gaagtgcagctggtggaatctg (DNA) NO: 8 gcggcggactcgtgaagcctgg cggctctctgagactgagctgt gccgccagcggcttcaccttca acacctacgccatgaactgggt gcgccaggcccctggcaaaggc ctggaatgggtgggacggatca gaagcaagtacaacaattacgc cacctactacgccgacagcgtg aaggaccggttcaccatcagcc gggacgacagcaagaacaccct gtacctgcagatgaacagcctg aaaaccgaggacaccgccgtgt actactgcaccacccacggcaa cttcggcaacagctatgtgtct tggtttgcctactggggccagg gcaccctcgtgacagtctcgag c mAb#3_VH VH SEQ ID QVQLVESGGGLVKPGGSLRLSC NO: 9 AASGFTFNTYAMNWIRQAPGKG LEWVSRIRSKYNNYATYYADSV KDRFTISRDNAKNSLYLQMNSL RAEDTAVYYCVRHGNFGNSYVS WFAYWGQGTLVTVSS mAb#3_VH VH SEQ ID caggtgcagctggtggaatctg (DNA) NO: 10 gcggcggactcgtgaagcctgg cggctctctgagactgagctgt gccgccagcggcttcaccttca acacctacgccatgaactggat ccggcaggcccctggcaagggc ctggaatgggtgtcccggatca gaagcaagtacaacaattacgc cacctactacgccgacagcgtg aaggaccggttcaccatcagcc gggacaacgccaagaacagcct gtacctgcagatgaactccctg cgggccgaggacaccgccgtgt actattgtgtgcggcacggcaa cttcggcaacagctatgtgtct tggtttgcctactggggccagg gcaccctcgtgacagtctcgag c
(291) TABLE-US-00006 TABLE 4 Humanized VL amino acid sequences of SP34 SEQ ID Construct Chain NO: [aa]/[nt] mAb#4_VL VL SEQ ID QAVVTQEPSLTVSPGGTVT NO: 11 LTCRSSTGAVTTSNYANWV QQKPGQAPRGLIGGTNKRA PWTPARFSGSLLGGKAALT ITGAQAEDEADYYCALWYS NLWVFGGGTKLTVLGQ mAb#4_VL VL SEQ ID caggccgtggttacacaag (DNA) NO: 12 agcccagcctgacagttag ccctggcggaacagtgacc ctgacctgcagatcttcta caggcgccgtgaccaccag caactacgccaattgggtg cagcagaagcctggacagg ctcccagaggactgatcgg cggcacaaacaaaagagcc ccttggacacccgccagat tcagcggatcactgctcgg aggaaaggccgcactgaca atcacaggtgcccaggccg aagatgaggccgattacta ttgcgccctgtggtacagc aacctgtgggtgttcggcg gaggtaccaagctgaccgt gctgggccag mAb#5_VL VL SEQ ID ELVVTQEPSLTVSPGGTVT NO: 13 LTCRSSTGAVTTSNYANWV QQKPGQAPRGLIGGINKRA PGTPARFSGSLLGGKAALT LSGVQPEDEAEYYCALWYS NLWVFGGGTKLTVLGQ mAb#5_VL VL SEQ ID gagctggtggtcacacaag (DNA) NO: 14 agcccagcctgacagtttc tcctggcggcacagtgacc ctgacctgcagatcttcta caggcgccgtgaccacctc caactacgccaattgggtg cagcagaagcctggacagg ctcccagaggactgatcgg cggcacaaacaaaagagcc cctggcacaccagccagat tcagcggatcactgctcgg aggaaaggccgctctgaca ctgtctggtgtccagcctg aagatgaggccgagtacta ctgcgccctgtggtacagc aatctgtgggtgttcggcg gaggtaccaagctgaccgt gctgggccag mAb#6_VL VL SEQ ID QTVVTQEPSLTVSPGGTVT NO: 15 LTCRSSTGAVTTSNYANWV QQKPGQAPRGLIGGINKRA PGTPARFSGSLLGGKAALT LLGAQPEDEAEYYCALWYS NLWVFGGGTKLTVLGQ mAb#6_VL VL SEQ ID cagaccgtggtcacacaag (DNA) NO: 16 agcccagcctgacagtttc tcctggcggcacagtgacc ctgacctgcagatcttcta caggcgccgtgaccaccag caactacgccaattgggtg cagcagaagcctggacagg ctcccagaggactgatcgg cggcacaaacaaaagagcc cctggcacaccagccagat tcagcggatcactgctcgg aggaaaggccgctctgaca ctgcttggagcacagcctg aagatgaggccgagtacta ctgcgccctgtggtacagc aatctgtgggtgttcggcg gaggtaccaagctgaccgt gctgggccag mAb#7_VL VL SEQ ID QTVVTQEPSLTVSPGGTVT NO: 17 LTCRSSTGAVTTSNYANWV QQKPGQAPRGLIGGTKFLA PGTPARFSGSLLGGKAALT LLGAQPEDEAEYYCALWYS NLWVFGGGTKLTVLGQ mAb#7_VL VL SEQ ID cagaccgtggtcacacaag (DNA) NO: 18 agcccagcctgacagtttc tcctggcggcacagtgacc ctgacctgcagatcttcta caggcgccgtgaccaccag caactacgccaattgggtg cagcagaagcctggacagg ctcccagaggactgatcgg cggcacaaaatttctggcc cctggcacaccagccagat tctctggatctctgctcgg cggaaaggccgctctgaca ctgcttggagcacagcctg aagatgaggccgagtacta ctgcgccctgtggtacagc aatctgtgggtgttcggcg gaggtaccaagctgaccgt gctgggccag mAb#8_VL VL SEQ ID QTVVTQEPSLTVSPGGTVT NO: 19 LTCRSSTGAVTTSNYANWV QQKPGQAPRGLIGGTKFLA PGTPARFSGSLLGGKAALT LSGVQPEDEAEYYCALWYS NLWVFGGGTKLTVLGQ mAb#8_VL VL SEQ ID cagaccgtggtcacacaag (DNA) NO: 20 agcccagcctgacagtttc tcctggcggcacagtgacc ctgacctgcagatcttcta caggcgccgtgaccaccag caactacgccaattgggtg cagcagaagcctggacagg ctcccagaggactgatcgg cggcacaaaatttctggcc cctggcacaccagccagat tctctggatctctgctcgg cggaaaggccgctctgaca ctgtctggtgttcagcctg aggacgaggccgagtacta ttgcgccctgtggtacagc aacctgtgggtgttcggcg gaggtaccaagctgaccgt gctgggccag mAb#9_VL VL SEQ ID QTVVTQEPSLTVSPGGTVT NO: 21 LTCRSSTGAVTTSNYANWV QQKPGQAPRGLIGGTNKRA PGTPARFSGSLLGGKAALT LSGVQPEDEAEYYCALWYS NLWVFGGGTKLTVLGQ mAb#9_VL VL SEQ ID cagaccgtggtcacacaag (DNA) NO: 22 agcccagcctgacagtttc tcctggcggcacagtgacc ctgacctgcagatcttcta caggcgccgtgaccaccag caactacgccaattgggtg cagcagaagcctggacagg ctcccagaggactgatcgg cggcacaaacaaaagagcc cctggcacaccagccagat tcagcggatcactgctcgg aggaaaggccgctctgaca ctgtctggtgtccagcctg aagatgaggccgagtacta ctgcgccctgtggtacagc aatctgtgggtgttcggcg gaggtaccaagctgaccgt gctgggccag
(292) TABLE-US-00007 TABLE 14 Concordance table of the antibody names and the SEQ ID NO identifiers used in Table 3 and Table 5 for the humanized variable heavy chains of the present disclosure VH SEQ VH SEQ VH SEQ VH SEQ ID NO ID NO ID NO ID NO VH Protein Protein DNA DNA according according according according according Antibody Table 3 Table 3 Table 5 Table 3 Table 5 Mainz mAb#3_VH 9 30 10 32 Köln mab#3_VH 9 46 10 48 Freiburg mAb#2_VH 7 56 8 58 München mAb#2_VH 7 68 8 70 Bremen mAb#2_VH 7 78 8 80 Gladbach mAb#3_VH 9 86 10 88 Nürnberg mAb#3_VH 9 96 10 98
(293) TABLE-US-00008 TABLE 15 Concordance table of the antibody names and the SEQ ID NO identifiers used in Table 4 and Table 5 for the humanized variable light chains of the present disclosure VL SEQ VL SEQ VL SEQ VL SEQ ID NO ID NO ID NO ID NO VL Protein Protein DNA DNA according according according according according Antibody Table 4 Table 4 Table 5 Table 4 Table 5 Mainz mAb#4_VL 11 29 12 31 Köln mAb#5_VL 13 45 14 47 Freiburg mAb#6_VL 15 55 16 57 München mAb#7_VL 17 67 18 69 Bremen mAb#8_VL 19 77 20 79 Gladbach mAb#8_VL 19 85 20 87 Nürnberg mAb#9_VL 21 95 22 97
(294) TABLE-US-00009 TABLE 5 Amino acid and nucleic acid sequence identifiers of the heavy and light chain variable regions and CDRs of selected CD3 specific humanized antibodies of the invention. Antibody# SEQ ID NO: [aa]/[nt] Mainz HCDR1 (Kabat) SEQ ID NO: 23 TYAMN HCDR2 (Kabat) SEQ ID NO: 24 RIRSKYNNYATYYADSVKD HCDR3 (Kabat) SEQ ID NO: 25 HGNFGNSYVSWFAY LCDR1 (Kabat) SEQ ID NO: 26 RSSTGAVTTSNYAN LCDR2 (Kabat) SEQ ID NO: 27 GTNKRAP LCDR3 (Kabat) SEQ ID NO: 28 ALWYSNLWV VL SEQ ID NO: 29 QAVVTQEPSLTVSPGGTVTLTCRSST SEQ ID NO: 11 GAVTTSNYANWVQQKPGQAPRGLIG GTNKRAPWTPARFSGSLLGGKAALTI TGAQAEDEADYYCALWYSNLWVFG GGTKLTVLGQ VH SEQ ID NO: 30 QVQLVESGGGLVKPGGSLRLSCAAS SEQ ID NO: 9 GFTFNTYAMNWIRQAPGKGLEWVSR IRSKYNNYATYYADSVKDRFTISRDN AKNSLYLQMNSLRAEDTAVYYCVRH GNFGNSYVSWFAYWGQGTLVTVSS VL (DNA) SEQ ID NO: 31 caggccgtggttacacaagagcccagcctgacag SEQ ID NO: 12 ttagccctggcggaacagtgaccctgacctgcaga tcttctacaggcgccgtgaccaccagcaactacgc caattgggtgcagcagaagcctggacaggctccc agaggactgatcggcggcacaaacaaaagagcc ccttggacacccgccagattcagcggatcactgctc ggaggaaaggccgcactgacaatcacaggtgcc caggccgaagatgaggccgattactattgcgccct gtggtacagcaacctgtgggtgttcggcggaggta ccaagctgaccgtgctgggccag VH (DNA) SEQ ID NO: 32 caggtgcagctggtggaatctggcggcggactcgt SEQ ID NO: 10 gaagcctggcggctctctgagactgagctgtgccg ccagcggcttcaccttcaacacctacgccatgaact ggatccggcaggcccctggcaagggcctggaatg ggtgtcccggatcagaagcaagtacaacaattacg ccacctactacgccgacagcgtgaaggaccggttc accatcagccgggacaacgccaagaacagcctg tacctgcagatgaactccctgcgggccgaggacac cgccgtgtactattgtgtgcggcacggcaacttcgg caacagctatgtgtcttggtttgcctactggggccag ggcaccctcgtgacagtctcgagc HCDR1 (Kabat) SEQ ID NO: 33 acctacgccatg (DNA) HCDR2 (Kabat) SEQ ID NO: 34 cggatcagaagcaagtacaacaattacgccacct (DNA) actacgccgacagcgtgaaggac HCDR3 (Kabat) SEQ ID NO: 35 cacggcaacttcggcaacagctatgtgtcttggtttg (DNA) cctac LCDR1 (Kabat) SEQ ID NO: 36 agatcttctacaggcgccgtgaccaccagcaacta (DNA) cgccaat LCDR2 (Kabat) SEQ ID NO: 37 ggcacaaacaaaagagcccct (DNA) LCDR3 (Kabat) SEQ ID NO: 38 gccctgtggtacagcaatctgtgggtg (DNA) Light chain SEQ ID NO: 39 QAVVTQEPSLTVSPGGTVTLTCRSST (VL + CL) GAVTTSNYANWVQQKPGQAPRGLIG GTNKRAPWTPARFSGSLLGGKAALTI TGAQAEDEADYYCALWYSNLWVFG GGTKLTVLGQPKAAPSVTLFPPSSEE LQANKATLVCLISDFYPGAVTVAWKA DSSPVKAGVETTTPSKQSNNKYAAS SYLSLTPEQWKSHRSYSCQVTHEGS TVEKTVAPTECS Heavy chain (IgG1) SEQ ID NO: 40 QVQLVESGGGLVKPGGSLRLSCAAS GFTFNTYAMNWIRQAPGKGLEWVSR IRSKYNNYATYYADSVKDRFTISRDN AKNSLYLQMNSLRAEDTAVYYCVRH GNFGNSYVSWFAYWGQGTLVTVSS ASTKGPSVFPLAPSSKSTSGGTAALG CLVKDYFPEPVTVSWNSGALTSGVH TFPAVLQSSGLYSLSSVVTVPSSSLG TQTYICNVNHKPSNTKVDKRVEPKSC DKTHTCPPCPAPELLGGPSVFLFPPK PKDTLMISRTPEVTCVVVDVSHEDPE VKFNWYVDGVEVHNAKTKPREEQYN STYRVVSVLTVLHQDWLNGKEYKCK VSNKALPAPIEKTISKAKGQPREPQV YTLPPSREEMTKNQVSLTCLVKGFYP SDIAVEWESNGQPENNYKTTPPVLD SDGSFFLYSKLTVDKSRWQQGNVFS CSVMHEALHNHYTQKSLSLSPGK Light chain SEQ ID NO: 41 caggccgtggttacacaagagcccagcctgacag (VL + CL) (DNA) ttagccctggcggaacagtgaccctgacctgcaga tcttctacaggcgccgtgaccaccagcaactacgc caattgggtgcagcagaagcctggacaggctccc agaggactgatcggcggcacaaacaaaagagcc ccttggacacccgccagattcagcggatcactgctc ggaggaaaggccgcactgacaatcacaggtgcc caggccgaagatgaggccgattactattgcgccct gtggtacagcaacctgtgggtgttcggcggaggta ccaagctgaccgtgctgggccagcccaaagccgc ccctagcgtgaccctgttccccccctcgagtgagga actccaggccaacaaggccaccctcgtgtgcctga tcagcgacttctaccctggcgccgtgaccgtggcct ggaaggccgatagcagccctgtgaaggccggcgt ggaaaccaccacccccagcaagcagagcaaca acaaatacgccgccagcagctacctgagcctgac ccccgagcagtggaagtcccacagatcctacagct gccaggtcacacacgagggcagcaccgtggaaa agaccgtggcccccaccgagtgcagc Heavy chain (IgG1, SEQ ID NO: 42 caggtgcagctggtggaatctggcggcggactcgt DNA) gaagcctggcggctctctgagactgagctgtgccg ccagcggcttcaccttcaacacctacgccatgaact ggatccggcaggcccctggcaagggcctggaatg ggtgtcccggatcagaagcaagtacaacaattacg ccacctactacgccgacagcgtgaaggaccggttc accatcagccgggacaacgccaagaacagcctg tacctgcagatgaactccctgcgggccgaggacac cgccgtgtactattgtgtgcggcacggcaacttcgg caacagctatgtgtcttggtttgcctactggggccag ggcaccctcgtgacagtctcgagcgcgtcgaccaa aggccccagcgtgttccctctggcccccagcagca agagcacctctggcggaacagccgccctgggctg cctggtcaaggactacftccccgagcccgtgaccgt gtcctggaactctggcgccctgaccagcggcgtgc acacctttccagccgtgctccagagcagcggcctgt acagcctgagcagcgtcgtgaccgtgcccagcag cagcctgggcacccagacctacatctgcaacgtga accacaagcccagcaacacaaaggtggacaag cgggtggaacccaagagctgcgacaagacccac acctgtcccccctgccctgcccctgaactgctggga ggcccctccgtgttcctgttccccccaaagcctaag gacaccctgatgatcagccggacccccgaagtga cctgcgtggtggtggacgtgtcccacgaggaccct gaagtgaagtttaattggtacgtggacggcgtggaa gtgcacaacgccaagaccaagcccagagagga acagtacaacagcacctaccgggtggtgtccgtgc tgaccgtgctgcaccaggactggctgaacggcaa agagtacaagtgcaaggtgtccaacaaggccctg cctgcccccatcgagaaaaccatcagcaaggcca aaggccagccccgcgagccccaggtgtacacact gccccctagccgggaagagatgaccaagaacca ggtgtccctgacctgcctcgtgaagggcttctacccc agcgacattgccgtggaatgggagagcaacggcc agcccgagaacaactacaagaccaccccccctgt gctggacagcgacggctcattcttcctgtacagcaa gctgaccgtggacaagagccggtggcagcaggg caacgtgttcagctgctccgtgatgcacgaggccct gcacaaccactacacccagaagtccctgagcctg agccccggcaagtga scFv (VL-linker-VH) SEQ ID NO: 43 ASPAAPAPSAQAVVTQEPSLTVSPG GTVTLTCRSSTGAVTTSNYANWVQQ KPGQAPRGLIGGTNKRAPWTPARFS GSLLGGKAALTITGAQAEDEADYYCA LWYSNLWVFGGGTKLTVLGQASPAA PAPASPAAPAPASGSQVQLVESGGG LVKPGGSLRLSCAASGFTFNTYAMN WIRQAPGKGLEWVSRIRSKYNNYAT YYADSVKDRFTISRDNAKNSLYLQMN SLRAEDTAVYYCVRHGNFGNSYVSW FAYWGQGTLVTVSS scFv (VL-linker-VH) SEQ ID NO: 44 gcttctcctgctgctcctgctcctagcgctcaggccgt (DNA) ggttacacaagagcccagcctgacagttagccctg gcggaacagtgaccctgacctgcagatcttctaca ggcgccgtgaccaccagcaactacgccaattgggt gcagcagaagcctggacaggctcccagaggact gatcggcggcacaaacaaaagagccccttggac acccgccagattcagcggatcactgctcggagga aaggccgcactgacaatcacaggtgcccaggcc gaagatgaggccgattactattgcgccctgtggtac agcaacctgtgggtgttcggcggaggtaccaagct gaccgtgctgggccaggcctctcctgctgctcctgct ccagcttctccagccgctccagctcctgctagcgga tctcaggtgcagctggtggaatctggcggcggactc gtgaagcctggcggctctctgagactgagctgtgcc gccagcggcttcaccttcaacacctacgccatgaa ctggatccggcaggcccctggcaagggcctggaa tgggtgtcccggatcagaagcaagtacaacaatta cgccacctactacgccgacagcgtgaaggaccgg ttcaccatcagccgggacaacgccaagaacagcc tgtacctgcagatgaactccctgcgggccgaggac accgccgtgtactattgtgtgcggcacggcaacttc ggcaacagctatgtgtcttggtttgcctactggggcc agggcaccctcgtgacagtctcgagc Köln HCDR1 (Kabat) SEQ ID NO: 23 TYAMN HCDR2 (Kabat) SEQ ID NO: 24 RIRSKYNNYATYYADSVKD HCDR3 (Kabat) SEQ ID NO: 25 HGNFGNSYVSWFAY LCDR1 (Kabat) SEQ ID NO: 26 RSSTGAVTTSNYAN LCDR2 (Kabat) SEQ ID NO: 27 GTNKRAP LCDR3 (Kabat) SEQ ID NO: 28 ALWYSNLWV VL SEQ ID NO: 45 ELVVTQEPSLTVSPGGTVTLTCRSST SEQ ID NO: 13 GAVTTSNYANWVQQKPGQAPRGLIG GTNKRAPGTPARFSGSLLGGKAALTL SGVQPEDEAEYYCALWYSNLWVFG GGTKLTVLGQ VH SEQ ID NO: 46 QVQLVESGGGLVKPGGSLRLSCAAS SEQ ID NO: 9 GFTFNTYAMNWIRQAPGKGLEWVSR IRSKYNNYATYYADSVKDRFTISRDN AKNSLYLQMNSLRAEDTAVYYCVRH GNFGNSYVSWFAYWGQGTLVTVSS VL (DNA) SEQ ID NO: 47 gagctggtggtcacacaagagcccagcctgacag SEQ ID NO: 14 tttctcctggcggcacagtgaccctgacctgcagatc ttctacaggcgccgtgaccacctccaactacgcca attgggtgcagcagaagcctggacaggctcccag aggactgatcggcggcacaaacaaaagagcccc tggcacaccagccagattcagcggatcactgctcg gaggaaaggccgctctgacactgtctggtgtccag cctgaagatgaggccgagtactactgcgccctgtg gtacagcaatctgtgggtgttcggcggaggtacca agctgaccgtgctgggccag VH (DNA) SEQ ID NO: 48 caggtgcagctggtggaatctggcggcggactcgt SEQ ID NO: 10 gaagcctggcggctctctgagactgagctgtgccg ccagcggcttcaccttcaacacctacgccatgaact ggatccggcaggcccctggcaagggcctggaatg ggtgtcccggatcagaagcaagtacaacaattacg ccacctactacgccgacagcgtgaaggaccggttc accatcagccgggacaacgccaagaacagcctg tacctgcagatgaactccctgcgggccgaggacac cgccgtgtactattgtgtgcggcacggcaacttcgg caacagctatgtgtcttggtttgcctactggggccag ggcaccctcgtgacagtctcgagc HCDR1 (Kabat) SEQ ID NO: 33 acctacgccatg (DNA) HCDR2 (Kabat) SEQ ID NO: 34 cggatcagaagcaagtacaacaattacgccacct (DNA) actacgccgacagcgtgaaggac HCDR3 (Kabat) SEQ ID NO: 35 cacggcaacttcggcaacagctatgtgtcttggtttg (DNA) cctac LCDR1 (Kabat) SEQ ID NO: 36 agatcttctacaggcgccgtgaccaccagcaacta (DNA) cgccaat LCDR2 (Kaba) SEQ ID NO: 37 ggcacaaacaaaagagcccct (DNA) LCDR3 (Kabat) SEQ ID NO: 38 gccctgtggtacagcaatctgtgggtg (DNA) Light chain SEQ ID NO: 49 ELVVTQEPSLTVSPGGTVTLTCRSST (VL + CL) GAVTTSNYANWVQQKPGQAPRGLIG GINKRAPGTPARFSGSLLGGKAALTL SGVQPEDEAEYYCALWYSNLWVFG GGTKLTVLGQPKAAPSVTLFPPSSEE LQANKATLVCLISDFYPGAVTVAWKA DSSPVKAGVETTTPSKQSNNKYAAS SYLSLTPEQWKSHRSYSCQVTHEGS TVEKTVAPTECS Heavy chain (IgG1) SEQ ID NO: 50 QVQLVESGGGLVKPGGSLRLSCAAS GFTFNTYAMNWIRQAPGKGLEWVSR IRSKYNNYATYYADSVKDRFTISRDN AKNSLYLQMNSLRAEDTAVYYCVRH GNFGNSYVSWFAYWGQGTLVTVSS ASTKGPSVFPLAPSSKSTSGGTAALG CLVKDYFPEPVTVSWNSGALTSGVH TFPAVLQSSGLYSLSSVVTVPSSSLG TQTYICNVNHKPSNTKVDKRVEPKSC DKTHTCPPCPAPELLGGPSVFLFPPK PKDTLMISRTPEVTCVVVDVSHEDPE VKFNWYVDGVEVHNAKTKPREEQYN STYRVVSVLTVLHQDWLNGKEYKCK VSNKALPAPIEKTISKAKGQPREPQV YTLPPSREEMTKNQVSLTCLVKGFYP SDIAVEWESNGQPENNYKTTPPVLD SDGSFFLYSKLTVDKSRWQQGNVFS CSVMHEALHNHYTQKSLSLSPGK Light chain (DNA) SEQ ID NO: 51 gagctggtggtcacacaagagcccagcctgacag tttctcctggcggcacagtgaccctgacctgcagatc ttctacaggcgccgtgaccacctccaactacgcca attgggtgcagcagaagcctggacaggctcccag aggactgatcggcggcacaaacaaaagagcccc tggcacaccagccagattcagcggatcactgctcg gaggaaaggccgctctgacactgtctggtgtccag cctgaagatgaggccgagtactactgcgccctgtg gtacagcaatctgtgggtgttcggcggaggtacca agctgaccgtgctgggccagcccaaagccgcccc tagcgtgaccctgttccccccctcgagtgaggaact ccaggccaacaaggccaccctcgtgtgcctgatca gcgacttctaccctggcgccgtgaccgtggcctgga aggccgatagcagccctgtgaaggccggcgtgga aaccaccacccccagcaagcagagcaacaaca aatacgccgccagcagctacctgagcctgacccc cgagcagtggaagtcccacagatcctacagctgcc aggtcacacacgagggcagcaccgtggaaaaga ccgtggcccccaccgagtgcagc Heavy chain (DNA, SEQ ID NO: 52 caggtgcagctggtggaatctggcggcggactcgt IgG1) gaagcctggcggctctctgagactgagctgtgccg ccagcggcttcaccttcaacacctacgccatgaact ggatccggcaggcccctggcaagggcctggaatg ggtgtcccggatcagaagcaagtacaacaattacg ccacctactacgccgacagcgtgaaggaccggttc accatcagccgggacaacgccaagaacagcctg tacctgcagatgaactccctgcgggccgaggacac cgccgtgtactattgtgtgcggcacggcaacttcgg caacagctatgtgtcttggtttgcctactggggccag ggcaccctcgtgacagtctcgagcgcgtcgaccaa aggccccagcgtgttccctctggcccccagcagca agagcacctctggcggaacagccgccctgggctg cctggtcaaggactacttccccgagcccgtgaccgt gtcctggaactctggcgccctgaccagcggcgtgc acacctttccagccgtgctccagagcagcggcctgt acagcctgagcagcgtcgtgaccgtgcccagcag cagcctgggcacccagacctacatctgcaacgtga accacaagcccagcaacacaaaggtggacaag cgggtggaacccaagagctgcgacaagacccac acctgtcccccctgccctgcccctgaactgctggga ggcccctccgtgttcctgttccccccaaagcctaag gacaccctgatgatcagccggacccccgaagtga cctgcgtggtggtggacgtgtcccacgaggaccct gaagtgaagtttaattggtacgtggacggcgtggaa gtgcacaacgccaagaccaagcccagagagga acagtacaacagcacctaccgggtggtgtccgtgc tgaccgtgctgcaccaggactggctgaacggcaa agagtacaagtgcaaggtgtccaacaaggccctg cctgcccccatcgagaaaaccatcagcaaggcca aaggccagccccgcgagccccaggtgtacacact gccccctagccgggaagagatgaccaagaacca ggtgtccctgacctgcctcgtgaagggcttctacccc agcgacattgccgtggaatgggagagcaacggcc agcccgagaacaactacaagaccaccccccctgt gctggacagcgacggctcattcttcctgtacagcaa gctgaccgtggacaagagccggtggcagcaggg caacgtgttcagctgctccgtgatgcacgaggccct gcacaaccactacacccagaagtccctgagcctg agccccggcaagtga scFv (VL-linker-VH) SEQ ID NO: 53 ASPAAPAPSAELVVTQEPSLTVSPGG (aa) TVTLTCRSSTGAVTTSNYANWVQQK PGQAPRGLIGGTNKRAPGTPARFSG SLLGGKAALTLSGVQPEDEAEYYCAL WYSNLWVFGGGTKLTVLGQASPAAP APASPAAPAPASGSQVQLVESGGGL VKPGGSLRLSCAASGFTFNTYAMNW IRQAPGKGLEWVSRIRSKYNNYATYY ADSVKDRFTISRDNAKNSLYLQMNSL RAEDTAVYYCVRHGNFGNSYVSWFA YWGQGTLVTVSS scFv (VL-linker-VH) SEQ ID NO: 54 gcttctcctgctgctcctgctcctagcgctgagctggt (DNA) ggtcacacaagagcccagcctgacagtttctcctgg cggcacagtgaccctgacctgcagatcttctacagg cgccgtgaccacctccaactacgccaattgggtgc agcagaagcctggacaggctcccagaggactgat cggcggcacaaacaaaagagcccctggcacacc agccagattcagcggatcactgctcggaggaaag gccgctctgacactgtctggtgtccagcctgaagat gaggccgagtactactgcgccctgtggtacagcaa tctgtgggtgttcggcggaggtaccaagctgaccgt gctgggccaggcctctcctgctgctcctgctccagct tctccagccgctccagctcctgctagcggatctcag gtgcagctggtggaatctggcggcggactcgtgaa gcctggcggctctctgagactgagctgtgccgccag cggcttcaccttcaacacctacgccatgaactggat ccggcaggcccctggcaagggcctggaatgggtg tcccggatcagaagcaagtacaacaattacgcca cctactacgccgacagcgtgaaggaccggttcacc atcagccgggacaacgccaagaacagcctgtac ctgcagatgaactccctgcgggccgaggacaccg ccgtgtactattgtgtgcggcacggcaacttcggca acagctatgtgtcttggtttgcctactggggccaggg caccctcgtgacagtctcgagc Freiburg HCDR1 (Kabat) SEQ ID NO: 23 TYAMN HCDR2 (Kabat) SEQ ID NO: 24 RIRSKYNNYATYYADSVKD HCDR3 (Kabat) SEQ ID NO: 25 HGNFGNSYVSWFAY LCDR1 (Kabat) SEQ ID NO: 26 RSSTGAVTTSNYAN LCDR2 (Kabat) SEQ ID NO: 27 GTNKRAP LCDR3 (Kabat) SEQ ID NO: 28 ALWYSNLWV VL SEQ ID NO: 55 QTVVTQEPSLTVSPGGTVTLTCRSST SEQ ID NO: 15 GAVTTSNYANWVQQKPGQAPRGLIG GTNKRAPGTPARFSGSLLGGKAALTL LGAQPEDEAEYYCALWYSNLWVFG GGTKLTVLGQ VH SEQ ID NO: 56 EVQLVESGGGLVKPGGSLRLSCAAS SEQ ID NO: 7 GFTFNTYAMNWVRQAPGKGLEWVG RIRSKYNNYATYYADSVKDRFTISRD DSKNTLYLQMNSLKTEDTAVYYCTTH GNFGNSYVSWFAYWGQGTLVTVSS VL (DNA) SEQ ID NO: 57 cagaccgtggtcacacaagagcccagcctgaca SEQ ID NO: 18 gtttctcctggcggcacagtgaccctgacctgcagat cttctacaggcgccgtgaccaccagcaactacgcc aattgggtgcagcagaagcctggacaggctccca gaggactgatcggcggcacaaacaaaagagccc ctggcacaccagccagattcagcggatcactgctc ggaggaaaggccgctctgacactgcttggagcac agcctgaagatgaggccgagtactactgcgccctg tggtacagcaatctgtgggtgttcggcggaggtacc aagctgaccgtgctgggccag VH (DNA) SEQ ID NO: 58 gaagtgcagctggtggaatctggcggcggactcgt SEQ ID NO: 8 gaagcctggcggctctctgagactgagctgtgccg ccagcggcttcaccttcaacacctacgccatgaact gggtgcgccaggcccctggcaaaggcctggaatg ggtgggacggatcagaagcaagtacaacaattac gccacctactacgccgacagcgtgaaggaccggtt caccatcagccgggacgacagcaagaacaccct gtacctgcagatgaacagcctgaaaaccgaggac accgccgtgtactactgcaccacccacggcaactt cggcaacagctatgtgtcttggtttgcctactggggc cagggcaccctcgtgacagtctcgagc HCDR1 (Kabat) SEQ ID NO: 33 acctacgccatg (DNA) HCDR2 (Kabat) SEQ ID NO: 34 cggatcagaagcaagtacaacaattacgccacct (DNA) actacgccgacagcgtgaaggac HCDR3 (Kabat) SEQ ID NO: 35 cacggcaacttcggcaacagctatgtgtcttggtttg (DNA) cctac LCDR1 (Kabat) SEQ ID NO: 36 agatcttctacaggcgccgtgaccaccagcaacta (DNA) cgccaat LCDR2 (Kabat) SEQ ID NO: 37 ggcacaaacaaaagagcccct (DNA) LCDR3 (Kabat) SEQ ID NO: 38 gccctgtggtacagcaatctgtgggtg (DNA) Light chain (IgG) SEQ ID NO: 59 QTVVTQEPSLTVSPGGTVTLTCRSST GAVTTSNYANWVQQKPGQAPRGLIG GTNKRAPGTPARFSGSLLGGKAALTL LGAQPEDEAEYYCALWYSNLWVFG GGTKLTVLGQPKAAPSVTLFPPSSEE LQANKATLVCLISDFYPGAVTVAWKA DSSPVKAGVETTTPSKQSNNKYAAS SYLSLTPEQWKSHRSYSCQVTHEGS TVEKTVAPTECS Heavy chain (IgG1) SEQ ID NO: 60 EVQLVESGGGLVKPGGSLRLSCAAS GFTFNTYAMNWVRQAPGKGLEWVG RIRSKYNNYATYYADSVKDRFTISRD DSKNTLYLQMNSLKTEDTAVYYCTTH GNFGNSYVSWFAYWGQGTLVTVSS ASTKGPSVFPLAPSSKSTSGGTAALG CLVKDYFPEPVTVSWNSGALTSGVH TFPAVLQSSGLYSLSSVVTVPSSSLG TQTYICNVNHKPSNTKVDKRVEPKSC DKTHTCPPCPAPELLGGPSVFLFPPK PKDTLMISRTPEVTCVVVDVSHEDPE VKFNWYVDGVEVHNAKTKPREEQYN STYRVVSVLTVLHQDWLNGKEYKCK VSNKALPAPIEKTISKAKGQPREPQV YTLPPSREEMTKNQVSLTCLVKGFYP SDIAVEWESNGQPENNYKTTPPVLD SDGSFFLYSKLTVDKSRWQQGNVFS CSVMHEALHNHYTQKSLSLSPGK Light chain (DNA) SEQ ID NO: 61 cagaccgtggtcacacaagagcccagcctgaca gtttctcctggcggcacagtgaccctgacctgcagat cttctacaggcgccgtgaccaccagcaactacgcc aattgggtgcagcagaagcctggacaggctccca gaggactgatcggcggcacaaacaaaagagccc ctggcacaccagccagattcagcggatcactgctc ggaggaaaggccgctctgacactgcttggagcac agcctgaagatgaggccgagtactactgcgccctg tggtacagcaatctgtgggtgttcggcggaggtacc aagctgaccgtgctgggccagcccaaagccgccc ctagcgtgaccctgttccccccctcgagtgaggaac tccaggccaacaaggccaccctcgtgtgcctgatc agcgacttctaccctggcgccgtgaccgtggcctgg aaggccgatagcagccctgtgaaggccggcgtgg aaaccaccacccccagcaagcagagcaacaac aaatacgccgccagcagctacctgagcctgaccc ccgagcagtggaagtcccacagatcctacagctgc caggtcacacacgagggcagcaccgtggaaaag accgtggcccccaccgagtgcagc Heavy chain (DNA, SEQ ID NO: 62 gaagtgcagctggtggaatctggcggcggactcgt IgG1) gaagcctggcggctctctgagactgagctgtgccg ccagcggcttcaccttcaacacctacgccatgaact gggtgcgccaggcccctggcaaaggcctggaatg ggtgggacggatcagaagcaagtacaacaattac gccacctactacgccgacagcgtgaaggaccggtt caccatcagccgggacgacagcaagaacaccct gtacctgcagatgaacagcctgaaaaccgaggac accgccgtgtactactgcaccacccacggcaactt cggcaacagctatgtgtcttggtttgcctactggggc cagggcaccctcgtgacagtctcgagcgcgtcgac caaaggccccagcgtgttccctctggcccccagca gcaagagcacctctggcggaacagccgccctgg gctgcctggtcaaggactacttccccgagcccgtga ccgtgtcctggaactctggcgccctgaccagcggc gtgcacacctttccagccgtgctccagagcagcgg cctgtacagcctgagcagcgtcgtgaccgtgccca gcagcagcctgggcacccagacctacatctgcaa cgtgaaccacaagcccagcaacacaaaggtgga caagcgggtggaacccaagagctgcgacaagac ccacacctgtcccccctgccctgcccctgaactgct gggaggcccctccgtgttcctgttccccccaaagcc taaggacaccctgatgatcagccggacccccgaa gtgacctgcgtggtggtggacgtgtcccacgagga ccctgaagtgaagtttaattggtacgtggacggcgt ggaagtgcacaacgccaagaccaagcccagag aggaacagtacaacagcacctaccgggtggtgtc cgtgctgaccgtgctgcaccaggactggctgaacg gcaaagagtacaagtgcaaggtgtccaacaagg ccctgcctgcccccatcgagaaaaccatcagcaa ggccaaaggccagccccgcgagccccaggtgta cacactgccccctagccgggaagagatgaccaa gaaccaggtgtccctgacctgcctcgtgaagggctt ctaccccagcgacattgccgtggaatgggagagc aacggccagcccgagaacaactacaagaccacc ccccctgtgctggacagcgacggctcattcttcctgt acagcaagctgaccgtggacaagagccggtggc agcagggcaacgtgttcagctgctccgtgatgcac gaggccctgcacaaccactacacccagaagtccc tgagcctgagccccggcaag scFv (VL-linker-VH) SEQ ID NO: 63 ASPAAPAPSAQTVVTQEPSLTVSPG GTVTLTCRSSTGAVTTSNYANWVQQ KPGQAPRGLIGGTNKRAPGTPARFS GSLLGGKAALTLLGAQPEDEAEYYCA LWYSNLWVFGGGTKLTVLGQASPAA PAPASPAAPAPASGSEVQLVESGGG LVKPGGSLRLSCAASGFTFNTYAMN WVRQAPGKGLEWVGRIRSKYNNYAT YYADSVKDRFTISRDDSKNTLYLQMN SLKTEDTAVYYCTTHGNFGNSYVSW FAYWGQGTLVTVSS scFv (VL-linker-VH) SEQ ID NO: 64 gcttctcctgctgctcctgctcctagcgctcagaccgt (DNA) ggtcacacaagagcccagcctgacagtttctcctgg cggcacagtgaccctgacctgcagatcttctacagg cgccgtgaccaccagcaactacgccaattgggtgc agcagaagcctggacaggctcccagaggactgat cggcggcacaaacaaaagagcccctggcacacc agccagattcagcggatcactgctcggaggaaag gccgctctgacactgcttggagcacagcctgaaga tgaggccgagtactactgcgccctgtggtacagca atctgtgggtgttcggcggaggtaccaagctgaccg tgctgggccaggcctctcctgctgctcctgctccagc ttctccagccgctccagctcctgctagcggatctgaa gtgcagctggtggaatctggcggcggactcgtgaa gcctggcggctctctgagactgagctgtgccgccag cggcttcaccttcaacacctacgccatgaactgggt gcgccaggcccctggcaaaggcctggaatgggtg ggacggatcagaagcaagtacaacaattacgcca cctactacgccgacagcgtgaaggaccggttcacc atcagccgggacgacagcaagaacaccctgtac ctgcagatgaacagcctgaaaaccgaggacacc gccgtgtactactgcaccacccacggcaacttcgg caacagctatgtgtcttggtttgcctactggggccag ggcaccctcgtgacagtctcgagc München HCDR1 (Kabat) SEQ ID NO: 23 TYAMN HCDR2 (Kabat) SEQ ID NO: 24 RIRSKYNNYATYYADSVKD HCDR3 (Kabat) SEQ ID NO: 25 HGNFGNSYVSWFAY LCDR1 (Kabat) SEQ ID NO: 26 RSSTGAVTTSNYAN LCDR2 (Kabat) SEQ ID NO: 65 GTKFLAP LCDR3 (Kabat) SEQ ID NO: 28 ALWYSNLWV VL SEQ ID NO: 67 QTVVTQEPSLTVSPGGTVTLTCRSST SEQ ID NO: 17 GAVTTSNYANWVQQKPGQAPRGLIG GTKFLAPGTPARFSGSLLGGKAALTL LGAQPEDEAEYYCALWYSNLWVFG GGTKLTVLGQ VH SEQ ID NO: 68 EVQLVESGGGLVKPGGSLRLSCAAS SEQ ID NO: 7 GFTFNTYAMNWVRQAPGKGLEWVG RIRSKYNNYATYYADSVKDRFTISRD DSKNTLYLQMNSLKTEDTAVYYCTTH GNFGNSYVSWFAYWGQGTLVTVSS VL (DNA) SEQ ID NO: 69 cagaccgtggtcacacaagagcccagcctgaca SEQ ID NO: 18 gtttctcctggcggcacagtgaccctgacctgcagat cttctacaggcgccgtgaccaccagcaactacgcc aattgggtgcagcagaagcctggacaggctccca gaggactgatcggcggcacaaaatttctggcccct ggcacaccagccagattctctggatctctgctcggc ggaaaggccgctctgacactgcttggagcacagc ctgaagatgaggccgagtactactgcgccctgtggt acagcaatctgtgggtgttcggcggaggtaccaag ctgaccgtgctgggccag VH (DNA) SEQ ID NO: 70 gaagtgcagctggtggaatctggcggcggactcgt SEQ ID NO: 8 gaagcctggcggctctctgagactgagctgtgccg ccagcggcttcaccttcaacacctacgccatgaact gggtgcgccaggcccctggcaaaggcctggaatg ggtgggacggatcagaagcaagtacaacaattac gccacctactacgccgacagcgtgaaggaccggtt caccatcagccgggacgacagcaagaacaccct gtacctgcagatgaacagcctgaaaaccgaggac accgccgtgtactactgcaccacccacggcaactt cggcaacagctatgtgtcttggtttgcctactggggc cagggcaccctcgtgacagtctcgagc HCDR1 (Kabat) SEQ ID NO: 33 acctacgccatg (DNA) HCDR2 (Kabat) SEQ ID NO: 34 cggatcagaagcaagtacaacaattacgccacct (DNA) actacgccgacagcgtgaaggac HCDR3 (Kabat) SEQ ID NO: 35 cacggcaacttcggcaacagctatgtgtcttggtttg (DNA) cctac LCDR1 (Kabat) SEQ ID NO: 36 agatcttctacaggcgccgtgaccaccagcaacta (DNA) cgccaat LCDR2 (Kabat) SEQ ID NO: 66 ggcacaaaatttctggcccct (DNA) LCDR3 (Kabat) SEQ ID NO: 38 gccctgtggtacagcaatctgtgggtg (DNA) Light chain (IgG) SEQ ID NO: 71 QTVVTQEPSLTVSPGGTVTLTCRSST GAVTTSNYANWVQQKPGQAPRGLIG GTKFLAPGTPARFSGSLLGGKAALTL LGAQPEDEAEYYCALWYSNLWVFG GGTKLTVLGQPKAAPSVTLFPPSSEE LQANKATLVCLISDFYPGAVTVAWKA DSSPVKAGVETTTPSKQSNNKYAAS SYLSLTPEQWKSHRSYSCQVTHEGS TVEKTVAPTECS Heavy chain (IgG1) SEQ ID NO: 72 EVQLVESGGGLVKPGGSLRLSCAAS GFTFNTYAMNWVRQAPGKGLEWVG RIRSKYNNYATYYADSVKDRFTISRD DSKNTLYLQMNSLKTEDTAVYYCTTH GNFGNSYVSWFAYWGQGTLVTVSS ASTKGPSVFPLAPSSKSTSGGTAALG CLVKDYFPEPVTVSWNSGALTSGVH TFPAVLQSSGLYSLSSVVTVPSSSLG TQTYICNVNHKPSNTKVDKRVEPKSC DKTHTCPPCPAPELLGGPSVFLFPPK PKDTLMISRTPEVTCVVVDVSHEDPE VKFNWYVDGVEVHNAKTKPREEQYN STYRVVSVLTVLHQDWLNGKEYKCK VSNKALPAPIEKTISKAKGQPREPQV YTLPPSREEMTKNQVSLTCLVKGFYP SDIAVEWESNGQPENNYKTTPPVLD SDGSFFLYSKLTVDKSRWQQGNVFS CSVMHEALHNHYTQKSLSLSPGK Light chain (DNA) SEQ ID NO: 73 cagaccgtggtcacacaagagcccagcctgaca gtttctcctggcggcacagtgaccctgacctgcagat cttctacaggcgccgtgaccaccagcaactacgcc aattgggtgcagcagaagcctggacaggctccca gaggactgatcggcggcacaaaatttctggcccct ggcacaccagccagattctctggatctctgctcggc ggaaaggccgctctgacactgcttggagcacagc ctgaagatgaggccgagtactactgcgccctgtggt acagcaatctgtgggtgttcggcggaggtaccaag ctgaccgtgctgggccagcccaaagccgccccta gcgtgaccctgttccccccctcgagtgaggaactcc aggccaacaaggccaccctcgtgtgcctgatcagc gacttctaccctggcgccgtgaccgtggcctggaag gccgatagcagccctgtgaaggccggcgtggaaa ccaccacccccagcaagcagagcaacaacaaat acgccgccagcagctacctgagcctgacccccga gcagtggaagtcccacagatcctacagctgccag gtcacacacgagggcagcaccgtggaaaagacc gtggcccccaccgagtgcagc Heavy chain (DNA, SEQ ID NO: 74 gaagtgcagctggtggaatctggcggcggactcgt IgG1) gaagcctggcggctctctgagactgagctgtgccg ccagcggcttcaccttcaacacctacgccatgaact gggtgcgccaggcccctggcaaaggcctggaatg ggtgggacggatcagaagcaagtacaacaattac gccacctactacgccgacagcgtgaaggaccggtt caccatcagccgggacgacagcaagaacaccct gtacctgcagatgaacagcctgaaaaccgaggac accgccgtgtactactgcaccacccacggcaactt cggcaacagctatgtgtcttggtttgcctactggggc cagggcaccctcgtgacagtctcgagcgcgtcgac caaaggccccagcgtgttccctctggcccccagca gcaagagcacctctggcggaacagccgccctgg gctgcctggtcaaggactacttccccgagcccgtga ccgtgtcctggaactctggcgccctgaccagcggc gtgcacacctttccagccgtgctccagagcagcgg cctgtacagcctgagcagcgtcgtgaccgtgccca gcagcagcctgggcacccagacctacatctgcaa cgtgaaccacaagcccagcaacacaaaggtgga caagcgggtggaacccaagagctgcgacaagac ccacacctgtcccccctgccctgcccctgaactgct gggaggcccctccgtgttcctgttccccccaaagcc taaggacaccctgatgatcagccggacccccgaa gtgacctgcgtggtggtggacgtgtcccacgagga ccctgaagtgaagtttaattggtacgtggacggcgt ggaagtgcacaacgccaagaccaagcccagag aggaacagtacaacagcacctaccgggtggtgtc cgtgctgaccgtgctgcaccaggactggctgaacg gcaaagagtacaagtgcaaggtgtccaacaagg ccctgcctgcccccatcgagaaaaccatcagcaa ggccaaaggccagccccgcgagccccaggtgta cacactgccccctagccgggaagagatgaccaa gaaccaggtgtccctgacctgcctcgtgaagggctt ctaccccagcgacattgccgtggaatgggagagc aacggccagcccgagaacaactacaagaccacc ccccctgtgctggacagcgacggctcattcttcctgt acagcaagctgaccgtggacaagagccggtggc agcagggcaacgtgttcagctgctccgtgatgcac gaggccctgcacaaccactacacccagaagtccc tgagcctgagccccggcaag scFv (VL-linker-VH) SEQ ID NO: 75 ASPAAPAPSAQTVVTQEPSLTVSPG (aa) GTVTLICRSSTGAVTTSNYANWVQQ KPGQAPRGLIGGTKFLAPGTPARFSG SLLGGKAALTLLGAQPEDEAEYYCAL WYSNLWVFGGGTKLTVLGQASPAAP APASPAAPAPASGSEVQLVESGGGL VKPGGSLRLSCAASGFTFNTYAMNW VRQAPGKGLEWVGRIRSKYNNYATY YADSVKDRFTISRDDSKNTLYLQMNS LKTEDTAVYYCTTHGNFGNSYVSWF AYWGQGTLVTVSS scFv (VL-linker-VH) SEQ ID NO: 76 gcttctcctgctgctcctgctcctagcgctcagaccgt (DNA) ggtcacacaagagcccagcctgacagtttctcctgg cggcacagtgaccctgacctgcagatcttctacagg cgccgtgaccaccagcaactacgccaattgggtgc agcagaagcctggacaggctcccagaggactgat cggcggcacaaaatttctggcccctggcacaccag ccagattctctggatctctgctcggcggaaaggccg ctctgacactgcttggagcacagcctgaagatgag gccgagtactactgcgccctgtggtacagcaatctg tgggtgttcggcggaggtaccaagctgaccgtgctg ggccaggcctctcctgctgctcctgctccagcttctcc agccgctccagctcctgctagcggatctgaagtgca gctggtggaatctggcggcggactcgtgaagcctg gcggctctctgagactgagctgtgccgccagcggct tcaccttcaacacctacgccatgaactgggtgcgcc aggcccctggcaaaggcctggaatgggtgggacg gatcagaagcaagtacaacaattacgccacctact acgccgacagcgtgaaggaccggttcaccatcag ccgggacgacagcaagaacaccctgtacctgca gatgaacagcctgaaaaccgaggacaccgccgt gtactactgcaccacccacggcaacttcggcaaca gctatgtgtcttggtttgcctactggggccagggcac cctcgtgacagtctcgagc Bremen HCDR1 (Kabat) SEQ ID NO: 23 TYAMN HCDR2 (Kabat) SEQ ID NO: 24 RIRSKYNNYATYYADSVKD HCDR3 (Kabat) SEQ ID NO: 25 HGNFGNSYVSWFAY LCDR1 (Kabat) SEQ ID NO: 26 RSSTGAVTTSNYAN LCDR2 (Kabat) SEQ ID NO: 65 GTKFLAP LCDR3 (Kabat) SEQ ID NO: 28 ALWYSNLWV VL SEQ ID NO: 77 QTVVTQEPSLTVSPGGTVTLTCRSST SEQ ID NO: 19 GAVTTSNYANWVQQKPGQAPRGLIG GTKFLAPGTPARFSGSLLGGKAALTL SGVQPEDEAEYYCALWYSNLWVFG GGTKLTVLGQ VH SEQ ID NO: 78 EVQLVESGGGLVKPGGSLRLSCAAS SEQ ID NO: 7 GFTFNTYAMNWVRQAPGKGLEWVG RIRSKYNNYATYYADSVKDRFTISRD DSKNTLYLQMNSLKTEDTAVYYCTTH GNFGNSYVSWFAYWGQGTLVTVSS VL (DNA) SEQ ID NO: 79 cagaccgtggtcacacaagagcccagcctgaca SEQ ID NO: 20 gtttctcctggcggcacagtgaccctgacctgcagat cttctacaggcgccgtgaccaccagcaactacgcc aattgggtgcagcagaagcctggacaggctccca gaggactgatcggcggcacaaaatttctggcccct ggcacaccagccagattctctggatctctgctcggc ggaaaggccgctctgacactgtctggtgttcagcct gaggacgaggccgagtactattgcgccctgtggta cagcaacctgtgggtgttcggcggaggtaccaagc tgaccgtgctgggccag VH (DNA) SEQ ID NO: 80 gaagtgcagctggtggaatctggcggcggactcgt SEQ ID NO: 8 gaagcctggcggctctctgagactgagctgtgccg ccagcggcttcaccttcaacacctacgccatgaact gggtgcgccaggcccctggcaaaggcctggaatg ggtgggacggatcagaagcaagtacaacaattac gccacctactacgccgacagcgtgaaggaccggtt caccatcagccgggacgacagcaagaacaccct gtacctgcagatgaacagcctgaaaaccgaggac accgccgtgtactactgcaccacccacggcaactt cggcaacagctatgtgtcttggtttgcctactggggc cagggcaccctcgtgacagtctcgagc HCDR1 (Kabat) SEQ ID NO: 33 acctacgccatg (DNA) HCDR2 (Kabat) SEQ ID NO: 34 cggatcagaagcaagtacaacaattacgccacct (DNA) actacgccgacagcgtgaaggac HCDR3 (Kabat) SEQ ID NO: 35 cacggcaacttcggcaacagctatgtgtcttggtttg (DNA) cctac LCDR1 (Kabat SEQ ID NO: 36 agatcttctacaggcgccgtgaccaccagcaacta (DNA) cgccaat LCDR2 (Kabat) SEQ ID NO: 66 ggcacaaaatttctggcccct (DNA) LCDR3 (Kabat) SEQ ID NO: 38 gccctgtggtacagcaatctgtgggtg (DNA) Light chain (IgG) SEQ ID NO: 81 QTVVTQEPSLTVSPGGTVTLTCRSST GAVTTSNYANWVQQKPGQAPRGLIG GTKFLAPGTPARFSGSLLGGKAALTL SGVQPEDEAEYYCALWYSNLWVFG GGTKLTVLGQPKAAPSVTLFPPSSEE LQANKATLVCLISDFYPGAVTVAWKA DSSPVKAGVETTTPSKQSNNKYAAS SYLSLTPEQWKSHRSYSCQVTHEGS TVEKTVAPTECS Heavy chain (IgG1) SEQ ID NO: 82 EVQLVESGGGLVKPGGSLRLSCAAS GFTFNTYAMNWVRQAPGKGLEWVG RIRSKYNNYATYYADSVKDRFTISRD DSKNTLYLQMNSLKTEDTAVYYCTTH GNFGNSYVSWFAYWGQGTLVTVSS ASTKGPSVFPLAPSSKSTSGGTAALG CLVKDYFPEPVTVSWNSGALTSGVH TFPAVLQSSGLYSLSSVVTVPSSSLG TQTYICNVNHKPSNTKVDKRVEPKSC DKTHTCPPCPAPELLGGPSVFLFPPK PKDTLMISRTPEVTCVVVDVSHEDPE VKFNWYVDGVEVHNAKTKPREEQYN STYRVVSVLTVLHQDWLNGKEYKCK VSNKALPAPIEKTISKAKGQPREPQV YTLPPSREEMTKNQVSLTCLVKGFYP SDIAVEWESNGQPENNYKTTPPVLD SDGSFFLYSKLTVDKSRWQQGNVFS CSVMHEALHNHYTQKSLSLSPGK Light chain (DNA, SEQ ID NO: 83 cagaccgtggtcacacaagagcccagcctgaca IgG1) gtttctcctggcggcacagtgaccctgacctgcagat cttctacaggcgccgtgaccaccagcaactacgcc aattgggtgcagcagaagcctggacaggctccca gaggactgatcggcggcacaaaatttctggcccct ggcacaccagccagattctctggatctctgctcggc ggaaaggccgctctgacactgtctggtgttcagcct gaggacgaggccgagtactattgcgccctgtggta cagcaacctgtgggtgttcggcggaggtaccaagc tgaccgtgctgggccagcccaaagccgcccctag cgtgaccctgttccccccctcgagtgaggaactcca ggccaacaaggccaccctcgtgtgcctgatcagcg acttctaccctggcgccgtgaccgtggcctggaagg ccgatagcagccctgtgaaggccggcgtggaaac caccacccccagcaagcagagcaacaacaaata cgccgccagcagctacctgagcctgacccccgag cagtggaagtcccacagatcctacagctgccaggt cacacacgagggcagcaccgtggaaaagaccgt ggcccccaccgagtgcagc Heavy chain (DNA, SEQ ID NO: 84 gaagtgcagctggtggaatctggcggcggactcgt IgG1) gaagcctggcggctctctgagactgagctgtgccg ccagcggcttcaccttcaacacctacgccatgaact gggtgcgccaggcccctggcaaaggcctggaatg ggtgggacggatcagaagcaagtacaacaattac gccacctactacgccgacagcgtgaaggaccggtt caccatcagccgggacgacagcaagaacaccct gtacctgcagatgaacagcctgaaaaccgaggac accgccgtgtactactgcaccacccacggcaactt cggcaacagctatgtgtcttggtttgcctactggggc cagggcaccctcgtgacagtctcgagcgcgtcgac caaaggccccagcgtgttccctctggcccccagca gcaagagcacctctggcggaacagccgccctgg gctgcctggtcaaggactacttccccgagcccgtga ccgtgtcctggaactctggcgccctgaccagcggc gtgcacacctttccagccgtgctccagagcagcgg cctgtacagcctgagcagcgtcgtgaccgtgccca gcagcagcctgggcacccagacctacatctgcaa cgtgaaccacaagcccagcaacacaaaggtgga caagcgggtggaacccaagagctgcgacaagac ccacacctgtcccccctgccctgcccctgaactgct gggaggcccctccgtgttcctgttccccccaaagcc taaggacaccctgatgatcagccggacccccgaa gtgacctgcgtggtggtggacgtgtcccacgagga ccctgaagtgaagtttaattggtacgtggacggcgt ggaagtgcacaacgccaagaccaagcccagag aggaacagtacaacagcacctaccgggtggtgtc cgtgctgaccgtgctgcaccaggactggctgaacg gcaaagagtacaagtgcaaggtgtccaacaagg ccctgcctgcccccatcgagaaaaccatcagcaa ggccaaaggccagccccgcgagccccaggtgta cacactgccccctagccgggaagagatgaccaa gaaccaggtgtccctgacctgcctcgtgaagggctt ctaccccagcgacattgccgtggaatgggagagc aacggccagcccgagaacaactacaagaccacc ccccctgtgctggacagcgacggctcattcttcctgt acagcaagctgaccgtggacaagagccggtggc agcagggcaacgtgttcagctgctccgtgatgcac gaggccctgcacaaccactacacccagaagtccc tgagcctgagccccggcaag scFv (VL-linker-VH) SEQ ID NO: ASPAAPAPSAQTVVTQEPSLTVSPG 156 GTVTLTCRSSTGAVTTSNYANWVQQ KPGQAPRGLIGGTKFLAPGTPARFSG SLLGGKAALTLSGVQPEDEAEYYCAL WYSNLWVFGGGTKLTVLGQASPAAP APASPAAPAPASGSEVQLVESGGGL VKPGGSLRLSCAASGFTFNTYAMNW VRQAPGKGLEWVGRIRSKYNNYATY YADSVKDRFTISRDDSKNTLYLQMNS LKTEDTAVYYCTTHGNFGNSYVSWF AYWGQGTLVTVSS scFv (VL-linker-VH) SEQ ID NO: gcttctcctgctgctcctgctcctagcgctcagaccgt DNA 157 ggtcacacaagagcccagcctgacagtttctcctgg cggcacagtgaccctgacctgcagatcttctacagg cgccgtgaccaccagcaactacgccaattgggtgc agcagaagcctggacaggctcccagaggactgat cggcggcacaaaatttctggcccctggcacaccag ccagattctctggatctctgctcggcggaaaggccg ctctgacactgtctggtgttcagcctgaggacgagg ccgagtactattgcgccctgtggtacagcaacctgt gggtgttcggcggaggtaccaagctgaccgtgctg ggccaggcctctcctgctgctcctgctccagcttctcc agccgctccagctcctgctagcggatctgaagtgca gctggtggaatctggcggcggactcgtgaagcctg gcggctctctgagactgagctgtgccgccagcggct tcaccttcaacacctacgccatgaactgggtgcgcc aggcccctggcaaaggcctggaatgggtgggacg gatcagaagcaagtacaacaattacgccacctact acgccgacagcgtgaaggaccggttcaccatcag ccgggacgacagcaagaacaccctgtacctgca gatgaacagcctgaaaaccgaggacaccgccgt gtactactgcaccacccacggcaacttcggcaaca gctatgtgtcttggtttgcctactggggccagggcac cctcgtgacagtctcgagc Gladbach HCDR1 (Kabat) SEQ ID NO: 23 TYAMN HCDR2 (Kabat) SEQ ID NO: 24 RIRSKYNNYATYYADSVKD HCDR3 (Kabat) SEQ ID NO: 25 HGNFGNSYVSWFAY LCDR1 (Kabat) SEQ ID NO: 26 RSSTGAVTTSNYAN LCDR2 (Kabat) SEQ ID NO: 65 GTKFLAP LCDR3 (Kabat) SEQ ID NO: 28 ALWYSNLWV VL SEQ ID NO: 85 QTVVTQEPSLTVSPGGTVTLTCRSST SEQ ID NO: 19 GAVTTSNYANWVQQKPGQAPRGLIG GTKFLAPGTPARFSGSLLGGKAALTL SGVQPEDEAEYYCALWYSNLWVFG GGTKLTVLGQ VH SEQ ID NO: 86 QVQLVESGGGLVKPGGSLRLSCAAS SEQ ID NO: 9 GFTFNTYAMNWIRQAPGKGLEWVSR IRSKYNNYATYYADSVKDRFTISRDN AKNSLYLQMNSLRAEDTAVYYCVRH GNFGNSYVSWFAYWGQGTLVTVSS VL (DNA) SEQ ID NO: 87 cagaccgtggtcacacaagagcccagcctgaca SEQ ID NO: 20 gtttctcctggcggcacagtgaccctgacctgcagat cttctacaggcgccgtgaccaccagcaactacgcc aattgggtgcagcagaagcctggacaggctccca gaggactgatcggcggcacaaaatttctggcccct ggcacaccagccagattctctggatctctgctcggc ggaaaggccgctctgacactgtctggtgttcagcct gaggacgaggccgagtactattgcgccctgtggta cagcaacctgtgggtgttcggcggaggtaccaagc tgaccgtgctgggccag VH (DNA) SEQ ID NO: 88 caggtgcagctggtggaatctggcggcggactcgt SEQ ID NO: 10 gaagcctggcggctctctgagactgagctgtgccg ccagcggcttcaccttcaacacctacgccatgaact ggatccggcaggcccctggcaagggcctggaatg ggtgtcccggatcagaagcaagtacaacaattacg ccacctactacgccgacagcgtgaaggaccggttc accatcagccgggacaacgccaagaacagcctg tacctgcagatgaactccctgcgggccgaggacac cgccgtgtactattgtgtgcggcacggcaacttcgg caacagctatgtgtcttggtttgcctactggggccag ggcaccctcgtgacagtctcgagc HCDR1 (Kabat) SEQ ID NO: 33 acctacgccatg HCDR2 (Kabat) SEQ ID NO: 34 cggatcagaagcaagtacaacaattacgccacct actacgccgacagcgtgaaggac HCDR3 (Kabat) SEQ ID NO: 35 cacggcaacttcggcaacagctatgtgtcttggtttg cctac LCDR1 (Kabat) SEQ ID NO: 36 agatcttctacaggcgccgtgaccaccagcaacta cgccaat LCDR2 (Kabat) SEQ ID NO: 66 ggcacaaaatttctggcccct LCDR3 (Kabat) SEQ ID NO: 38 gccctgtggtacagcaatctgtgggtg Light chain (IgG) SEQ ID NO: 89 QTVVTQEPSLTVSPGGTVTLTCRSST GAVTTSNYANWVQQKPGQAPRGLIG GTKFLAPGTPARFSGSLLGGKAALTL SGVQPEDEAEYYCALWYSNLWVFG GGTKLTVLGQPKAAPSVTLFPPSSEE LQANKATLVCLISDFYPGAVTVAWKA DSSPVKAGVETTTPSKQSNNKYAAS SYLSLTPEQWKSHRSYSCQVTHEGS TVEKTVAPTECS Heavy chain (IgG1) SEQ ID NO: 90 QVQLVESGGGLVKPGGSLRLSCAAS GFTFNTYAMNWIRQAPGKGLEWVSR IRSKYNNYATYYADSVKDRFTISRDN AKNSLYLQMNSLRAEDTAVYYCVRH GNFGNSYVSWFAYWGQGTLVTVSS ASTKGPSVFPLAPSSKSTSGGTAALG CLVKDYFPEPVTVSWNSGALTSGVH TFPAVLQSSGLYSLSSVVTVPSSSLG TQTYICNVNHKPSNTKVDKRVEPKSC DKTHTCPPCPAPELLGGPSVFLFPPK PKDTLMISRTPEVTCVVVDVSHEDPE VKFNWYVDGVEVHNAKTKPREEQYN STYRVVSVLTVLHQDWLNGKEYKCK VSNKALPAPIEKTISKAKGQPREPQV YTLPPSREEMTKNQVSLTCLVKGFYP SDIAVEWESNGQPENNYKTTPPVLD SDGSFFLYSKLTVDKSRWQQGNVFS CSVMHEALHNHYTQKSLSLSPGK Light chain (DNA) SEQ ID NO: 91 cagaccgtggtcacacaagagcccagcctgaca gtttctcctggcggcacagtgaccctgacctgcagat cttctacaggcgccgtgaccaccagcaactacgcc aattgggtgcagcagaagcctggacaggctccca gaggactgatcggcggcacaaaatttctggcccct ggcacaccagccagattctctggatctctgctcggc ggaaaggccgctctgacactgtctggtgttcagcct gaggacgaggccgagtactattgcgccctgtggta cagcaacctgtgggtgttcggcggaggtaccaagc tgaccgtgctgggccagcccaaagccgcccctag cgtgaccctgttccccccctcgagtgaggaactcca ggccaacaaggccaccctcgtgtgcctgatcagcg acttctaccctggcgccgtgaccgtggcctggaagg ccgatagcagccctgtgaaggccggcgtggaaac caccacccccagcaagcagagcaacaacaaata cgccgccagcagctacctgagcctgacccccgag cagtggaagtcccacagatcctacagctgccaggt cacacacgagggcagcaccgtggaaaagaccgt ggcccccaccgagtgcagc Heavy chain (DNA, SEQ ID NO: 92 caggtgcagctggtggaatctggcggcggactcgt IgG1) gaagcctggcggctctctgagactgagctgtgccg ccagcggcttcaccttcaacacctacgccatgaact ggatccggcaggcccctggcaagggcctggaatg ggtgtcccggatcagaagcaagtacaacaattacg ccacctactacgccgacagcgtgaaggaccggttc accatcagccgggacaacgccaagaacagcctg tacctgcagatgaactccctgcgggccgaggacac cgccgtgtactattgtgtgcggcacggcaacttcgg caacagctatgtgtcttggtttgcctactggggccag ggcaccctcgtgacagtctcgagcgcgtcgaccaa aggccccagcgtgttccctctggcccccagcagca agagcacctctggcggaacagccgccctgggctg cctggtcaaggactacttccccgagcccgtgaccgt gtcctggaactctggcgccctgaccagcggcgtgc acacctttccagccgtgctccagagcagcggcctgt acagcctgagcagcgtcgtgaccgtgcccagcag cagcctgggcacccagacctacatctgcaacgtga accacaagcccagcaacacaaaggtggacaag cgggtggaacccaagagctgcgacaagacccac acctgtcccccctgccctgcccctgaactgctggga ggcccctccgtgttcctgttccccccaaagcctaag gacaccctgatgatcagccggacccccgaagtga cctgcgtggtggtggacgtgtcccacgaggaccct gaagtgaagtttaattggtacgtggacggcgtggaa gtgcacaacgccaagaccaagcccagagagga acagtacaacagcacctaccgggtggtgtccgtgc tgaccgtgctgcaccaggactggctgaacggcaa agagtacaagtgcaaggtgtccaacaaggccctg cctgcccccatcgagaaaaccatcagcaaggcca aaggccagccccgcgagccccaggtgtacacact gccccctagccgggaagagatgaccaagaacca ggtgtccctgacctgcctcgtgaagggcttctacccc agcgacattgccgtggaatgggagagcaacggcc agcccgagaacaactacaagaccaccccccctgt gctggacagcgacggctcattcttcctgtacagcaa gctgaccgtggacaagagccggtggcagcaggg caacgtgttcagctgctccgtgatgcacgaggccct gcacaaccactacacccagaagtccctgagcctg agccccggcaagtga scFv (VL-linker-VH) SEQ ID NO: 93 ASPAAPAPSAQTVVTQEPSLTVSPG GTVTLTCRSSTGAVTTSNYANWVQQ KPGQAPRGLIGGTKFLAPGTPARFSG SLLGGKAALTLSGVQPEDEAEYYCAL WYSNLWVFGGGTKLTVLGQASPAAP APASPAAPAPASGSQVQLVESGGGL VKPGGSLRLSCAASGFTFNTYAMNW IRQAPGKGLEWVSRIRSKYNNYATYY ADSVKDRFTISRDNAKNSLYLQMNSL RAEDTAVYYCVRHGNFGNSYVSWFA YWGQGTLVTVSS scFv (VL-linker-VH) SEQ ID NO: 94 gcttctcctgctgctcctgctcctagcgctcagaccgt (DNA) ggtcacacaagagcccagcctgacagtttctcctgg cggcacagtgaccctgacctgcagatcttctacagg cgccgtgaccaccagcaactacgccaattgggtgc agcagaagcctggacaggctcccagaggactgat cggcggcacaaaatttctggcccctggcacaccag ccagattctctggatctctgctcggcggaaaggccg ctctgacactgtctggtgttcagcctgaggacgagg ccgagtactattgcgccctgtggtacagcaacctgt gggtgttcggcggaggtaccaagctgaccgtgctg ggccaggcctctcctgctgctcctgctccagcttctcc agccgctccagctcctgctagcggatctcaggtgca gctggtggaatctggcggcggactcgtgaagcctg gcggctctctgagactgagctgtgccgccagcggct tcaccttcaacacctacgccatgaactggatccggc aggcccctggcaagggcctggaatgggtgtcccg gatcagaagcaagtacaacaattacgccacctact acgccgacagcgtgaaggaccggttcaccatcag ccgggacaacgccaagaacagcctgtacctgca gatgaactccctgcgggccgaggacaccgccgtgt actattgtgtgcggcacggcaacttcggcaacagct atgtgtcttggtttgcctactggggccagggcaccct cgtgacagtctcgagc Nürnberg HCDR1 (Kabat) SEQ ID NO: 23 TYAMN HCDR2 (Kabat) SEQ ID NO: 24 RIRSKYNNYATYYADSVKD HCDR3 (Kabat) SEQ ID NO: 25 HGNFGNSYVSWFAY LCDR1 (Kabat) SEQ ID NO: 26 RSSTGAVTTSNYAN LCDR2 (Kabat) SEQ ID NO: 27 GTNKRAP LCDR3 (Kabat) SEQ ID NO: 28 ALWYSNLWV VL SEQ ID NO: 95 QTVVTQEPSLTVSPGGTVTLTCRSST SEQ ID NO: 21 GAVTTSNYANWVQQKPGQAPRGLIG GTNKRAPGTPARFSGSLLGGKAALTL SGVQPEDEAEYYCALWYSNLWVFG GGTKLTVLGQ VH SEQ ID NO: 96 QVQLVESGGGLVKPGGSLRLSCAAS SEQ ID NO: 9 GFTFNTYAMNWIRQAPGKGLEWVSR IRSKYNNYATYYADSVKDRFTISRDN AKNSLYLQMNSLRAEDTAVYYCVRH GNFGNSYVSWFAYWGQGTLVTVSS VL (DNA) SEQ ID NO: 97 cagaccgtggtcacacaagagcccagcctgaca SEQ ID NO: 22 gtttctcctggcggcacagtgaccctgacctgcagat cttctacaggcgccgtgaccaccagcaactacgcc aattgggtgcagcagaagcctggacaggctccca gaggactgatcggcggcacaaacaaaagagccc ctggcacaccagccagattcagcggatcactgctc ggaggaaaggccgctctgacactgtctggtgtcca gcctgaagatgaggccgagtactactgcgccctgt ggtacagcaatctgtgggtgttcggcggaggtacc aagctgaccgtgctgggccag VH (DNA) SEQ ID NO: 98 caggtgcagctggtggaatctggcggcggactcgt SEQ ID NO: 10 gaagcctggcggctctctgagactgagctgtgccg ccagcggcttcaccttcaacacctacgccatgaact ggatccggcaggcccctggcaagggcctggaatg ggtgtcccggatcagaagcaagtacaacaattacg ccacctactacgccgacagcgtgaaggaccggttc accatcagccgggacaacgccaagaacagcctg tacctgcagatgaactccctgcgggccgaggacac cgccgtgtactattgtgtgcggcacggcaacttcgg caacagctatgtgtcttggtttgcctactggggccag ggcaccctcgtgacagtctcgagc HCDR1 (Kabat) SEQ ID NO: 33 acctacgccatg HCDR2 (Kabat) SEQ ID NO: 34 cggatcagaagcaagtacaacaattacgccacct actacgccgacagcgtgaaggac HCDR3 (Kabat) SEQ ID NO: 35 cacggcaacttcggcaacagctatgtgtcttggtttg cctac LCDR1 (Kabat) SEQ ID NO: 36 agatcttctacaggcgccgtgaccaccagcaacta cgccaat LCDR2 (Kabat) SEQ ID NO: 37 ggcacaaacaaaagagcccct LCDR3 (Kabat) SEQ ID NO: 38 gccctgtggtacagcaatctgtgggtg Light chain (IgG) SEQ ID NO: 99 QTVVTQEPSLTVSPGGTVTLTCRSST GAVTTSNYANWVQQKPGQAPRGLIG GTNKRAPGTPARFSGSLLGGKAALTL SGVQPEDEAEYYCALWYSNLWVFG GGTKLTVLGQPKAAPSVTLFPPSSEE LQANKATLVCLISDFYPGAVTVAWKA DSSPVKAGVETTTPSKQSNNKYAAS SYLSLTPEQWKSHRSYSCQVTHEGS TVEKTVAPTECS Heavy chain (IgG1) SEQ ID NO: QVQLVESGGGLVKPGGSLRLSCAAS 100 GFTFNTYAMNWIRQAPGKGLEWVSR IRSKYNNYATYYADSVKDRFTISRDN AKNSLYLQMNSLRAEDTAVYYCVRH GNFGNSYVSWFAYWGQGTLVTVSS ASTKGPSVFPLAPSSKSTSGGTAALG CLVKDYFPEPVTVSWNSGALTSGVH TFPAVLQSSGLYSLSSVVTVPSSSLG TQTYICNVNHKPSNTKVDKRVEPKSC DKTHTCPPCPAPELLGGPSVFLFPPK PKIDTLMISRTPEVTCVVVDVSHEDPE VKFNWYVDGVEVHNAKTKPREEQYN STYRVVSVLTVLHQDWLNGKEYKCK VSNKALPAPIEKTISKAKGQPREPQV YTLPPSREEMTKNQVSLTCLVKGFYP SDIAVEWESNGQPENNYKTTPPVLD SDGSFFLYSKLTVDKSRWQQGNVFS CSVMHEALHNHYTQKSLSLSPGK Light chain (DNA) SEQ ID NO: cagaccgtggtcacacaagagcccagcctgaca 101 gtttctcctggcggcacagtgaccctgacctgcagat cttctacaggcgccgtgaccaccagcaactacgcc aattgggtgcagcagaagcctggacaggctccca gaggactgatcggcggcacaaacaaaagagccc ctggcacaccagccagattcagcggatcactgctc ggaggaaaggccgctctgacactgtctggtgtcca gcctgaagatgaggccgagtactactgcgccctgt ggtacagcaatctgtgggtgttcggcggaggtacc aagctgaccgtgctgggccagcccaaagccgccc ctagcgtgaccctgttccccccctcgagtgaggaac tccaggccaacaaggccaccctcgtgtgcctgatc agcgacttctaccctggcgccgtgaccgtggcctgg aaggccgatagcagccctgtgaaggccggcgtgg aaaccaccacccccagcaagcagagcaacaac aaatacgccgccagcagctacctgagcctgaccc ccgagcagtggaagtcccacagatcctacagctgc caggtcacacacgagggcagcaccgtggaaaag accgtggcccccaccgagtgcagc Heavy chain (DNA, SEQ ID NO: caggtgcagctggtggaatctggcggcggactcgt IgG1) 102 gaagcctggcggctctctgagactgagctgtgccg ccagcggcttcaccttcaacacctacgccatgaact ggatccggcaggcccctggcaagggcctggaatg ggtgtcccggatcagaagcaagtacaacaattacg ccacctactacgccgacagcgtgaaggaccggttc accatcagccgggacaacgccaagaacagcctg tacctgcagatgaactccctgcgggccgaggacac cgccgtgtactattgtgtgcggcacggcaacttcgg caacagctatgtgtcttggtttgcctactggggccag ggcaccctcgtgacagtctcgagcgcgtcgaccaa aggccccagcgtgttccctctggcccccagcagca agagcacctctggcggaacagccgccctgggctg cctggtcaaggactacttccccgagcccgtgaccgt gtcctggaactctggcgccctgaccagcggcgtgc acacctttccagccgtgctccagagcagcggcctgt acagcctgagcagcgtcgtgaccgtgcccagcag cagcctgggcacccagacctacatctgcaacgtga accacaagcccagcaacacaaaggtggacaag cgggtggaacccaagagctgcgacaagacccac acctgtcccccctgccctgcccctgaactgctggga ggcccctccgtgttcctgttccccccaaagcctaag gacaccctgatgatcagccggacccccgaagtga cctgcgtggtggtggacgtgtcccacgaggaccct gaagtgaagtttaattggtacgtggacggcgtggaa gtgcacaacgccaagaccaagcccagagagga acagtacaacagcacctaccgggtggtgtccgtgc tgaccgtgctgcaccaggactggctgaacggcaa agagtacaagtgcaaggtgtccaacaaggccctg cctgcccccatcgagaaaaccatcagcaaggcca aaggccagccccgcgagccccaggtgtacacact gccccctagccgggaagagatgaccaagaacca ggtgtccctgacctgcctcgtgaagggcttctacccc agcgacattgccgtggaatgggagagcaacggcc agcccgagaacaactacaagaccaccccccctgt gctggacagcgacggctcattcttcctgtacagcaa gctgaccgtggacaagagccggtggcagcaggg caacgtgttcagctgctccgtgatgcacgaggccct gcacaaccactacacccagaagtccctgagcctg agccccggcaagtga scFv (VL-linker-VH) SEQ ID NO: ASPAAPAPSAQTVVTQEPSLTVSPG 103 GTVTLTCRSSTGAVTTSNYANWVQQ KPGQAPRGLIGGTNKRAPGTPARFS GSLLGGKAALTLSGVQPEDEAEYYC ALWYSNLWVFGGGTKLTVLGQASPA APAPASPAAPAPASGSQVQLVESGG GLVKPGGSLRLSCAASGFTFNTYAM NWIRQAPGKGLEWVSRIRSKYNNYA TYYADSVKDRFTISRDNAKNSLYLQM NSLRAEDTAVYYCVRHGNFGNSYVS WFAYWGQGTLVTVSS scFv (VL-linker-VH) SEQ ID NO: gcttctcctgctgctcctgctcctagcgctcagaccgt (DNA) 104 ggtcacacaagagcccagcctgacagtttctcctgg cggcacagtgaccctgacctgcagatcttctacagg cgccgtgaccaccagcaactacgccaattgggtgc agcagaagcctggacaggctcccagaggactgat cggcggcacaaacaaaagagcccctggcacacc agccagattcagcggatcactgctcggaggaaag gccgctctgacactgtctggtgtccagcctgaagat gaggccgagtactactgcgccctgtggtacagcaa tctgtgggtgttcggcggaggtaccaagctgaccgt gctgggccaggcctctcctgctgctcctgctccagct tctccagccgctccagctcctgctagcggatctcag gtgcagctggtggaatctggcggcggactcgtgaa gcctggcggctctctgagactgagctgtgccgccag cggcttcaccttcaacacctacgccatgaactggat ccggcaggcccctggcaagggcctggaatgggtg tcccggatcagaagcaagtacaacaattacgcca cctactacgccgacagcgtgaaggaccggttcacc atcagccgggacaacgccaagaacagcctgtac ctgcagatgaactccctgcgggccgaggacaccg ccgtgtactattgtgtgcggcacggcaacttcggca acagctatgtgtcttggtttgcctactggggccaggg caccctcgtgacagtctcgagc
(295) TABLE-US-00010 TABLE 6 Bispecific antibody sequences. Each of the listed antibodies shares the same IgG light chain of RefmAb#2_h_Igkappa (SEQ ID NO: 119/120) anti-Her2 [IgG1- AEASS] x anti- Antibody CD3 [scFv] SEQ ID NO: [aa]/DNA BsAb#Mainz RefmAb#2 SEQ ID NO: QVQLVESGGGLVQPGGSLRLSCAASG (IgG1- 105 FNIKDTYIHWVRQAPGKGLEWVARIYP AEASS_HC) x TNGYTRYADSVKGRFTISADTSKNTAY mAb#Mainz LQMNSLRAEDTAVYYCSRWGGDGFY (scFv) AMDYWGQGTLVTVSSASTKGPSVFPL APSSKSTSGGTAALGCLVKDYFPEPVT VSWNSGALTSGVHTFPAVLQSSGLYS LSSVVTVPSSSLGTQTYICNVNHKPSN TKVDKRVEPKSCDKTHTCPPCPAPEA EGAPSVFLFPPKPKDTLMISRTPEVTC VVVDVSHEDPEVKFNWYVDGVEVHNA KTKPREEQYNSTYRVVSVLTVLHQDW LNGKEYKCKVSNKALPSSIEKTISKAKG QPREPQVYTLPPSREEMTKNQVSLTC LVKGFYPSDIAVEWESNGQPENNYKT TPPVLDSDGSFFLYSKLTVDKSRWQQ GNVFSCSVMHEALHNHYTQKSLSLSP GKASPAAPAPSAQAVVTQEPSLTVSP GGTVTLTCRSSTGAVTTSNYANWVQQ KPGQAPRGLIGGTNKRAPWTPARFSG SLLGGKAALTITGAQAEDEADYYCALW YSNLWVFGGGTKLTVLGQASPAAPAP ASPAAPAPASGSQVQLVESGGGLVKP GGSLRLSCAASGFTFNTYAMNWIRQA PGKGLEWVSRIRSKYNNYATYYADSV KDRFTISRDNAKNSLYLQMNSLRAEDT AVYYCVRHGNFGNSYVSWFAYWGQG TLVTVSS RefmAb#2 SEQ ID NO: caggtgcaattggtggagtctggcggaggactggtgc (IgG1- 106 agcctgggggcagcctgagactgagctgcgccgcc AEASS_HC) x agcggcttcaacatcaaggacacctacatccactgg mAb#Mainz gtgcgccaggctccaggcaagggactggaatgggt (scFv) ggcccggatctaccccaccaacggctacaccagata (DNA) cgccgacagcgtgaagggccggttcaccatcagcg ccgacaccagcaagaacaccgcctacctgcagatg aacagcctgcgggccgaggacaccgccgtgtacta ctgcagcagatggggcggagatggcttctacgccatg gactactggggccagggcaccctggtgaccgtctcg agcgcgtcgaccaaaggccccagcgtgttccctctgg cccccagcagcaagagcacctctggcggaacagcc gccctgggctgcctggtcaaggactacttccccgagc ccgtgaccgtgtcctggaactctggcgccctgaccag cggcgtgcacacctttccagccgtgctccagagcagc ggcctgtacagcctgagcagcgtcgtgaccgtgccc agcagcagcctgggcacccagacctacatctgcaac gtgaaccacaagcccagcaacacaaaggtggaca agcgggtggaacccaagagctgcgacaagaccca cacctgtcccccctgccctgcccctgaagcggaggg agccccctccgtgttcctgttccccccaaagcctaagg acaccctgatgatcagccggacccccgaagtgacct gcgtggtggtggacgtgtcccacgaggaccctgaagt gaagtttaattggtacgtggacggcgtggaagtgcac aacgccaagaccaagcccagagaggaacagtaca acagcacctaccgggtggtgtccgtgctgaccgtgct gcaccaggactggctgaacggcaaagagtacaagt gcaaggtgtccaacaaggccctgccttcctccatcga gaaaaccatcagcaaggccaaaggccagccccgc gagccccaggtgtacacactgccccctagccgggaa gagatgaccaagaaccaggtgtccctgacctgcctc gtgaagggcttctaccccagcgacattgccgtggaat gggagagcaacggccagcccgagaacaactacaa gaccaccccccctgtgctggacagcgacggctcattc ttcctgtacagcaagctgaccgtggacaagagccggt ggcagcagggcaacgtgttcagctgctccgtgatgca cgaggccctgcacaaccactacacccagaagtccct gagcctgagccccggcaaggcttctcctgctgctcctg ctcctagcgctcaggccgtggttacacaagagccca gcctgacagttagccctggcggaacagtgaccctga cctgcagatcttctacaggcgccgtgaccaccagcaa ctacgccaattgggtgcagcagaagcctggacaggc tcccagaggactgatcggcggcacaaacaaaagag ccccttggacacccgccagattcagcggatcactgct cggaggaaaggccgcactgacaatcacaggtgccc aggccgaagatgaggccgattactattgcgccctgtg gtacagcaacctgtgggtgttcggcggaggtaccaa gctgaccgtgctgggccaggcctctcctgctgctcctg ctccagcttctccagccgctccagctcctgctagcgga tctcaggtgcagctggtggaatctggcggcggactcgt gaagcctggcggctctctgagactgagctgtgccgcc agcggcttcaccttcaacacctacgccatgaactgga tccggcaggcccctggcaagggcctggaatgggtgt cccggatcagaagcaagtacaacaattacgccacct actacgccgacagcgtgaaggaccggttcaccatca gccgggacaacgccaagaacagcctgtacctgcag atgaactccctgcgggccgaggacaccgccgtgtac tattgtgtgcggcacggcaacttcggcaacagctatgt gtcttggtttgcctactggggccagggcaccctcgtga cagtctcgagc BsAb#Köln RefmAb#2 SEQ ID NO: QVQLVESGGGLVQPGGSLRLSCAASG (IgG1f_AEASS_ 107 FNIKDTYIHWVRQAPGKGLEWVARIYP HC) x mAb#KöIn TNGYTRYADSVKGRFTISADTSKNTAY (scFv) LQMNSLRAEDTAVYYCSRWGGDGFY AMDYWGQGTLVTVSSASTKGPSVFPL APSSKSTSGGTAALGCLVKDYFPEPVT VSWNSGALTSGVHTFPAVLQSSGLYS LSSVVTVPSSSLGTQTYICNVNHKPSN TKVDKRVEPKSCDKTHTCPPCPAPEA EGAPSVFLFPPKPKDTLMISRTPEVTC VVVDVSHEDPEVKFNWYVDGVEVHNA KTKPREEQYNSTYRVVSVLTVLHQDW LNGKEYKCKVSNKALPSSIEKTISKAKG QPREPQVYTLPPSREEMTKNQVSLTC LVKGFYPSDIAVEWESNGQPENNYKT TPPVLDSDGSFFLYSKLTVDKSRWQQ GNVFSCSVMHEALHNHYTQKSLSLSP GKASPAAPAPSAELVVTQEPSLTVSPG GTVTLTCRSSTGAVTTSNYANWVQQK PGQAPRGLIGGTNKRAPGTPARFSGS LLGGKAALTLSGVQPEDEAEYYCALW YSNLWVFGGGTKLTVLGQASPAAPAP ASPAAPAPASGSQVQLVESGGGLVKP GGSLRLSCAASGFTFNTYAMNWIRQA PGKGLEWVSRIRSKYNNYATYYADSV KDRFTISRDNAKNSLYLQMNSLRAEDT AVYYCVRHGNFGNSYVSWFAYWGQG TLVTVSS RefmAb#2 SEQ ID NO: caggtgcaattggtggagtctggcggaggactggtgc (IgG1f_AEASS_ 108 agcctgggggcagcctgagactgagctgcgccgcc HC) x mAb#Köln agcggcttcaacatcaaggacacctacatccactgg (scFv) gtgcgccaggctccaggcaagggactggaatgggt (DNA) ggcccggatctaccccaccaacggctacaccagata cgccgacagcgtgaagggccggttcaccatcagcg ccgacaccagcaagaacaccgcctacctgcagatg aacagcctgcgggccgaggacaccgccgtgtacta ctgcagcagatggggcggagatggcttctacgccatg gactactggggccagggcaccctggtgaccgtctcg agcgcgtcgaccaaaggccccagcgtgttccctctgg cccccagcagcaagagcacctctggcggaacagcc gccctgggctgcctggtcaaggactacttccccgagc ccgtgaccgtgtcctggaactctggcgccctgaccag cggcgtgcacacctttccagccgtgctccagagcagc ggcctgtacagcctgagcagcgtcgtgaccgtgccc agcagcagcctgggcacccagacctacatctgcaac gtgaaccacaagcccagcaacacaaaggtggaca agcgggtggaacccaagagctgcgacaagaccca cacctgtcccccctgccctgcccctgaagcggaggg agccccctccgtgttcctgttccccccaaagcctaagg acaccctgatgatcagccggacccccgaagtgacct gcgtggtggtggacgtgtcccacgaggaccctgaagt gaagtttaattggtacgtggacggcgtggaagtgcac aacgccaagaccaagcccagagaggaacagtaca acagcacctaccgggtggtgtccgtgctgaccgtgct gcaccaggactggctgaacggcaaagagtacaagt gcaaggtgtccaacaaggccctgccttcctccatcga gaaaaccatcagcaaggccaaaggccagccccgc gagccccaggtgtacacactgccccctagccgggaa gagatgaccaagaaccaggtgtccctgacctgcctc gtgaagggcttctaccccagcgacattgccgtggaat gggagagcaacggccagcccgagaacaactacaa gaccaccccccctgtgctggacagcgacggctcattc ttcctgtacagcaagctgaccgtggacaagagccggt ggcagcagggcaacgtgttcagctgctccgtgatgca cgaggccctgcacaaccactacacccagaagtccct gagcctgagccccggcaaggcttctcctgctgctcctg ctcctagcgctgagctggtggtcacacaagagccca gcctgacagtttctcctggcggcacagtgaccctgacc tgcagatcttctacaggcgccgtgaccacctccaacta cgccaattgggtgcagcagaagcctggacaggctcc cagaggactgatcggcggcacaaacaaaagagcc cctggcacaccagccagattcagcggatcactgctcg gaggaaaggccgctctgacactgtctggtgtccagcc tgaagatgaggccgagtactactgcgccctgtggtac agcaatctgtgggtgttcggcggaggtaccaagctga ccgtgctgggccaggcctctcctgctgctcctgctcca gcttctccagccgctccagctcctgctagcggatctca ggtgcagctggtggaatctggcggcggactcgtgaa gcctggcggctctctgagactgagctgtgccgccagc ggcttcaccttcaacacctacgccatgaactggatccg gcaggcccctggcaagggcctggaatgggtgtcccg gatcagaagcaagtacaacaattacgccacctacta cgccgacagcgtgaaggaccggttcaccatcagcc gggacaacgccaagaacagcctgtacctgcagatg aactccctgcgggccgaggacaccgccgtgtactatt gtgtgcggcacggcaacttcggcaacagctatgtgtct tggtttgcctactggggccagggcaccctcgtgacagt ctcgagc BsAb# RefmAb#2 SEQ ID NO: QVQLVESGGGLVQPGGSLRLSCAASG Freiburg (IgG1f_AEASS_ 109 FNIKDTYIHWVRQAPGKGLEWVARIYP HC) x TNGYTRYADSVKGRFTISADTSKNTAY mAb#Freiburg LQMNSLRAEDTAVYYCSRWGGDGFY (scFv) AMDYWGQGTLVTVSSASTKGPSVFPL APSSKSTSGGTAALGCLVKDYFPEPVT VSWNSGALTSGVHTFPAVLQSSGLYS LSSVVTVPSSSLGTQTYICNVNHKPSN TKVDKRVEPKSCDKTHTCPPCPAPEA EGAPSVFLFPPKPKDTLMISRTPEVTC VVVDVSHEDPEVKFNWYVDGVEVHNA KTKPREEQYNSTYRVVSVLTVLHQDW LNGKEYKCKVSNKALPSSIEKTISKAKG QPREPQVYTLPPSREEMTKNQVSLTC LVKGFYPSDIAVEWESNGQPENNYKT TPPVLDSDGSFFLYSKLTVDKSRWQQ GNVFSCSVMHEALHNHYTQKSLSLSP GKASPAAPAPSAQTVVTQEPSLTVSP GGTVTLTCRSSTGAVTTSNYANWVQQ KPGQAPRGLIGGTNKRAPGTPARFSG SLLGGKAALTLLGAQPEDEAEYYCALW YSNLWVFGGGTKLTVLGQASPAAPAP ASPAAPAPASGSEVQLVESGGGLVKP GGSLRLSCAASGFTFNTYAMNWVRQA PGKGLEWVGRIRSKYNNYATYYADSV KDRFTISRDDSKNTLYLQMNSLKTEDT AVYYCTTHGNFGNSYVSWFAYWGQG TLVTVSS RefmAb#2 SEQ ID NO: caggtgcaattggtggagtctggcggaggactggtgc (IgG1f_AEASS_ 110 agcctgggggcagcctgagactgagctgcgccgcc HC) x agcggcttcaacatcaaggacacctacatccactgg mAb#Freiburg gtgcgccaggctccaggcaagggactggaatgggt (scFv) ggcccggatctaccccaccaacggctacaccagata (DNA) cgccgacagcgtgaagggccggttcaccatcagcg ccgacaccagcaagaacaccgcctacctgcagatg aacagcctgcgggccgaggacaccgccgtgtacta ctgcagcagatggggcggagatggcttctacgccatg gactactggggccagggcaccctggtgaccgtctcg agcgcgtcgaccaaaggccccagcgtgttccctctgg cccccagcagcaagagcacctctggcggaacagcc gccctgggctgcctggtcaaggactacttccccgagc ccgtgaccgtgtcctggaactctggcgccctgaccag cggcgtgcacacctttccagccgtgctccagagcagc ggcctgtacagcctgagcagcgtcgtgaccgtgccc agcagcagcctgggcacccagacctacatctgcaac gtgaaccacaagcccagcaacacaaaggtggaca agcgggtggaacccaagagctgcgacaagaccca cacctgtcccccctgccctgcccctgaagcggaggg agccccctccgtgttcctgttccccccaaagcctaagg acaccctgatgatcagccggacccccgaagtgacct gcgtggtggtggacgtgtcccacgaggaccctgaagt gaagtttaattggtacgtggacggcgtggaagtgcac aacgccaagaccaagcccagagaggaacagtaca acagcacctaccgggtggtgtccgtgctgaccgtgct gcaccaggactggctgaacggcaaagagtacaagt gcaaggtgtccaacaaggccctgccttcctccatcga gaaaaccatcagcaaggccaaaggccagccccgc gagccccaggtgtacacactgccccctagccgggaa gagatgaccaagaaccaggtgtccctgacctgcctc gtgaagggcttctaccccagcgacattgccgtggaat gggagagcaacggccagcccgagaacaactacaa gaccaccccccctgtgctggacagcgacggctcattc ttcctgtacagcaagctgaccgtggacaagagccggt ggcagcagggcaacgtgttcagctgctccgtgatgca cgaggccctgcacaaccactacacccagaagtccct gagcctgagccccggcaaggcttctcctgctgctcctg ctcctagcgctcagaccgtggtcacacaagagccca gcctgacagtttctcctggcggcacagtgaccctgacc tgcagatcttctacaggcgccgtgaccaccagcaact acgccaattgggtgcagcagaagcctggacaggctc ccagaggactgatcggcggcacaaacaaaagagc ccctggcacaccagccagattcagcggatcactgctc ggaggaaaggccgctctgacactgcttggagcacag cctgaagatgaggccgagtactactgcgccctgtggt acagcaatctgtgggtgttcggcggaggtaccaagct gaccgtgctgggccaggcctctcctgctgctcctgctc cagcttctccagccgctccagctcctgctagcggatct gaagtgcagctggtggaatctggcggcggactcgtg aagcctggcggctctctgagactgagctgtgccgcca gcggcttcaccttcaacacctacgccatgaactgggt gcgccaggcccctggcaaaggcctggaatgggtgg gacggatcagaagcaagtacaacaattacgccacct actacgccgacagcgtgaaggaccggttcaccatca gccgggacgacagcaagaacaccctgtacctgcag atgaacagcctgaaaaccgaggacaccgccgtgta ctactgcaccacccacggcaacttcggcaacagctat gtgtcttggtttgcctactggggccagggcaccctcgtg acagtctcgagc BsAb# RefmAb#2 SEQ ID NO: QVQLVESGGGLVQPGGSLRLSCAASG München (IgG1f_AEASS_ 111 FNIKDTYIHWVRQAPGKGLEWVARIYP HC) x TNGYTRYADSVKGRFTISADTSKNTAY mAb#München LQMNSLRAEDTAVYYCSRWGGDGFY (scFv) AMDYWGQGTLVTVSSASTKGPSVFPL APSSKSTSGGTAALGCLVKDYFPEPVT VSWNSGALTSGVHTFPAVLQSSGLYS LSSVVTVPSSSLGTQTYICNVNHKPSN TKVDKRVEPKSCDKTHTCPPCPAPEA EGAPSVFLFPPKPKDTLMISRTPEVTC VVVDVSHEDPEVKFNWYVDGVEVHNA KTKPREEQYNSTYRVVSVLTVLHQDW LNGKEYKCKVSNKALPSSIEKTISKAKG QPREPQVYTLPPSREEMTKNQVSLTC LVKGFYPSDIAVEWESNGQPENNYKT TPPVLDSDGSFFLYSKLTVDKSRWQQ GNVFSCSVMHEALHNHYTQKSLSLSP GKASPAAPAPSAQTVVTQEPSLTVSP GGTVTLTCRSSTGAVTTSNYANWVQQ KPGQAPRGLIGGTKFLAPGTPARFSGS LLGGKAALTLLGAQPEDEAEYYCALWY SNLWVFGGGTKLTVLGQASPAAPAPA SPAAPAPASGSEVQLVESGGGLVKPG GSLRLSCAASGFTFNTYAMNWVRQAP GKGLEWVGRIRSKYNNYATYYADSVK DRFTISRDDSKNTLYLQMNSLKTEDTA VYYCTTHGNFGNSYVSWFAYWGQGT LVTVSS RefmAb#2 SEQ ID NO: caggtgcaattggtggagtctggcggaggactggtgc (IgG1f_AEASS_ 112 agcctgggggcagcctgagactgagctgcgccgcc HC) x agcggcttcaacatcaaggacacctacatccactgg mAb#München gtgcgccaggctccaggcaagggactggaatgggt (scFv) (DNA) ggcccggatctaccccaccaacggctacaccagata cgccgacagcgtgaagggccggttcaccatcagcg ccgacaccagcaagaacaccgcctacctgcagatg aacagcctgcgggccgaggacaccgccgtgtacta ctgcagcagatggggcggagatggcttctacgccatg gactactggggccagggcaccctggtgaccgtctcg agcgcgtcgaccaaaggccccagcgtgttccctctgg cccccagcagcaagagcacctctggcggaacagcc gccctgggctgcctggtcaaggactacttccccgagc ccgtgaccgtgtcctggaactctggcgccctgaccag cggcgtgcacacctttccagccgtgctccagagcagc ggcctgtacagcctgagcagcgtcgtgaccgtgccc agcagcagcctgggcacccagacctacatctgcaac gtgaaccacaagcccagcaacacaaaggtggaca agcgggtggaacccaagagctgcgacaagaccca cacctgtcccccctgccctgcccctgaagcggaggg agccccctccgtgttcctgttccccccaaagcctaagg acaccctgatgatcagccggacccccgaagtgacct gcgtggtggtggacgtgtcccacgaggaccctgaagt gaagtttaattggtacgtggacggcgtggaagtgcac aacgccaagaccaagcccagagaggaacagtaca acagcacctaccgggtggtgtccgtgctgaccgtgct gcaccaggactggctgaacggcaaagagtacaagt gcaaggtgtccaacaaggccctgccttcctccatcga gaaaaccatcagcaaggccaaaggccagccccgc gagccccaggtgtacacactgccccctagccgggaa gagatgaccaagaaccaggtgtccctgacctgcctc gtgaagggcttctaccccagcgacattgccgtggaat gggagagcaacggccagcccgagaacaactacaa gaccaccccccctgtgctggacagcgacggctcattc ttcctgtacagcaagctgaccgtggacaagagccggt ggcagcagggcaacgtgttcagctgctccgtgatgca cgaggccctgcacaaccactacacccagaagtccct gagcctgagccccggcaaggcttctcctgctgctcctg ctcctagcgctcagaccgtggtcacacaagagccca gcctgacagtttctcctggcggcacagtgaccctgacc tgcagatcttctacaggcgccgtgaccaccagcaact acgccaattgggtgcagcagaagcctggacaggctc ccagaggactgatcggcggcacaaaatttctggccc ctggcacaccagccagattctctggatctctgctcggc ggaaaggccgctctgacactgcttggagcacagcct gaagatgaggccgagtactactgcgccctgtggtaca gcaatctgtgggtgttcggcggaggtaccaagctgac cgtgctgggccaggcctctcctgctgctcctgctccag cttctccagccgctccagctcctgctagcggatctgaa gtgcagctggtggaatctggcggcggactcgtgaag cctggcggctctctgagactgagctgtgccgccagcg gcttcaccttcaacacctacgccatgaactgggtgcgc caggcccctggcaaaggcctggaatgggtgggacg gatcagaagcaagtacaacaattacgccacctacta cgccgacagcgtgaaggaccggttcaccatcagcc gggacgacagcaagaacaccctgtacctgcagatg aacagcctgaaaaccgaggacaccgccgtgtacta ctgcaccacccacggcaacttcggcaacagctatgtg tcttggtttgcctactggggccagggcaccctcgtgac agtctcgagc BsAb# RefmAb#2 SEQ ID NO: QVQLVESGGGLVQPGGSLRLSCAASG Bremen (IgG1f_AEASS_ 113 FNIKDTYIHWVRQAPGKGLEWVARIYP HC) x TNGYTRYADSVKGRFTISADTSKNTAY mAb#Bremen LQMNSLRAEDTAVYYCSRWGGDGFY (scFv) AMDYWGQGTLVTVSSASTKGPSVFPL APSSKSTSGGTAALGCLVKDYFPEPVT VSWNSGALTSGVHTFPAVLQSSGLYS LSSVVTVPSSSLGTQTYICNVNHKPSN TKVDKRVEPKSCDKTHTCPPCPAPEA EGAPSVFLFPPKPKDTLMISRTPEVTC VVVDVSHEDPEVKFNWYVDGVEVHNA KTKPREEQYNSTYRVVSVLTVLHQDW LNGKEYKCKVSNKALPSSIEKTISKAKG QPREPQVYTLPPSREEMTKNQVSLTC LVKGFYPSDIAVEWESNGQPENNYKT TPPVLDSDGSFFLYSKLTVDKSRWQQ GNVFSCSVMHEALHNHYTQKSLSLSP GKASPAAPAPSAQTVVTQEPSLTVSP GGTVTLTCRSSTGAVTTSNYANWVQQ KPGQAPRGLIGGTKFLAPGTPARFSGS LLGGKAALTLSGVQPEDEAEYYCALW YSNLWVFGGGTKLTVLGQASPAAPAP ASPAAPAPASGSEVQLVESGGGLVKP GGSLRLSCAASGFTFNTYAMNWVRQA PGKGLEWVGRIRSKYNNYATYYADSV KDRFTISRDDSKNTLYLQMNSLKTEDT AVYYCTTHGNFGNSYVSWFAYWGQG TLVTVSS RefmAb#2 SEQ ID NO: caggtgcaattggtggagtctggcggaggactggtgc (IgG1f_AEASS_ 114 agcctgggggcagcctgagactgagctgcgccgcc HC) x agcggcttcaacatcaaggacacctacatccactgg mAb#Bremen gtgcgccaggctccaggcaagggactggaatgggt (scFv) (DNA) ggcccggatctaccccaccaacggctacaccagata cgccgacagcgtgaagggccggttcaccatcagcg ccgacaccagcaagaacaccgcctacctgcagatg aacagcctgcgggccgaggacaccgccgtgtacta ctgcagcagatggggcggagatggcttctacgccatg gactactggggccagggcaccctggtgaccgtctcg agcgcgtcgaccaaaggccccagcgtgttccctctgg cccccagcagcaagagcacctctggcggaacagcc gccctgggctgcctggtcaaggactacttccccgagc ccgtgaccgtgtcctggaactctggcgccctgaccag cggcgtgcacacctttccagccgtgctccagagcagc ggcctgtacagcctgagcagcgtcgtgaccgtgccc agcagcagcctgggcacccagacctacatctgcaac gtgaaccacaagcccagcaacacaaaggtggaca agcgggtggaacccaagagctgcgacaagaccca cacctgtcccccctgccctgcccctgaagcggaggg agccccctccgtgttcctgttccccccaaagcctaagg acaccctgatgatcagccggacccccgaagtgacct gcgtggtggtggacgtgtcccacgaggaccctgaagt gaagtttaattggtacgtggacggcgtggaagtgcac aacgccaagaccaagcccagagaggaacagtaca acagcacctaccgggtggtgtccgtgctgaccgtgct gcaccaggactggctgaacggcaaagagtacaagt gcaaggtgtccaacaaggccctgccttcctccatcga gaaaaccatcagcaaggccaaaggccagccccgc gagccccaggtgtacacactgccccctagccgggaa gagatgaccaagaaccaggtgtccctgacctgcctc gtgaagggcttctaccccagcgacattgccgtggaat gggagagcaacggccagcccgagaacaactacaa gaccaccccccctgtgctggacagcgacggctcattc ttcctgtacagcaagctgaccgtggacaagagccggt ggcagcagggcaacgtgttcagctgctccgtgatgca cgaggccctgcacaaccactacacccagaagtccct gagcctgagccccggcaaggcttctcctgctgctcctg ctcctagcgctcagaccgtggtcacacaagagccca gcctgacagtttctcctggcggcacagtgaccctgacc tgcagatcttctacaggcgccgtgaccaccagcaact acgccaattgggtgcagcagaagcctggacaggctc ccagaggactgatcggcggcacaaaatttctggccc ctggcacaccagccagattctctggatctctgctcggc ggaaaggccgctctgacactgtctggtgttcagcctga ggacgaggccgagtactattgcgccctgtggtacagc aacctgtgggtgttcggcggaggtaccaagctgaccg tgctgggccaggcctctcctgctgctcctgctccagctt ctccagccgctccagctcctgctagcggatctgaagtg cagctggtggaatctggcggcggactcgtgaagcctg gcggctctctgagactgagctgtgccgccagcggctt caccttcaacacctacgccatgaactgggtgcgccag gcccctggcaaaggcctggaatgggtgggacggatc agaagcaagtacaacaattacgccacctactacgcc gacagcgtgaaggaccggttcaccatcagccggga cgacagcaagaacaccctgtacctgcagatgaaca gcctgaaaaccgaggacaccgccgtgtactactgca ccacccacggcaacttcggcaacagctatgtgtcttg gtttgcctactggggccagggcaccctcgtgacagtct cgagc BsAb# RefmAb#2 SEQ ID NO: QVQLVESGGGLVQPGGSLRLSCAASG Gladbach (IgG1f_AEASS_ 115 FNIKDTYIHWVRQAPGKGLEWVARIYP HC) x TNGYTRYADSVKGRFTISADTSKNTAY mAb#Gladbach LQMNSLRAEDTAVYYCSRWGGDGFY (scFv) AMDYWGQGTLVTVSSASTKGPSVFPL APSSKSTSGGTAALGCLVKDYFPEPVT VSWNSGALTSGVHTFPAVLQSSGLYS LSSVVTVPSSSLGTQTYICNVNHKPSN TKVDKRVEPKSCDKTHTCPPCPAPEA EGAPSVFLFPPKPKDTLMISRTPEVTC VVVDVSHEDPEVKFNWYVDGVEVHNA KTKPREEQYNSTYRVVSVLTVLHQDW LNGKEYKCKVSNKALPSSIEKTISKAKG QPREPQVYTLPPSREEMTKNQVSLTC LVKGFYPSDIAVEWESNGQPENNYKT TPPVLDSDGSFFLYSKLTVDKSRWQQ GNVFSCSVMHEALHNHYTQKSLSLSP GKASPAAPAPSAQTVVTQEPSLTVSP GGTVTLTCRSSTGAVTTSNYANWVQQ KPGQAPRGLIGGTKFLAPGTPARFSGS LLGGKAALTLSGVQPEDEAEYYCALW YSNLWVFGGGTKLTVLGQASPAAPAP ASPAAPAPASGSQVQLVESGGGLVKP GGSLRLSCAASGFTFNTYAMNWIRQA PGKGLEWVSRIRSKYNNYATYYADSV KDRFTISRDNAKNSLYLQMNSLRAEDT AVYYCVRHGNFGNSYVSWFAYWGQG TLVTVSS RefmAb#2 SEQ ID NO: caggtgcaattggtggagtctggcggaggactggtgc (IgG1f_AEASS_ 116 agcctgggggcagcctgagactgagctgcgccgcc HC) x agcggcttcaacatcaaggacacctacatccactgg mAb#Gladbach gtgcgccaggctccaggcaagggactggaatgggt (scFv) (DNA) ggcccggatctaccccaccaacggctacaccagata cgccgacagcgtgaagggccggttcaccatcagcg ccgacaccagcaagaacaccgcctacctgcagatg aacagcctgcgggccgaggacaccgccgtgtacta ctgcagcagatggggcggagatggcttctacgccatg gactactggggccagggcaccctggtgaccgtctcg agcgcgtcgaccaaaggccccagcgtgttccctctgg cccccagcagcaagagcacctctggcggaacagcc gccctgggctgcctggtcaaggactacttccccgagc ccgtgaccgtgtcctggaactctggcgccctgaccag cggcgtgcacacctttccagccgtgctccagagcagc ggcctgtacagcctgagcagcgtcgtgaccgtgccc agcagcagcctgggcacccagacctacatctgcaac gtgaaccacaagcccagcaacacaaaggtggaca agcgggtggaacccaagagctgcgacaagaccca cacctgtcccccctgccctgcccctgaagcggaggg agccccctccgtgttcctgttccccccaaagcctaagg acaccctgatgatcagccggacccccgaagtgacct gcgtggtggtggacgtgtcccacgaggaccctgaagt gaagtttaattggtacgtggacggcgtggaagtgcac aacgccaagaccaagcccagagaggaacagtaca acagcacctaccgggtggtgtccgtgctgaccgtgct gcaccaggactggctgaacggcaaagagtacaagt gcaaggtgtccaacaaggccctgccttcctccatcga gaaaaccatcagcaaggccaaaggccagccccgc gagccccaggtgtacacactgccccctagccgggaa gagatgaccaagaaccaggtgtccctgacctgcctc gtgaagggcttctaccccagcgacattgccgtggaat gggagagcaacggccagcccgagaacaactacaa gaccaccccccctgtgctggacagcgacggctcattc ttcctgtacagcaagctgaccgtggacaagagccggt ggcagcagggcaacgtgttcagctgctccgtgatgca cgaggccctgcacaaccactacacccagaagtccct gagcctgagccccggcaaggcttctcctgctgctcctg ctcctagcgctcagaccgtggtcacacaagagccca gcctgacagtttctcctggcggcacagtgaccctgacc tgcagatcttctacaggcgccgtgaccaccagcaact acgccaattgggtgcagcagaagcctggacaggctc ccagaggactgatcggcggcacaaaatttctggccc ctggcacaccagccagattctctggatctctgctcggc ggaaaggccgctctgacactgtctggtgttcagcctga ggacgaggccgagtactattgcgccctgtggtacagc aacctgtgggtgttcggcggaggtaccaagctgaccg tgctgggccaggcctctcctgctgctcctgctccagctt ctccagccgctccagctcctgctagcggatctcaggtg cagctggtggaatctggcggcggactcgtgaagcctg gcggctctctgagactgagctgtgccgccagcggctt caccttcaacacctacgccatgaactggatccggcag gcccctggcaagggcctggaatgggtgtcccggatc agaagcaagtacaacaattacgccacctactacgcc gacagcgtgaaggaccggttcaccatcagccggga caacgccaagaacagcctgtacctgcagatgaactc cctgcgggccgaggacaccgccgtgtactattgtgtg cggcacggcaacttcggcaacagctatgtgtcttggttt gcctactggggccagggcaccctcgtgacagtctcg agc BsAb# RefmAb#2 SEQ ID NO: QVQLVESGGGLVQPGGSLRLSCAASG Nürnberg (IgG1f_AEASS_ 117 FNIKDTYIHWVRQAPGKGLEWVARIYP HC) x TNGYTRYADSVKGRFTISADTSKNTAY mAb#Nürnberg LQMNSLRAEDTAVYYCSRWGGDGFY (scFv) AMDYVVGQGTLVTVSSASTKGPSVFPL APSSKSTSGGTAALGCLVKDYFPEPVT VSWNSGALTSGVHTFPAVLQSSGLYS LSSVVTVPSSSLGTQTYICNVNHKPSN TKVDKRVEPKSCDKTHTCPPCPAPEA EGAPSVFLFPPKPKDTLMISRTPEVTC VVVDVSHEDPEVKFNWYVDGVEVHNA KTKPREEQYNSTYRVVSVLTVLHQDW LNGKEYKCKVSNKALPSSIEKTISKAKG QPREPQVYTLPPSREEMTKNQVSLTC LVKGFYPSDIAVEWESNGQPENNYKT TPPVLDSDGSFFLYSKLTVDKSRWQQ GNVFSCSVMHEALHNHYTQKSLSLSP GKASPAAPAPSAQTVVTQEPSLTVSP GGTVTLTCRSSTGAVTTSNYANWVQQ KPGQAPRGLIGGTNKRAPGTPARFSG SLLGGKAALTLSGVQPEDEAEYYCAL WYSNLWVFGGGTKLTVLGQASPAAPA PASPAAPAPASGSQVQLVESGGGLVK PGGSLRLSCAASGFTFNTYAMNWIRQ APGKGLEWVSRIRSKYNNYATYYADS VKDRFTISRDNAKNSLYLQMNSLRAED TAVYYCVRHGNFGNSYVSWFAYWGQ GTLVTVSS RefmAb#2 SEQ ID NO: caggtgcaattggtggagtctggcggaggactggtgc (IgG1f_AEASS_ 118 agcctgggggcagcctgagactgagctgcgccgcc HC) x agcggcttcaacatcaaggacacctacatccactgg mAb#Nürnberg gtgcgccaggctccaggcaagggactggaatgggt (scFv) (DNA) ggcccggatctaccccaccaacggctacaccagata cgccgacagcgtgaagggccggttcaccatcagcg ccgacaccagcaagaacaccgcctacctgcagatg aacagcctgcgggccgaggacaccgccgtgtacta ctgcagcagatggggcggagatggcttctacgccatg gactactggggccagggcaccctggtgaccgtctcg agcgcgtcgaccaaaggccccagcgtgttccctctgg cccccagcagcaagagcacctctggcggaacagcc gccctgggctgcctggtcaaggactacttccccgagc ccgtgaccgtgtcctggaactctggcgccctgaccag cggcgtgcacacctttccagccgtgctccagagcagc ggcctgtacagcctgagcagcgtcgtgaccgtgccc agcagcagcctgggcacccagacctacatctgcaac gtgaaccacaagcccagcaacacaaaggtggaca agcgggtggaacccaagagctgcgacaagaccca cacctgtcccccctgccctgcccctgaagcggaggg agccccctccgtgttcctgttccccccaaagcctaagg acaccctgatgatcagccggacccccgaagtgacct gcgtggtggtggacgtgtcccacgaggaccctgaagt gaagtttaattggtacgtggacggcgtggaagtgcac aacgccaagaccaagcccagagaggaacagtaca acagcacctaccgggtggtgtccgtgctgaccgtgct gcaccaggactggctgaacggcaaagagtacaagt gcaaggtgtccaacaaggccctgccttcctccatcga gaaaaccatcagcaaggccaaaggccagccccgc gagccccaggtgtacacactgccccctagccgggaa gagatgaccaagaaccaggtgtccctgacctgcctc gtgaagggcttctaccccagcgacattgccgtggaat gggagagcaacggccagcccgagaacaactacaa gaccaccccccctgtgctggacagcgacggctcattc ttcctgtacagcaagctgaccgtggacaagagccggt ggcagcagggcaacgtgttcagctgctccgtgatgca cgaggccctgcacaaccactacacccagaagtccct gagcctgagccccggcaaggcttctcctgctgctcctg ctcctagcgctcagaccgtggtcacacaagagccca gcctgacagtttctcctggcggcacagtgaccctgacc tgcagatcttctacaggcgccgtgaccaccagcaact acgccaattgggtgcagcagaagcctggacaggctc ccagaggactgatcggcggcacaaacaaaagagc ccctggcacaccagccagattcagcggatcactgctc ggaggaaaggccgctctgacactgtctggtgtccagc ctgaagatgaggccgagtactactgcgccctgtggta cagcaatctgtgggtgttcggcggaggtaccaagctg accgtgctgggccaggcctctcctgctgctcctgctcc agcttctccagccgctccagctcctgctagcggatctc aggtgcagctggtggaatctggcggcggactcgtga agcctggcggctctctgagactgagctgtgccgccag cggcttcaccttcaacacctacgccatgaactggatcc ggcaggcccctggcaagggcctggaatgggtgtccc ggatcagaagcaagtacaacaattacgccacctact acgccgacagcgtgaaggaccggttcaccatcagc cgggacaacgccaagaacagcctgtacctgcagat gaactccctgcgggccgaggacaccgccgtgtacta ttgtgtgcggcacggcaacttcggcaacagctatgtgt cttggtttgcctactggggccagggcaccctcgtgaca gtctcgagc IgG light RefmAb#2_h_ SEQ ID NO: DIQMTQSPSSLSASVGDRVTITCRASQ chain Igkappa 119 DVNTAVAWYQQKPGKAPKLLIYSASFL YSGVPSRFSGSRSGTDFTLTISSLQPE DFATYYCQQHYTTPPTFGQGTKVEIKR TVAAPSVFIFPPSDEQLKSGTASVVCLL NNFYPREAKVQWKVDNALQSGNSQE SVTEQDSKDSTYSLSSTLTLSKADYEK HKVYACEVTHQGLSSPVTKSFNRGEC RefmAb#2_h_ SEQ ID NO: gatatccagatgacccagagccccagcagcctgag Igkappa (DNA) 120 cgccagcgtgggcgacagagtgaccatcacctgcc gggccagccaggacgtgaacaccgccgtggcctgg tatcagcagaagcccggcaaggcccccaagctgct gatctacagcgccagcttcctgtacagcggcgtgccc agccggttcagcggcagcagaagcggcaccgactt caccctgaccatcagctccctgcagcccgaggacttc gccacctactactgccagcagcactacaccaccccc cccaccttcggccagggtaccaaagtggaaatcaag cggaccgtggccgctccctccgtgttcatcttcccaccc agcgacgagcagctgaagtccggcacagccagcgt cgtgtgcctgctgaacaacttctacccccgcgaggcc aaagtgcagtggaaggtggacaacgccctccagag cggcaacagccaggaaagcgtcaccgagcaggac agcaaggactccacctacagcctgagcagcaccctg accctgagcaaggccgactacgagaagcacaaggt gtacgcctgcgaagtgacccaccagggcctgtccag ccccgtgaccaagagcttcaaccggggcgagtgt
(296) TABLE-US-00011 TABLE 7 Bispecific antibody sequences anti-CD3 [IgG1f- AEASS_HC] x anti- Antibody# HER2 [scFv] SEQ ID NO: [aa]/DNA BsAb# mAb# SEQ ID NO: EVQLVESGGGLVKPGGSLRLSCAASG München_2 München 121 FTFNTYAMNWVRQAPGKGLEWVGRIR (IgG1f_AEASS_ SKYNNYATYYADSVKDRFTISRDDSKN HC) x TLYLQMNSLKTEDTAVYYCTTHGNFG RefmAb#2 NSYVSWFAYWGQGTLVTVSSASTKGP (scFv) SVFPLAPSSKSTSGGTAALGCLVKDYF PEPVTVSWNSGALTSGVHTFPAVLQS SGLYSLSSVVTVPSSSLGTQTYICNVN HKPSNTKVDKRVEPKSCDKTHTCPPC PAPEAEGAPSVFLFPPKPKDTLMISRT PEVTCVVVDVSHEDPEVKFNWYVDGV EVHNAKTKPREEQYNSTYRVVSVLTVL HQDWLNGKEYKCKVSNKALPSSIEKTI SKAKGQPREPQVYTLPPSREEMTKNQ VSLTCLVKGFYPSDIAVEWESNGQPEN NYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSL SLSPGKASPAAPAPSADIQMTQSPSSL SASVGDRVTITCRASQDVNTAVAWYQ QKPGKAPKLLIYSASFLYSGVPSRFSG SRSGTDFTLTISSLQPEDFATYYCQQH YTTPPTFGQGTKVEIKRTASPAAPAPA SPAAPAPASGSQVQLVESGGGLVQPG GSLRLSCAASGFNIKDTYIHWVRQAPG KGLEWVARIYPTNGYTRYADSVKGRF TISADTSKNTAYLQMNSLRAEDTAVYY CSRWGGDGFYAMDYWGQGTLVTVSS mAb# SEQ ID NO: gaagtgcagctggtggaatctggcggcggactcgtg München_2 122 aagcctggcggctctctgagactgagctgtgccgcca (IgG1f_AEASS_ gcggcttcaccttcaacacctacgccatgaactgggt HC) x gcgccaggcccctggcaaaggcctggaatgggtgg RefmAb#2 gacggatcagaagcaagtacaacaattacgccacct (scFv) actacgccgacagcgtgaaggaccggttcaccatca (DNA) gccgggacgacagcaagaacaccctgtacctgcag atgaacagcctgaaaaccgaggacaccgccgtgta ctactgcaccacccacggcaacttcggcaacagctat gtgtcttggtttgcctactggggccagggcaccctcgtg acagtctcgagcgcgtcgaccaaaggccccagcgt gttccctctggcccccagcagcaagagcacctctggc ggaacagccgccctgggctgcctggtcaaggactac ttccccgagcccgtgaccgtgtcctggaactctggcgc cctgaccagcggcgtgcacacctttccagccgtgctc cagagcagcggcctgtacagcctgagcagcgtcgtg accgtgcccagcagcagcctgggcacccagaccta catctgcaacgtgaaccacaagcccagcaacacaa aggtggacaagcgggtggaacccaagagctgcga caagacccacacctgtcccccctgccctgcccctgaa gcggagggagccccctccgtgttcctgttccccccaa agcctaaggacaccctgatgatcagccggacccccg aagtgacctgcgtggtggtggacgtgtcccacgagg accctgaagtgaagtttaattggtacgtggacggcgtg gaagtgcacaacgccaagaccaagcccagagagg aacagtacaacagcacctaccgggtggtgtccgtgct gaccgtgctgcaccaggactggctgaacggcaaag agtacaagtgcaaggtgtccaacaaggccctgccttc ctccatcgagaaaaccatcagcaaggccaaaggcc agccccgcgagccccaggtgtacacactgcccccta gccgggaagagatgaccaagaaccaggtgtccctg acctgcctcgtgaagggcttctaccccagcgacattgc cgtggaatgggagagcaacggccagcccgagaac aactacaagaccaccccccctgtgctggacagcgac ggctcattcttcctgtacagcaagctgaccgtggacaa gagccggtggcagcagggcaacgtgttcagctgctc cgtgatgcacgaggccctgcacaaccactacaccca gaagtccctgagcctgagccccggcaaggcttctcct gctgctcctgctcctagcgctgacatccagatgaccca gagccctagcagcctgagcgccagcgtgggcgaca gagtgaccatcacctgtagagccagccaggacgtga acaccgccgtggcctggtatcagcagaagcctggca aggcccccaagctgctgatctacagcgccagcttcct gtacagcggcgtgcccagcagattcagcggcagca gatccggcaccgacttcaccctgaccatcagcagcct gcagcccgaggacttcgccacctactactgccagca gcactacaccaccccccccacatttggccagggcac caaggtggaaatcaagcggacagcctctcctgccgc ccctgctcctgcttctcctgctgctccagctccagccag cggatctcaggtgcagctggtggaatctggcggcgg actggtgcagcctggcggatctctgagactgagctgtg ccgccagcggcttcaacatcaaggacacctacatcc actgggtgcgccaggcccctggaaagggactggaat gggtggccagaatctaccccaccaacggctacacca gatacgccgacagcgtgaagggccggttcaccatca gcgccgacaccagcaagaataccgcctacctgcag atgaacagcctgagagccgaggataccgccgtgtac tactgctccagatggggaggcgacggcttctacgcca tggactattggggccagggaaccctcgtgaccgtgtc ctct mAb# SEQ ID NO: QTVVTQEPSLTVSPGGTVTLTCRSSTG München 123 AVTTSNYANWVQQKPGQAPRGLIGGT (h_Iglambda) KFLAPGTPARFSGSLLGGKAALTLLGA QPEDEAEYYCALWYSNLWVFGGGTKL TVLGQPKAAPSVTLFPPSSEELQANKA TLVCLISDFYPGAVTVAWKADSSPVKA GVETTTPSKQSNNKYAASSYLSLTPEQ WKSHRSYSCQVTHEGSTVEKTVAPTE CS mAb# SEQ ID NO: cagaccgtggtcacacaagagcccagcctgacagtt München 124 tctcctggcggcacagtgaccctgacctgcagatcttct (h_Iglambda) acaggcgccgtgaccaccagcaactacgccaattg (DNA) ggtgcagcagaagcctggacaggctcccagaggac tgatcggcggcacaaaatttctggcccctggcacacc agccagattctctggatctctgctcggcggaaaggcc gctctgacactgcttggagcacagcctgaagatgagg ccgagtactactgcgccctgtggtacagcaatctgtgg gtgttcggcggaggtaccaagctgaccgtgctgggcc agcccaaagccgcccctagcgtgaccctgttcccccc ctcgagtgaggaactccaggccaacaaggccaccc tcgtgtgcctgatcagcgacttctaccctggcgccgtg accgtggcctggaaggccgatagcagccctgtgaag gccggcgtggaaaccaccacccccagcaagcaga gcaacaacaaatacgccgccagcagctacctgagc ctgacccccgagcagtggaagtcccacagatcctac agctgccaggtcacacacgagggcagcaccgtgga aaagaccgtggcccccaccgagtgcagc BsAb# mAb#Bremen SEQ ID NO: EVQLVESGGGLVKPGGSLRLSCAASG Bremen_2 (IgG1f_AEASS_ 125 FTFNTYAMNWVRQAPGKGLEWVGRIR HC) x SKYNNYATYYADSVKDRFTISRDDSKN RefmAb#2 TLYLQMNSLKTEDTAVYYCTTHGNFG (scFv) NSYVSWFAYWGQGTLVTVSSASTKGP SVFPLAPSSKSTSGGTAALGCLVKDYF PEPVTVSWNSGALTSGVHTFPAVLQS SGLYSLSSVVTVPSSSLGTQTYICNVN HKPSNTKVDKRVEPKSCDKTHTCPPC PAPEAEGAPSVFLFPPKPKDTLMISRT PEVTCVVVDVSHEDPEVKFNWYVDGV EVHNAKTKPREEQYNSTYRVVSVLTVL HQDWLNGKEYKCKVSNKALPSSIEKTI SKAKGQPREPQVYTLPPSREEMTKNQ VSLTCLVKGFYPSDIAVEWESNGQPEN NYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSL SLSPGKASPAAPAPSADIQMTQSPSSL SASVGDRVTITCRASQDVNTAVAWYQ QKPGKAPKLLIYSASFLYSGVPSRFSG SRSGTDFTLTISSLQPEDFATYYCQQH YTTPPTFGQGTKVEIKRTASPAAPAPA SPAAPAPASGSQVQLVESGGGLVQPG GSLRLSCAASGFNIKDTYIHWVRQAPG KGLEWVARIYPINGYTRYADSVKGRF TISADTSKNTAYLQMNSLRAEDTAVYY CSRWGGDGFYAMDYWGQGTLVTVSS mAb#Bremen SEQ ID NO: gaagtgcagctggtggaatctggcggcggactcgtg (IgG1f_AEASS_ 126 aagcctggcggctctctgagactgagctgtgccgcca HC) x gcggcttcaccttcaacacctacgccatgaactgggt RefmAb#2 gcgccaggcccctggcaaaggcctggaatgggtgg (scFv) gacggatcagaagcaagtacaacaattacgccacct actacgccgacagcgtgaaggaccggttcaccatca gccgggacgacagcaagaacaccctgtacctgcag atgaacagcctgaaaaccgaggacaccgccgtgta ctactgcaccacccacggcaacttcggcaacagctat gtgtcttggtttgcctactggggccagggcaccctcgtg acagtctcgagcgcgtcgaccaaaggccccagcgt gttccctctggcccccagcagcaagagcacctctggc ggaacagccgccctgggctgcctggtcaaggactac ttccccgagcccgtgaccgtgtcctggaactctggcgc cctgaccagcggcgtgcacacctttccagccgtgctc cagagcagcggcctgtacagcctgagcagcgtcgtg accgtgcccagcagcagcctgggcacccagaccta catctgcaacgtgaaccacaagcccagcaacacaa aggtggacaagcgggtggaacccaagagctgcga caagacccacacctgtcccccctgccctgcccctgaa gcggagggagccccctccgtgttcctgttccccccaa agcctaaggacaccctgatgatcagccggacccccg aagtgacctgcgtggtggtggacgtgtcccacgagg accctgaagtgaagtttaattggtacgtggacggcgtg gaagtgcacaacgccaagaccaagcccagagagg aacagtacaacagcacctaccgggtggtgtccgtgct gaccgtgctgcaccaggactggctgaacggcaaag agtacaagtgcaaggtgtccaacaaggccctgccttc ctccatcgagaaaaccatcagcaaggccaaaggcc agccccgcgagccccaggtgtacacactgcccccta gccgggaagagatgaccaagaaccaggtgtccctg acctgcctcgtgaagggcttctaccccagcgacattgc cgtggaatgggagagcaacggccagcccgagaac aactacaagaccaccccccctgtgctggacagcgac ggctcattcttcctgtacagcaagctgaccgtggacaa gagccggtggcagcagggcaacgtgttcagctgctc cgtgatgcacgaggccctgcacaaccactacaccca gaagtccctgagcctgagccccggcaaggcttctcct gctgctcctgctcctagcgctgacatccagatgaccca gagccctagcagcctgagcgccagcgtgggcgaca gagtgaccatcacctgtagagccagccaggacgtga acaccgccgtggcctggtatcagcagaagcctggca aggcccccaagctgctgatctacagcgccagcttcct gtacagcggcgtgcccagcagattcagcggcagca gatccggcaccgacttcaccctgaccatcagcagcct gcagcccgaggacttcgccacctactactgccagca gcactacaccaccccccccacatttggccagggcac caaggtggaaatcaagcggacagcctctcctgccgc ccctgctcctgcttctcctgctgctccagctccagccag cggatctcaggtgcagctggtggaatctggcggcgg actggtgcagcctggcggatctctgagactgagctgtg ccgccagcggcttcaacatcaaggacacctacatcc actgggtgcgccaggcccctggaaagggactggaat gggtggccagaatctaccccaccaacggctacacca gatacgccgacagcgtgaagggccggttcaccatca gcgccgacaccagcaagaataccgcctacctgcag atgaacagcctgagagccgaggataccgccgtgtac tactgctccagatggggaggcgacggcttctacgcca tggactattggggccagggaaccctcgtgaccgtgtc ctct mAb#Bremen SEQ ID NO: QTVVTQEPSLTVSPGGTVTLTCRSSTG (h_Iglambda) 127 AVTTSNYANWVQQKPGQAPRGLIGGT KFLAPGTPARFSGSLLGGKAALTLSGV QPEDEAEYYCALWYSNLWVFGGGTKL TVLGQPKAAPSVTLFPPSSEELQANKA TLVCLISDFYPGAVTVAWKADSSPVKA GVETTTPSKQSNNKYAASSYLSLTPEQ WKSHRSYSCQVTHEGSTVEKTVAPTE CS mAb#Bremen SEQ ID NO: cagaccgtggtcacacaagagcccagcctgacagtt (h_Iglambda) 128 tctcctggcggcacagtgaccctgacctgcagatcttct acaggcgccgtgaccaccagcaactacgccaattg ggtgcagcagaagcctggacaggctcccagaggac tgatcggcggcacaaaatttctggcccctggcacacc agccagattctctggatctctgctcggcggaaaggcc gctctgacactgtctggtgttcagcctgaggacgaggc cgagtactattgcgccctgtggtacagcaacctgtggg tgttcggcggaggtaccaagctgaccgtgctgggcca gcccaaagccgcccctagcgtgaccctgttccccccc tcgagtgaggaactccaggccaacaaggccaccct cgtgtgcctgatcagcgacttctaccctggcgccgtga ccgtggcctggaaggccgatagcagccctgtgaagg ccggcgtggaaaccaccacccccagcaagcagag caacaacaaatacgccgccagcagctacctgagcct gacccccgagcagtggaagtcccacagatcctaca gctgccaggtcacacacgagggcagcaccgtggaa aagaccgtggcccccaccgagtgcagc BsAb# mAb#Mainz SEQ ID NO: QVQLVESGGGLVKPGGSLRLSCAASG Mainz_2 (IgG1f_AEASS_ 129 FTFNTYAMNWIRQAPGKGLEWVSRIR HC) x SKYNNYATYYADSVKDRFTISRDNAKN RefmAb#2 SLYLQMNSLRAEDTAVYYCVRHGNFG (scFv) NSYVSWFAYWGQGTLVTVSSASTKGP SVFPLAPSSKSTSGGTAALGCLVKDYF PEPVTVSWNSGALTSGVHTFPAVLQS SGLYSLSSVVTVPSSSLGTQTYICNVN HKPSNTKVDKRVEPKSCDKTHTCPPC PAPEAEGAPSVFLFPPKPKDTLMISRT PEVTCVVVDVSHEDPEVKFNWYVDGV EVHNAKTKPREEQYNSTYRVVSVLTVL HQDWLNGKEYKCKVSNKALPSSIEKTI SKAKGQPREPQVYTLPPSREEMTKNQ VSLTCLVKGFYPSDIAVEWESNGQPEN NYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSL SLSPGKASPAAPAPSADIQMTQSPSSL SASVGDRVTITCRASQDVNTAVAWYQ QKPGKAPKLLIYSASFLYSGVPSRFSG SRSGTDFTLTISSLQPEDFATYYCQQH YTTPPTFGQGTKVEIKRTASPAAPAPA SPAAPAPASGSQVQLVESGGGLVQPG GSLRLSCAASGFNIKDTYIHWVRQAPG KGLEWVARIYPTNGYTRYADSVKGRF TISADTSKNTAYLQMNSLRAEDTAVYY CSRWGGDGFYAMDYWGQGTLVTVSS mAb#Mainz SEQ ID NO: caggtgcagctggtggaatctggcggcggactcgtg (IgG1f_AEASS_ 130 aagcctggcggctctctgagactgagctgtgccgcca HC) x gcggcttcaccttcaacacctacgccatgaactggatc RefmAb#2 cggcaggcccctggcaagggcctggaatgggtgtcc (scFv) (DNA) cggatcagaagcaagtacaacaattacgccacctac tacgccgacagcgtgaaggaccggttcaccatcagc cgggacaacgccaagaacagcctgtacctgcagat gaactccctgcgggccgaggacaccgccgtgtacta ttgtgtgcggcacggcaacttcggcaacagctatgtgt cttggtttgcctactggggccagggcaccctcgtgaca gtctcgagcgcgtcgaccaaaggccccagcgtgttcc ctctggcccccagcagcaagagcacctctggcggaa cagccgccctgggctgcctggtcaaggactacttccc cgagcccgtgaccgtgtcctggaactctggcgccctg accagcggcgtgcacacctttccagccgtgctccaga gcagcggcctgtacagcctgagcagcgtcgtgaccg tgcccagcagcagcctgggcacccagacctacatct gcaacgtgaaccacaagcccagcaacacaaaggt ggacaagcgggtggaacccaagagctgcgacaag acccacacctgtcccccctgccctgcccctgaagcgg agggagccccctccgtgttcctgttccccccaaagcct aaggacaccctgatgatcagccggacccccgaagt gacctgcgtggtggtggacgtgtcccacgaggaccct gaagtgaagtttaattggtacgtggacggcgtggaag tgcacaacgccaagaccaagcccagagaggaaca gtacaacagcacctaccgggtggtgtccgtgctgacc gtgctgcaccaggactggctgaacggcaaagagtac aagtgcaaggtgtccaacaaggccctgccttcctcca tcgagaaaaccatcagcaaggccaaaggccagcc ccgcgagccccaggtgtacacactgccccctagccg ggaagagatgaccaagaaccaggtgtccctgacctg cctcgtgaagggcttctaccccagcgacattgccgtg gaatgggagagcaacggccagcccgagaacaact acaagaccaccccccctgtgctggacagcgacggct cattcttcctgtacagcaagctgaccgtggacaagag ccggtggcagcagggcaacgtgttcagctgctccgtg atgcacgaggccctgcacaaccactacacccagaa gtccctgagcctgagccccggcaaggcttctcctgctg ctcctgctcctagcgctgacatccagatgacccagag ccctagcagcctgagcgccagcgtgggcgacagag tgaccatcacctgtagagccagccaggacgtgaaca ccgccgtggcctggtatcagcagaagcctggcaagg cccccaagctgctgatctacagcgccagcttcctgtac agcggcgtgcccagcagattcagcggcagcagatc cggcaccgacttcaccctgaccatcagcagcctgca gcccgaggacttcgccacctactactgccagcagca ctacaccaccccccccacatttggccagggcaccaa ggtggaaatcaagcggacagcctctcctgccgcccct gctcctgcttctcctgctgctccagctccagccagcgg atctcaggtgcagctggtggaatctggcggcggactg gtgcagcctggcggatctctgagactgagctgtgccg ccagcggcttcaacatcaaggacacctacatccactg ggtgcgccaggcccctggaaagggactggaatggg tggccagaatctaccccaccaacggctacaccagat acgccgacagcgtgaagggccggttcaccatcagc gccgacaccagcaagaataccgcctacctgcagat gaacagcctgagagccgaggataccgccgtgtacta ctgctccagatggggaggcgacggcttctacgccatg gactattggggccagggaaccctcgtgaccgtgtcct ct mAb#Mainz SEQ ID NO: QAVVTQEPSLTVSPGGTVTLTCRSSTG (h_Iglambda_ 131 AVTTSNYANWVQQKPGQAPRGLIGGT LC) NKRAPWTPARFSGSLLGGKAALTITGA QAEDEADYYCALWYSNLWVFGGGTKL TVLGQPKAAPSVTLFPPSSEELQANKA TLVCLISDFYPGAVTVAWKADSSPVKA GVETTTPSKQSNNKYAASSYLSLTPEQ WKSHRSYSCQVTHEGSTVEKTVAPTE CS mAb#Mainz SEQ ID NO: caggccgtggttacacaagagcccagcctgacagtt (h_Iglambda_ 132 agccctggcggaacagtgaccctgacctgcagatctt LC) ctacaggcgccgtgaccaccagcaactacgccaatt gggtgcagcagaagcctggacaggctcccagagga ctgatcggcggcacaaacaaaagagccccttggac acccgccagattcagcggatcactgctcggaggaaa ggccgcactgacaatcacaggtgcccaggccgaag atgaggccgattactattgcgccctgtggtacagcaac ctgtgggtgttcggcggaggtaccaagctgaccgtgct gggccagcccaaagccgcccctagcgtgaccctgtt ccccccctcgagtgaggaactccaggccaacaagg ccaccctcgtgtgcctgatcagcgacttctaccctggc gccgtgaccgtggcctggaaggccgatagcagccct gtgaaggccggcgtggaaaccaccacccccagca agcagagcaacaacaaatacgccgccagcagcta cctgagcctgacccccgagcagtggaagtcccacag atcctacagctgccaggtcacacacgagggcagca ccgtggaaaagaccgtggcccccaccgagtgcagc BsAb# mAb#Köln SEQ ID NO: QVQLVESGGGLVKPGGSLRLSCAASG Köln_2 (IgG1f_AEASS_ 133 FTFNTYAMNWIRQAPGKGLEWVSRIR HC) x SKYNNYATYYADSVKDRFTISRDNAKN RefmAb#2 SLYLQMNSLRAEDTAVYYCVRHGNFG (scFv) NSYVSWFAYWGQGTLVTVSSASTKGP SVFPLAPSSKSTSGGTAALGCLVKDYF PEPVTVSWNSGALTSGVHTFPAVLQS SGLYSLSSVVTVPSSSLGTQTYICNVN HKPSNTKVDKRVEPKSCDKTHTCPPC PAPEAEGAPSVFLFPPKPKDTLMISRT PEVTCVVVDVSHEDPEVKFNWYVDGV EVHNAKTKPREEQYNSTYRVVSVLTVL HQDWLNGKEYKCKVSNKALPSSIEKTI SKAKGQPREPQVYTLPPSREEMTKNQ VSLTCLVKGFYPSDIAVEWESNGQPEN NYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSL SLSPGKASPAAPAPSADIQMTQSPSSL SASVGDRVTITCRASQDVNTAVAWYQ QKPGKAPKLLIYSASFLYSGVPSRFSG SRSGTDFTLTISSLQPEDFATYYCQQH YTTPPTFGQGTKVEIKRTASPAAPAPA SPAAPAPASGSQVQLVESGGGLVQPG GSLRLSCAASGFNIKDTYIHWVRQAPG KGLEWVARIYPTNGYTRYADSVKGRF TISADTSKNTAYLQMNSLRAEDTAVYY CSRWGGDGFYAMDYWGQGTLVTVSS mAb#Köln SEQ ID NO: caggtgcagctggtggaatctggcggcggactcgtg (IgG1f_AEASS_ 134 aagcctggcggctctctgagactgagctgtgccgcca HC) x gcggcttcaccttcaacacctacgccatgaactggatc RefmAb#2 cggcaggcccctggcaagggcctggaatgggtgtcc (scFv) (DNA) cggatcagaagcaagtacaacaattacgccacctac tacgccgacagcgtgaaggaccggttcaccatcagc cgggacaacgccaagaacagcctgtacctgcagat gaactccctgcgggccgaggacaccgccgtgtacta ttgtgtgcggcacggcaacttcggcaacagctatgtgt cttggtttgcctactggggccagggcaccctcgtgaca gtctcgagcgcgtcgaccaaaggccccagcgtgttcc ctctggcccccagcagcaagagcacctctggcggaa cagccgccctgggctgcctggtcaaggactacttccc cgagcccgtgaccgtgtcctggaactctggcgccctg accagcggcgtgcacacctttccagccgtgctccaga gcagcggcctgtacagcctgagcagcgtcgtgaccg tgcccagcagcagcctgggcacccagacctacatct gcaacgtgaaccacaagcccagcaacacaaaggt ggacaagcgggtggaacccaagagctgcgacaag acccacacctgtcccccctgccctgcccctgaagcgg agggagccccctccgtgttcctgttccccccaaagcct aaggacaccctgatgatcagccggacccccgaagt gacctgcgtggtggtggacgtgtcccacgaggaccct gaagtgaagtttaattggtacgtggacggcgtggaag tgcacaacgccaagaccaagcccagagaggaaca gtacaacagcacctaccgggtggtgtccgtgctgacc gtgctgcaccaggactggctgaacggcaaagagtac aagtgcaaggtgtccaacaaggccctgccttcctcca tcgagaaaaccatcagcaaggccaaaggccagcc ccgcgagccccaggtgtacacactgccccctagccg ggaagagatgaccaagaaccaggtgtccctgacctg cctcgtgaagggcttctaccccagcgacattgccgtg gaatgggagagcaacggccagcccgagaacaact acaagaccaccccccctgtgctggacagcgacggct cattcttcctgtacagcaagctgaccgtggacaagag ccggtggcagcagggcaacgtgttcagctgctccgtg atgcacgaggccctgcacaaccactacacccagaa gtccctgagcctgagccccggcaaggcttctcctgctg ctcctgctcctagcgctgacatccagatgacccagag ccctagcagcctgagcgccagcgtgggcgacagag tgaccatcacctgtagagccagccaggacgtgaaca ccgccgtggcctggtatcagcagaagcctggcaagg cccccaagctgctgatctacagcgccagcttcctgtac agcggcgtgcccagcagattcagcggcagcagatc cggcaccgacttcaccctgaccatcagcagcctgca gcccgaggacttcgccacctactactgccagcagca ctacaccaccccccccacatttggccagggcaccaa ggtggaaatcaagcggacagcctctcctgccgcccct gctcctgcttctcctgctgctccagctccagccagcgg atctcaggtgcagctggtggaatctggcggcggactg gtgcagcctggcggatctctgagactgagctgtgccg ccagcggcttcaacatcaaggacacctacatccactg ggtgcgccaggcccctggaaagggactggaatggg tggccagaatctaccccaccaacggctacaccagat acgccgacagcgtgaagggccggttcaccatcagc gccgacaccagcaagaataccgcctacctgcagat gaacagcctgagagccgaggataccgccgtgtacta ctgctccagatggggaggcgacggcttctacgccatg gactattggggccagggaaccctcgtgaccgtgtcct ct mAb#Köln SEQ ID NO: ELVVTQEPSLTVSPGGTVTLTCRSSTG (h_Iglambda_ 135 AVTTSNYANWVQQKPGQAPRGLIGGT LC) NKRAPGTPARFSGSLLGGKAALTLSGV QPEDEAEYYCALWYSNLWVFGGGTKL TVLGQPKAAPSVTLFPPSSEELQANKA TLVCLISDFYPGAVTVAWKADSSPVKA GVETTTPSKQSNNKYAASSYLSLTPEQ WKSHRSYSCQVTHEGSTVEKTVAPTE CS mAb#Köln SEQ ID NO: gagctggtggtcacacaagagcccagcctgacagttt (h_Iglambda_ 136 ctcctggcggcacagtgaccctgacctgcagatcttct LC) (DNA) acaggcgccgtgaccacctccaactacgccaattgg gtgcagcagaagcctggacaggctcccagaggact gatcggcggcacaaacaaaagagcccctggcaca ccagccagattcagcggatcactgctcggaggaaag gccgctctgacactgtctggtgtccagcctgaagatga ggccgagtactactgcgccctgtggtacagcaatctgt gggtgttcggcggaggtaccaagctgaccgtgctgg gccagcccaaagccgcccctagcgtgaccctgttcc ccccctcgagtgaggaactccaggccaacaaggcc accctcgtgtgcctgatcagcgacttctaccctggcgc cgtgaccgtggcctggaaggccgatagcagccctgt gaaggccggcgtggaaaccaccacccccagcaag cagagcaacaacaaatacgccgccagcagctacct gagcctgacccccgagcagtggaagtcccacagat cctacagctgccaggtcacacacgagggcagcacc gtggaaaagaccgtggcccccaccgagtgcagc BsAb# mAb#Gladbach SEQ ID NO: QVQLVESGGGLVKPGGSLRLSCAASG Gladbach_ (IgG1f_AEASS_ 137 FTFNTYAMNWIRQAPGKGLEWVSRIR 2 HC) x SKYNNYATYYADSVKDRFTISRDNAKN RefmAb#2 SLYLQMNSLRAEDTAVYYCVRHGNFG (scFv) NSYVSWFAYWGQGTLVTVSSASTKGP SVFPLAPSSKSTSGGTAALGCLVKDYF PEPVTVSWNSGALTSGVHTFPAVLQS SGLYSLSSVVTVPSSSLGTQTYICNVN HKPSNTKVDKRVEPKSCDKTHTCPPC PAPEAEGAPSVFLFPPKPKDTLMISRT PEVTCVVVDVSHEDPEVKFNWYVDGV EVHNAKTKPREEQYNSTYRVVSVLTVL HQDWLNGKEYKCKVSNKALPSSIEKTI SKAKGQPREPQVYTLPPSREEMTKNQ VSLTCLVKGFYPSDIAVEWESNGQPEN NYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSL SLSPGKASPAAPAPSADIQMTQSPSSL SASVGDRVTITCRASQDVNTAVAWYQ QKPGKAPKLLIYSASFLYSGVPSRFSG SRSGTDFTLTISSLQPEDFATYYCQQH YTTPPTFGQGTKVEIKRTASPAAPAPA SPAAPAPASGSQVQLVESGGGLVQPG GSLRLSCAASGFNIKDTYIHWVRQAPG KGLEWVARIYPTNGYTRYADSVKGRF TISADTSKNTAYLQMNSLRAEDTAVYY CSRWGGDGFYAMDYWGQGTLVTVSS mAb#Gladbach SEQ ID NO: caggtgcagctggtggaatctggcggcggactcgtg (IgG1f_AEASS_ 138 aagcctggcggctctctgagactgagctgtgccgcca HC) x gcggcttcaccttcaacacctacgccatgaactggatc RefmAb#2 cggcaggcccctggcaagggcctggaatgggtgtcc (scFv) cggatcagaagcaagtacaacaattacgccacctac tacgccgacagcgtgaaggaccggttcaccatcagc cgggacaacgccaagaacagcctgtacctgcagat gaactccctgcgggccgaggacaccgccgtgtacta ttgtgtgcggcacggcaacttcggcaacagctatgtgt cttggtttgcctactggggccagggcaccctcgtgaca gtctcgagcgcgtcgaccaaaggccccagcgtgttcc ctctggcccccagcagcaagagcacctctggcggaa cagccgccctgggctgcctggtcaaggactacttccc cgagcccgtgaccgtgtcctggaactctggcgccctg accagcggcgtgcacacctttccagccgtgctccaga gcagcggcctgtacagcctgagcagcgtcgtgaccg tgcccagcagcagcctgggcacccagacctacatct gcaacgtgaaccacaagcccagcaacacaaaggt ggacaagcgggtggaacccaagagctgcgacaag acccacacctgtcccccctgccctgcccctgaagcgg agggagccccctccgtgttcctgttccccccaaagcct aaggacaccctgatgatcagccggacccccgaagt gacctgcgtggtggtggacgtgtcccacgaggaccct gaagtgaagtttaattggtacgtggacggcgtggaag tgcacaacgccaagaccaagcccagagaggaaca gtacaacagcacctaccgggtggtgtccgtgctgacc gtgctgcaccaggactggctgaacggcaaagagtac aagtgcaaggtgtccaacaaggccctgccttcctcca tcgagaaaaccatcagcaaggccaaaggccagcc ccgcgagccccaggtgtacacactgccccctagccg ggaagagatgaccaagaaccaggtgtccctgacctg cctcgtgaagggcttctaccccagcgacattgccgtg gaatgggagagcaacggccagcccgagaacaact acaagaccaccccccctgtgctggacagcgacggct cattcttcctgtacagcaagctgaccgtggacaagag ccggtggcagcagggcaacgtgttcagctgctccgtg atgcacgaggccctgcacaaccactacacccagaa gtccctgagcctgagccccggcaaggcttctcctgctg ctcctgctcctagcgctgacatccagatgacccagag ccctagcagcctgagcgccagcgtgggcgacagag tgaccatcacctgtagagccagccaggacgtgaaca ccgccgtggcctggtatcagcagaagcctggcaagg cccccaagctgctgatctacagcgccagcttcctgtac agcggcgtgcccagcagattcagcggcagcagatc cggcaccgacttcaccctgaccatcagcagcctgca gcccgaggacttcgccacctactactgccagcagca ctacaccaccccccccacatttggccagggcaccaa ggtggaaatcaagcggacagcctctcctgccgcccct gctcctgcttctcctgctgctccagctccagccagcgg atctcaggtgcagctggtggaatctggcggcggactg gtgcagcctggcggatctctgagactgagctgtgccg ccagcggcttcaacatcaaggacacctacatccactg ggtgcgccaggcccctggaaagggactggaatggg tggccagaatctaccccaccaacggctacaccagat acgccgacagcgtgaagggccggttcaccatcagc gccgacaccagcaagaataccgcctacctgcagat gaacagcctgagagccgaggataccgccgtgtacta ctgctccagatggggaggcgacggcttctacgccatg gactattggggccagggaaccctcgtgaccgtgtcct ct mAb# SEQ ID NO: QTVVTQEPSLTVSPGGTVTLICRSSTG Gladbach 139 AVTTSNYANWVQQKPGQAPRGLIGGT (h_Iglambda_ KFLAPGTPARFSGSLLGGKAALTLSGV LC) QPEDEAEYYCALWYSNLWVFGGGTKL TVLGQPKAAPSVTLFPPSSEELQANKA TLVCLISDFYPGAVTVAWKADSSPVKA GVETTTPSKQSNNKYAASSYLSLTPEQ WKSHRSYSCQVTHEGSTVEKTVAPTE CS mAb# SEQ ID NO: cagaccgtggtcacacaagagcccagcctgacagtt Gladbach 140 tctcctggcggcacagtgaccctgacctgcagatcttct (h_Iglambda_ acaggcgccgtgaccaccagcaactacgccaattg LC) ggtgcagcagaagcctggacaggctcccagaggac tgatcggcggcacaaaatttctggcccctggcacacc agccagattctctggatctctgctcggcggaaaggcc gctctgacactgtctggtgttcagcctgaggacgaggc cgagtactattgcgccctgtggtacagcaacctgtggg tgttcggcggaggtaccaagctgaccgtgctgggcca gcccaaagccgcccctagcgtgaccctgttccccccc tcgagtgaggaactccaggccaacaaggccaccct cgtgtgcctgatcagcgacttctaccctggcgccgtga ccgtggcctggaaggccgatagcagccctgtgaagg ccggcgtggaaaccaccacccccagcaagcagag caacaacaaatacgccgccagcagctacctgagcct gacccccgagcagtggaagtcccacagatcctaca gctgccaggtcacacacgagggcagcaccgtggaa aagaccgtggcccccaccgagtgcagc BsAb# mAb# SEQ ID NO: QVQLVESGGGLVKPGGSLRLSCAASG Nürnberg_ Nürnberg 141 FTFNTYAMNWIRQAPGKGLEWVSRIR 2 (IgG1f_AEASS_ SKYNNYATYYADSVKDRFTISRDNAKN HC) x SLYLQMNSLRAEDTAVYYCVRHGNFG RefmAb#2 NSYVSWFAYWGQGTLVTVSSASTKGP (scFv) SVFPLAPSSKSTSGGTAALGCLVKDYF PEPVTVSWNSGALTSGVHTFPAVLQS SGLYSLSSVVTVPSSSLGTQTYICNVN HKPSNTKVDKRVEPKSCDKTHTCPPC PAPEAEGAPSVFLFPPKPKDTLMISRT PEVTCVVVDVSHEDPEVKFNWYVDGV EVHNAKTKPREEQYNSTYRVVSVLTVL HQDWLNGKEYKCKVSNKALPSSIEKTI SKAKGQPREPQVYTLPPSREEMTKNQ VSLTCLVKGFYPSDIAVEWESNGQPEN NYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSL SLSPGKASPAAPAPSADIQMTQSPSSL SASVGDRVTITCRASQDVNTAVAWYQ QKPGKAPKLLIYSASFLYSGVPSRFSG SRSGTDFTLTISSLQPEDFATYYCQQH YTTPPTFGQGTKVEIKRTASPAAPAPA SPAAPAPASGSQVQLVESGGGLVQPG GSLRLSCAASGFNIKDTYIHWVRQAPG KGLEWVARIYPTNGYTRYADSVKGRF TISADTSKNTAYLQMNSLRAEDTAVYY CSRWGGDGFYAMDYWGQGTLVTVSS mAb# SEQ ID NO: caggtgcagctggtggaatctggcggcggactcgtg Nürnberg 142 aagcctggcggctctctgagactgagctgtgccgcca (IgG1f_AEASS_ gcggcttcaccttcaacacctacgccatgaactggatc HC) x cggcaggcccctggcaagggcctggaatgggtgtcc RefmAb#2 cggatcagaagcaagtacaacaattacgccacctac (scFv) tacgccgacagcgtgaaggaccggttcaccatcagc cgggacaacgccaagaacagcctgtacctgcagat gaactccctgcgggccgaggacaccgccgtgtacta ttgtgtgcggcacggcaacttcggcaacagctatgtgt cttggtttgcctactggggccagggcaccctcgtgaca gtctcgagcgcgtcgaccaaaggccccagcgtgttcc ctctggcccccagcagcaagagcacctctggcggaa cagccgccctgggctgcctggtcaaggactacttccc cgagcccgtgaccgtgtcctggaactctggcgccctg accagcggcgtgcacacctttccagccgtgctccaga gcagcggcctgtacagcctgagcagcgtcgtgaccg tgcccagcagcagcctgggcacccagacctacatct gcaacgtgaaccacaagcccagcaacacaaaggt ggacaagcgggtggaacccaagagctgcgacaag acccacacctgtcccccctgccctgcccctgaagcgg agggagccccctccgtgttcctgttccccccaaagcct aaggacaccctgatgatcagccggacccccgaagt gacctgcgtggtggtggacgtgtcccacgaggaccct gaagtgaagtttaattggtacgtggacggcgtggaag tgcacaacgccaagaccaagcccagagaggaaca gtacaacagcacctaccgggtggtgtccgtgctgacc gtgctgcaccaggactggctgaacggcaaagagtac aagtgcaaggtgtccaacaaggccctgccttcctcca tcgagaaaaccatcagcaaggccaaaggccagcc ccgcgagccccaggtgtacacactgccccctagccg ggaagagatgaccaagaaccaggtgtccctgacctg cctcgtgaagggcttctaccccagcgacattgccgtg gaatgggagagcaacggccagcccgagaacaact acaagaccaccccccctgtgctggacagcgacggct cattcttcctgtacagcaagctgaccgtggacaagag ccggtggcagcagggcaacgtgttcagctgctccgtg atgcacgaggccctgcacaaccactacacccagaa gtccctgagcctgagccccggcaaggcttctcctgctg ctcctgctcctagcgctgacatccagatgacccagag ccctagcagcctgagcgccagcgtgggcgacagag tgaccatcacctgtagagccagccaggacgtgaaca ccgccgtggcctggtatcagcagaagcctggcaagg cccccaagctgctgatctacagcgccagcttcctgtac agcggcgtgcccagcagattcagcggcagcagatc cggcaccgacttcaccctgaccatcagcagcctgca gcccgaggacttcgccacctactactgccagcagca ctacaccaccccccccacatttggccagggcaccaa ggtggaaatcaagcggacagcctctcctgccgcccct gctcctgcttctcctgctgctccagctccagccagcgg atctcaggtgcagctggtggaatctggcggcggactg gtgcagcctggcggatctctgagactgagctgtgccg ccagcggcttcaacatcaaggacacctacatccactg ggtgcgccaggcccctggaaagggactggaatggg tggccagaatctaccccaccaacggctacaccagat acgccgacagcgtgaagggccggttcaccatcagc gccgacaccagcaagaataccgcctacctgcagat gaacagcctgagagccgaggataccgccgtgtacta ctgctccagatggggaggcgacggcttctacgccatg gactattggggccagggaaccctcgtgaccgtgtcct ct mAb# SEQ ID NO: QTVVTQEPSLTVSPGGTVTLTCRSSTG Nürnberg 143 AVTTSNYANWVQQKPGQAPRGLIGGT (h_Iglambda_ NKRAPGTPARFSGSLLGGKAALTLSGV LC) QPEDEAEYYCALWYSNLWVFGGGTKL TVLGQPKAAPSVTLFPPSSEELQANKA TLVCLISDFYPGAVTVAWKADSSPVKA GVETTTPSKQSNNKYAASSYLSLTPEQ WKSHRSYSCQVTHEGSTVEKTVAPTE CS SEQ ID NO: cagaccgtggtcacacaagagcccagcctgacagtt 144 tctcctggcggcacagtgaccctgacctgcagatcttct acaggcgccgtgaccaccagcaactacgccaattg ggtgcagcagaagcctggacaggctcccagaggac tgatcggcggcacaaacaaaagagcccctggcaca ccagccagattcagcggatcactgctcggaggaaag gccgctctgacactgtctggtgtccagcctgaagatga ggccgagtactactgcgccctgtggtacagcaatctgt gggtgttcggcggaggtaccaagctgaccgtgctgg gccagcccaaagccgcccctagcgtgaccctgttcc ccccctcgagtgaggaactccaggccaacaaggcc accctcgtgtgcctgatcagcgacttctaccctggcgc cgtgaccgtggcctggaaggccgatagcagccctgt gaaggccggcgtggaaaccaccacccccagcaag cagagcaacaacaaatacgccgccagcagctacct gagcctgacccccgagcagtggaagtcccacagat cctacagctgccaggtcacacacgagggcagcacc gtggaaaagaccgtggcccccaccgagtgcagc BsAb# mAb# SEQ ID NO: EVQLVESGGGLVKPGGSLRLSCAASG Freiburg_ Freiburg 145 FTFNTYAMNWVRQAPGKGLEWVGRIR 2 (IgG1f_AEASS_ SKYNNYATYYADSVKDRFTISRDDSKN HC) x TLYLQMNSLKTEDTAVYYCTTHGNFG RefmAb#2 NSYVSWFAYWGQGTLVTVSSASTKGP (scFv) SVFPLAPSSKSTSGGTAALGCLVKDYF PEPVTVSWNSGALTSGVHTFPAVLQS SGLYSLSSVVTVPSSSLGTQTYICNVN HKPSNTKVDKRVEPKSCDKTHTCPPC PAPEAEGAPSVFLFPPKPKDTLMISRT PEVTCVVVDVSHEDPEVKFNWYVDGV EVHNAKTKPREEQYNSTYRVVSVLTVL HQDWLNGKEYKCKVSNKALPSSIEKTI SKAKGQPREPQVYTLPPSREEMTKNQ VSLTCLVKGFYPSDIAVEWESNGQPEN NYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSL SLSPGKASPAAPAPSADIQMTQSPSSL SASVGDRVTITCRASQDVNTAVAWYQ QKPGKAPKLLIYSASFLYSGVPSRFSG SRSGTDFTLTISSLQPEDFATYYCQQH YTTPPTFGQGTKVEIKRTASPAAPAPA SPAAPAPASGSQVQLVESGGGLVQPG GSLRLSCAASGFNIKDTYIHWVRQAPG KGLEWVARIYPTNGYTRYADSVKGRF TISADTSKNTAYLQMNSLRAEDTAVYY CSRWGGDGFYAMDYWGQGTLVTVSS mAb#Freiburg SEQ ID NO: gaagtgcagctggtggaatctggcggcggactcgtg (IgG1f_AEASS_ 146 aagcctggcggctctctgagactgagctgtgccgcca HC) x gcggcttcaccttcaacacctacgccatgaactgggt RefmAb#2 gcgccaggcccctggcaaaggcctggaatgggtgg (scFv) gacggatcagaagcaagtacaacaattacgccacct actacgccgacagcgtgaaggaccggttcaccatca gccgggacgacagcaagaacaccctgtacctgcag atgaacagcctgaaaaccgaggacaccgccgtgta ctactgcaccacccacggcaacttcggcaacagctat gtgtcttggtttgcctactggggccagggcaccctcgtg acagtctcgagcgcgtcgaccaaaggccccagcgt gttccctctggcccccagcagcaagagcacctctggc ggaacagccgccctgggctgcctggtcaaggactac ttccccgagcccgtgaccgtgtcctggaactctggcgc cctgaccagcggcgtgcacacctttccagccgtgctc cagagcagcggcctgtacagcctgagcagcgtcgtg accgtgcccagcagcagcctgggcacccagaccta catctgcaacgtgaaccacaagcccagcaacacaa aggtggacaagcgggtggaacccaagagctgcga caagacccacacctgtcccccctgccctgcccctgaa gcggagggagccccctccgtgttcctgttccccccaa agcctaaggacaccctgatgatcagccggacccccg aagtgacctgcgtggtggtggacgtgtcccacgagg accctgaagtgaagtttaattggtacgtggacggcgtg gaagtgcacaacgccaagaccaagcccagagagg aacagtacaacagcacctaccgggtggtgtccgtgct gaccgtgctgcaccaggactggctgaacggcaaag agtacaagtgcaaggtgtccaacaaggccctgccttc ctccatcgagaaaaccatcagcaaggccaaaggcc agccccgcgagccccaggtgtacacactgcccccta gccgggaagagatgaccaagaaccaggtgtccctg acctgcctcgtgaagggcttctaccccagcgacattgc cgtggaatgggagagcaacggccagcccgagaac aactacaagaccaccccccctgtgctggacagcgac ggctcattcttcctgtacagcaagctgaccgtggacaa gagccggtggcagcagggcaacgtgttcagctgctc cgtgatgcacgaggccctgcacaaccactacaccca gaagtccctgagcctgagccccggcaaggcttctcct gctgctcctgctcctagcgctgacatccagatgaccca gagccctagcagcctgagcgccagcgtgggcgaca gagtgaccatcacctgtagagccagccaggacgtga acaccgccgtggcctggtatcagcagaagcctggca aggcccccaagctgctgatctacagcgccagcttcct gtacagcggcgtgcccagcagattcagcggcagca gatccggcaccgacttcaccctgaccatcagcagcct gcagcccgaggacttcgccacctactactgccagca gcactacaccaccccccccacatttggccagggcac caaggtggaaatcaagcggacagcctctcctgccgc ccctgctcctgcttctcctgctgctccagctccagccag cggatctcaggtgcagctggtggaatctggcggcgg actggtgcagcctggcggatctctgagactgagctgtg ccgccagcggcttcaacatcaaggacacctacatcc actgggtgcgccaggcccctggaaagggactggaat gggtggccagaatctaccccaccaacggctacacca gatacgccgacagcgtgaagggccggttcaccatca gcgccgacaccagcaagaataccgcctacctgcag atgaacagcctgagagccgaggataccgccgtgtac tactgctccagatggggaggcgacggcttctacgcca tggactattggggccagggaaccctcgtgaccgtgtc ctct mAb# SEQ ID NO: QTVVTQEPSLTVSPGGTVTLTCRSSTG Freiburg 147 AVTTSNYANWVQQKPGQAPRLIGGT (h_Iglambda_ NKRAPGTPARFSGSLLGGKAALTLLGA LC) QPEDEAEYYCALWYSNLWVFGGGTKL TVLGQPKAAPSVTLFPPSSEELQANKA TLVCLISDFYPGAVTVAWKADSSPVKA GVETTTPSKQSNNKYAASSYLSLTPEQ WKSHRSYSCQVTHEGSTVEKTVAPTE CS mAb#Freiburg SEQ ID NO: cagaccgtggtcacacaagagcccagcctgacagtt (h_Iglambda_ 148 tctcctggcggcacagtgaccctgacctgcagatcttct LC) acaggcgccgtgaccaccagcaactacgccaattg ggtgcagcagaagcctggacaggctcccagaggac tgatcggcggcacaaacaaaagagcccctggcaca ccagccagattcagcggatcactgctcggaggaaag gccgctctgacactgcttggagcacagcctgaagatg aggccgagtactactgcgccctgtggtacagcaatct gtgggtgttcggcggaggtaccaagctgaccgtgctg ggccagcccaaagccgcccctagcgtgaccctgttc cccccctcgagtgaggaactccaggccaacaaggc caccctcgtgtgcctgatcagcgacttctaccctggcg ccgtgaccgtggcctggaaggccgatagcagccctg tgaaggccggcgtggaaaccaccacccccagcaa gcagagcaacaacaaatacgccgccagcagctac ctgagcctgacccccgagcagtggaagtcccacag atcctacagctgccaggtcacacacgagggcagca ccgtggaaaagaccgtggcccccaccgagtgcagc
WORKING EXAMPLES
Example 1—Humanization of Murine Antibody SP34
(297) Humanized derivatives of SP34 and variants thereof were prepared.
(298) The amino acid sequence of either the murine variable heavy chain (SEQ ID NO: 3) and the murine variable light chain (SEQ ID NO: 4) of SP34 were aligned to the repertoire of human VL or VH germline sequences (https with the extension ncbi.nlm.nih.gov/igblast of the world wide web) using the Vector NTI DNA analysis software.
(299) On the basis of this analysis, the human germline segments VL7-43 and VL7-46 were chosen as template sequences for the humanized SP34 VL variants. For the human VH, the human germline sequences VH3-15 and VH3-73 were chosen as template sequences.
(300) Selected amino acid residues that differed between the murine VL chain and the human Vlambda segment VL7-43 and VL7-46 or the murine VH chain and the human VH3-15 and VH3-73 chain within the framework regions were mutated on the DNA level towards the human residues. Potentially crucial framework residues of the original murine Vlambda or VH sequence were maintained.
(301) In sum, 4 distinct humanized VL amino acid sequences and 2 distinct humanized VH amino acid sequences were designed, whose CDRs were identical to the CDRs from the murine antibody SP34 VL and VH chain, respectively.
(302) In addition, for two of the designed VL sequences, additional amino acid substitutions at Kabat Positions 52-54 within the LCDR2 were introduced, namely N52K, K53F, R54L.
(303) An in silico T cell epitope screening for the obtained VH and VL sequences was done (Lonza, The Epibase™ In Silico tool). The screening tool allows for the identification of potential T cell epitopes in biotherapeutic protein and antibody targets. The tool uses structural characteristics of the HLA receptor along with experimentally determined binding affinities to predict potential peptide/HLA binding, a condition necessary for T cell activation
(304) An exemplary result of the in silico immunogenicity analysis for the VH and VL sequences of the humanized SP34 variant “Munchen” is shown in Table 13. The analysis revealed a significant lower immunogenicity score for the VH and VL of the humanized variant in view of the parental murine antibody SP34.
(305) TABLE-US-00012 TABLE 13 Immunogenic risk scores for Caucasian DRB1 alleles Risk Score Sequence (Caucasian) SP34_VL 621.4 München_VL 333.0 SP34_VH 953.0 München_VH 549.1
(306)
(307) The amino acid sequences and encoding polynucleotide sequences of these humanized derivatives are shown in TABLE 3 and TABLE 4.
Example 2: Gene Synthesis and Cloning of the Humanized VH and VL Region of SP34 into Human IgG Backbones
(308) The afore-mentioned humanized VH and VL regions of SP34 were gene synthesized by an external provider (GeneArt® (chemical preparations for laboratory analysis), ThermoFisher Scientific) and in-house cloned into a set of suitable prepared mammalian IgG expression vectors (two vector IgG expression system).
(309) Subsequently, Eukaryotic HKB-11 cells were transfected with the mammalian expression vector DNAs encoding the heavy and light chains of IgG, respectively. Cell culture supernatants were harvested on day 3 or 6 post transfection and subjected to standard Protein A affinity chromatography (MabSelect SURE® (chromatography chemicals)|GE Healthcare). Buffer exchange was performed to 1× Dulbcecco's PBS (pH 7.2|Invitrogen) and samples were sterile filtered (0.2 μm pore size).
(310) Protein concentrations were determined by UV-spectrophotometry and purities of IgG were analyzed under denaturing, reducing and non-reducing conditions using CE-SDS (LabChip® (biological chemical diagnostic test kits for scientific or research use, consisting of nucleic acid molecules, DNA molecules, slides and membranes for comparison testing of expression levels of biological samples) GXII|Perkin Elmer PerkinElmer® (full line of scientific, electrical, photographic, optical, weighing, measuring and signalling apparatus)|USA). HP-SEC was performed to analyze IgG preparations in native state.
Example 3—Control Constructs Used in the Following Examples
(311) Various control constructs (CD3 specific IgGs or HER2×CD3 bispecific Abs) were included in the following experiments for comparative purposes:
(312) Nucleotide sequences encoding the VH and VL domains from “Trastuzumab” ((RefmAb #2); an antibody specific for HER2) as described by Baselga et al. 1998, Cancer Res 58(13): 2825-2831).
(313) Nucleotide sequences encoding VH and VL domains from “SP34” a murine monoclonal antibody as described by Yoshino et al. (Exp. Anim. 49(2), 97-110, 2000) as well as RefMAb #1, an antibody disclosed in WO2008119566A2. Both antibodies are reactive against the N-terminus of the epsilon chain of the T3 complex on human T lymphocyte cells.
(314) All nucleotide sequences were gene synthesized as linear DNA fragments with appropriate flanking regions (e.g. suitable restriction enzyme recognition sites, linker sequences) either in-house or by an external provider. All synthesized DNA fragments were cloned into suited mammalian IgG expression vectors using standard molecular biology methods.
(315) The murine monoclonal antibody “OKT-3” (J Pediatr. 1982 April; 100(4):665-8) which also binds to the human epsilon chain of CD3 but to a distinct epitope as RefMab #1 and SP34 is commercially available and was purchased from Thermo Fisher (Catalog Nr. 16-0037-85).
Example 4: Binding of CD3 Specific IgGs to Recombinant CD3Epsilon Antigens
(316) 7 humanized CD3 epsilon specific IgGs according to the present disclosure and two CD3 specific reference antibodies were tested for their ability to bind to recombinant human and cynomolgus CD3 epsilon in ELISA.
(317) 5 nM of recombinant human CD3e (22-49)-Fc2 (K105-K330) (SEQ ID NO: 149) or 1 nM of recombinant cynomolgus CD3e (22-49)-Fc2 (K105-K330) (SEQ ID NO: 150) were coated on Maxisorp plates (Nunc, #460518). Coated plates were blocked with 5% skim milk in PBS. Antibodies were serially diluted in PBS containing 0.5% skim milk and 0.5% Tween®-20 (biocompatible surfactants used in food, biotechnical, and pharmaceutical applications). Bound antibodies were detected using an alkaline phosphatase-conjugated detection antibody directed against human F(ab′)2 fragment (Jackson Immuno Research, #109-055-097). EC.sub.50 values were calculated using 4-parameter non-linear regression analysis in Prism software (GrapPad Software Inc., version 5.04).
(318) The results of the experiment are summarized in TABLE 8 and
(319) TABLE-US-00013 TABLE 8 ELISA binding EC50 [nM] hCD3e(22-49)_ cyCD3e(22-49)_ IgGs Fc2(K105-K330) Fc2(K105-K330) SP-34 (m/h 0.39 0.15 chimeric) RefmAb#1 0.38 0.12 mAb#Mainz 1.21 1.53 mAb#Köln 0.31 0.20 mAb#Freiburg 0.91 1.26 mAb#München 0.60 1.43 mAb#Bremen 1.10 0.80 mAb#Gladbach 0.38 0.21 mAb#Nürnberg 0.34 0.21
Example 5: Binding of CD3 Specific IgGs to CD3 Expressing Cell Lines
(320) 7 humanized CD3 epsilon specific IgGs of the present disclosure were tested for their ability to bind to Jurkat cells (a CD3 positive human T-cell line) and to the corresponding CD3 negative cell line J.RT3-T3.5., a derivative mutant of the parental Jurkat leukemia cell.
(321) Jurkat and J.RT3-T3.5. cells were resuspended and counted in Superblock® (chemical preparations for use in connection with analytical procedures in research and diagnostic applications and in the chemical and biotechnological industries; ThermoScientific, #37515) and blocked for 1 h on ice. Blocked cells were resuspended in anti-CD3 antibodies serially diluted in Superblock® and incubated for 1 h on ice. Cells were washed 2 times in D-PBS (Gibco) containing 3% fetal bovine serum (Sigma, #F7524). Bound antibodies were detected using R-Phycoerythrin-conjugated detection antibody directed against human F(ab).sub.2 fragment (Jackson Immuno Research, #109-116-097). Antibody staining was measured using FACS Array FACSArray® (Flow Cytometer; Beckton Dickinson) or IntelliCyt iQue® flow cytometer and analyzed in FlowJo® (Computer software for data analysis; version 7.6.5) or ForeCyt (version 4.1.5379, IntelliCyt) softwares, respectively. EC.sub.50 values were calculated using 4-parameter non-linear regression analysis in Prism software (GraphPad Software Inc., version 5.04).
(322) The results of the experiment are shown in TABLE 9 and
(323) TABLE-US-00014 TABLE 9 Cell binding Jurkat IgG EC.sub.50 [nM] SP34 (m/h 1.4 chimeric) RefmAb#01 1.1 mAb#Mainz 9.4 mAb#Köln 1.8 mAb#Freiburg 10.7 mAb#München 6.6 mAb#Bremen 6.3 mAb#Gladbach 1.4 mAb#Nürnberg 1.0
Example 6: K.SUB.D .Determination Using SPR in Antibody Capture Setup
(324) High-capacity capture surfaces were prepared by covalently immobilizing MabSelect SuRe® ligand (GE Healthcare, 28-4018-60) onto all flowcells of a CM5 chip (GE Healthcare, BR-100530) using EDC/NHS chemistry.
(325) Each cycle of the kinetic experiment consisted of capture steps (of different antibody ligands on the specific flow cells 2, 3 and 4), followed by an analyte injection (on all flow cells, including reference, or flow cell 1). At the end of each cycle, the sensor surface was regenerated by 2 consecutive injections of 10 mM Glycine/HCl pH1.5 (GE Healthcare, BR-100354) to remove captured antibody/antigen complexes, while maintaining the integrity of the capture surface. A blank injection of running buffer was used for referencing, i.e. correcting for dissociation of captured antibody. Association was recorded for 180 s and dissociation for 300 s at a flow rate of 30 μL/min. HBS-EP+ (GE Healthcare, BR-100669; 10 fold stock diluted to 1× with H.sub.2O) was used as running buffer.
(326) Capture levels of antibodies were adjusted to approx. 75-185 RU to achieve saturation levels Rmax of approx. 20-60 RU by the hCD3e analyte. Six different analyte concentrations were used for analysis during kinetic experiments (pMAX_hCD3e(1-118)_F-chLys_avi; applied molarities 4.1-999 nM, in a 3 fold serial dilution series).
(327) Sensorgrams were evaluated with Biacore® T200 Evaluation Software 3.0 (Biacore®, GE Healthcare). All sensorgrams were fitted to a 1:1 binding model to determine k.sub.on and k.sub.off rate constants, which were used to calculate the K.sub.D value. For kinetic profiles deviating from the expected 1:1 binding, the sensorgrams were evaluated using a best approximation to the monovalent kinetics, and results marked with comment “heterogeneous binding”. These results are considered less precise than kinetic profiles completely following the expected monovalent binding kinetics, but are assumed to be good approximations for K.sub.D.
(328) The results of this experiment are shown in TABLE 10 and reveal that SP34 and the humanized CD3 variants of the present disclosure exhibited equivalent or lower affinity binding to recombinant human CD3 epsilon.
(329) TABLE-US-00015 TABLE 10 K.sub.D values of IgGs as determined on CD3 antigen pMAX_hCD3e(22-118)_F-chLys_avi KD restriction IgG k.sub.on [1/Ms] k.sub.off [1/s] K.sub.D [nM] Comment (yes/no) SP34 (m/h 4.87E+05 8.35E−04 1.7 no chimeric) RefmAb#1 3.74E+05 4.91E−04 1.3 no mAb#Mainz 1.42E+04 8.47E−03 600 weak binding yes signals, only 333 nM & 999 nM evaluated mAb#Köln 7.62E+04 3.86E−03 51 slightly no heterogeneous binding mAb#Freiburg 3.52E+04 4.67E−03 130 heterogeneous yes binding mAb#München 8.40E+04 6.58E−03 78 slightly no heterogeneous binding mAb#Bremen 6.50E+04 4.79E−03 74 heterogeneous yes binding mAb#Gladbach 7.18E+04 3.85E−03 54 slightly no heterogeneous binding mAb#Nürnberg 8.00E+04 3.87E−03 48 only conc. yes 37-333 nM used for evaluation
Example 7: Generation of Bispecific Antibodies (bsAbs) that Specifically Bind to CD3 Epsilon and HER2
(330) Bispecific antibodies according to the present disclosure were designed using an IgG-scFv format comprising an aglycosylated monoclonal IgG1 binding moiety and a scFv binding moiety, with the N-terminus of each scFv VL domain fused to the C-terminal end of each IgG heavy chain via a peptide linker. Both Fabs arms of the IgG bind to HER2 while the scFv is specific for CD3 (both scFv are identical and display the same specificity for CD3). Alternatively, bispecific antibodies were generated, wherein the two scFv molecules were specific for HER2 and the Fab arms of the IgG1 portion were specific for CD3.
(331) All constructs were generated using standard molecular methodologies as described in Example 3.
(332) A summary of the components of the antigen-binding domains of the various bispecific antibodies and of the bispecific antibodies made in accordance with this example is set forth in TABLE 5, 6 and 7.
(333) Subsequently, Eukaryotic HKB-11 cells were transfected with mammalian expression vectors with DNA encoding all component of the various bispecific antibodies. Cell culture supernatants were harvested on day 3 or 6 post transfection and subjected to standard Protein A affinity chromatography (MabSelect SURE®|GE Healthcare). Buffer exchange was performed to 1× Dulbcecco's PBS (pH 7.2|Invitrogen) and samples were sterile filtered (0.2 μm pore size).
(334) Protein concentrations were determined by UV-spectrophotometry and purities of IgG were analyzed under denaturing, reducing and non-reducing conditions using CE-SDS (LabChip® GXII|Perkin Elmer PerkinElmer®|USA). HP-SEC was performed to analyze IgG preparations in native state.
Example 8: Isolation of Human and Cynomolgus PBMCs
(335) Human whole blood from healthy donors (in house) and whole blood from cynomolgus monkey (retrieved from LPT Laboratory of Pharmacology and Toxicology, Hamburg, Germany) was collected in Li-Heparin containing S-Monovette® (scientific laboratory instruments, apparatus and equipment for clinical use) containers (Sarstedt). Blood was transferred to 50 ml conical tubes and mixed with an equal volume of PBS containing 2% fetal bovine serum (Sigma, #F7524) and 2 mM EDTA. Diluted blood was transferred to SepMate® (cell separation equipment)-50 tubes (StemCell Technologies® (cell separation equipment), #86450) containing 15 ml Biocoll solution (Biochrom, #L6115) and centrifuged for 10 min at 1200×g. Supernatant was transferred into a 50 ml conical tube, diluted to 45 ml with PBS and centrifuged for 8 min at 300×g. Supernatant was discarded, cell pellet resuspended in 1 ml PBS and cells counted using a Neubauer chamber.
Example 9: Cell Binding of HER2×CD3 bsAbs to CD3 or HER2 Expressing Cell Lines
(336) 3 HER2 IgG×CD3 scFv bispecific antibodies of the present disclosure and one control bispecific antibody comprising the variable domains of RefmAb #1 were tested for their ability to bind to Jurkat cells expressing CD3 or to SKBR3 cells expressing high levels of the target antigen HER2. Experiments were done as described in Example 5.
(337) The results of this experiment are summarized in TABLE 11 and reveal that the humanized variants of the present disclosure exhibited equivalent or weaker binding to Jurkat cells when compared to the control bispecific antibody comprising the Fab binding domains of RefMab #2 and the scFv binding domains of RefMab #1. In contrast, binding to SKBR3 cells remained unaffected.
(338) TABLE-US-00016 TABLE 11 Cell binding of HER2 × CD3 bsABs to Jurkat and SKBR3 cells Bispecific FACS EC.sub.50 [nM] antibody Jurkat SKBR3 BsAb#RefMab1 23 21 BsAb#Freiburg >100 15 BsAb#München 52 10 BsAb#Bremen 34 12
Example 10: Cell Binding of CD3 Specific IgGs and HER2×CD3 Bispecific Antibodies to Lymphocytes Expressing CD3
(339) 3 HER2 IgG×CD3 scFv bispecific antibodies of the present disclosure and a control bispecific antibody comprising the variable domains of RefmAb #1 were tested by FACS for their ability to bind to human and cynomolgus lymphocytes expressing CD3.
(340) In addition, 7 humanized anti-CD3 epsilon specific IgGs of the present disclosure were tested for their ability to bind to human derived (n=3) and cynomolgus derived (n=1) PBMCs.
(341) 200,000 purified human or cynomolgus PBMCs were mixed with antibodies serially diluted (final concentration: 0.1 nM-400 nM or 0.01-200 nM) in D-PBS (Gibco) containing 3% fetal bovine serum (Sigma, #F7524) and incubated for 1 h on ice. Bound antibodies were detected using R-Phycoerythrin-conjugated detection antibody directed against human F(ab′)2 fragment (Jackson Immuno Research, #109-116-097). Antibody staining was measured using a FACSArray® flow cytometer (Beckton Dickinson) and analyzed using FlowJo® software (version 7.6.5). Lymphocytes were identified by morphological gating of forward and side scatters. EC.sub.50 values were calculated using 4-parameter non-linear regression analysis in Prism software (GraphPad Software Inc., version 5.04).
(342) The results of the experiments are shown in
Example 11: T Cell Activation by HER2×CD3 bsAbs in the Absence of Target Cancer Cells
(343) 3 HER2 IgG×CD3 scFv bispecific antibodies of the present disclosure were tested for their ability to activate human T cells derived from different from human blood samples of different donors in the absence of target cancer cells.
(344) Human PBMCs were purified as described above. Cells were resuspended to a density of 1E+07 cells/mL in RPMI 1640 medium (Gibco, #31870-025) supplemented with GlutaMax® (cell culture supplement for adherent and suspension culture of mammalian cells all for research use or further manufacturing) (Gibco, #35050-038), non-essential amino acids (Gibco, #11140-035), HEPES buffer bolution (Gibco #15630-056), sodium pyruvate (Gibco, #11360-039), β-mercaptoethanol, Penicillin/Streptomycin (Gibco #15140-122) and human serum (Sigma, #H4522) and incubated for 48 h at 37° C. and 5% CO.sub.2. Following high-density preincubation, 200,000 PBMCs in medium were mixed with an equal volume of serially diluted antibodies (final concentration: 10 nM, 0.1 nM, 0.001 nM) in medium and incubated for 24 h at 37° C. and 5% CO.sub.2.
(345) Activation of T cells was assessed by evaluation of upregulation of CD69 expression on CD4 positive or CD8 positive T cells. For this, PBMCs were stained with antibodies to CD69, CD4 and CD8 conjugated with APC, APC/Cy7 and PE/Cy7, respectively (Biolegend® (reagents for scientific or research use), #310910/#300518/#344712). Antibody staining was measured using NovoCyte® (instrumentation for measuring, detecting or analyzing chemical or biological samples, including biological cells, polymer beads of different sizes such as from nanometer to mm range or scale) 3000 flow cytometer (Acea Biosciences, Inc.) and analyzed using FlowJo® software (version 7.6.5).
(346) Results of the T cell activation experiments are shown in
(347) In contrast, no or very weak activation of T-cells was observable for the 3 HER2 IgG×CD3 scFv bispecific antibodies (BsAb #Freiburg, BsAb #Munchen, BsAb #Bremen) in the absence of HER2 expressing target cells. This finding clearly demonstrating the preferred safety profile of the humanized CD3 specific antibodies of the present disclosure even when bivalently binding to CD3.
Example 12: Cytotoxicity Assay with HER2×CD3 Bispecific Constructs
(348) 3 HER2 IgG×CD3 scFv bsAbs of the present disclosure were tested for their ability to mediate T cell dependent killing of HER2 tumor cell lines.
(349) 5,000 HER2-expressing SKBR3, A498 cells and HER2-negative MDA-MB468 cells were suspended in culture medium (SKBR3: McCoy's 5A Medium (Gibco, #26600), 10% FCS (Sigma, #F7524); MDA-MB468: DMEM (Gibco, #10938), GlutaMax® (Gibco, #35050), 10% FCS, lx Sodium Pyruvate (Gibco, #11360-039)), seeded in black 96 well assay plates (Corning, #3340) and incubated over night at 37° C. and 5% CO.sub.2. CellToxGreen™ dye (Promega, #G8731), serially diluted bispecific antibody constructs (final concentration: 0.1-100 pM) and 100,000 purified PBMCs, all diluted in assay medium comprising RPMI 1640 w/o Phenol red (Gibco, #32404-014), GlutaMax® and 10% fetal bovine serum, were added to the cells and incubated for 48 h at 37° C. and 5% CO.sub.2.
(350) Cytotoxic activity was assessed by measuring incorporated CellToxGreen™ fluorescence at 485 nm excitation and 535 nm emission using a Tecan Infinite F500 device. EC.sub.50 values were calculated using 4-parameter non-linear regression analysis in Prism software (GraphPad Software Inc., version 5.04).
(351) Further evidence for T cell-mediated target cell killing was assessed by determined by secretion of the pro-inflammatory cytokine IFN-gamma using a commercially available kit (Human IFN-gamma Duo Set ELISA, R&D Systems, DY285).
(352) Results of the experiments for one exemplified doner are shown in
(353) However, bispecific constructs of the present disclosure displayed a much weaker antibody dose dependent killing of HER2 low expressing A498 cells compared to that of the control antibody bsAb_RefMab #1. This clearly indicates a favorable safety profile for the antibodies of the present disclosure. The IC.sub.50 values were higher for the humanized antibodies displaying weaker binding to CD3 as compared to the control antibody bsAb_RefMab #1, most likely because of a decreased activation of CD8+ T cells (
(354)
Example 13: Cytotoxicity Assay with CD3×HER2 Bispecific Constructs
(355) 7 CD3 IgG×HER2 scFv bispecific antibodies of the present disclosure were tested for their ability to induce T-cell directed target cell killing as described in Example 12.
(356) Results of the experiments are depicted in
(357) These results clearly demonstrates that the favorable killing and safety properties of the bispecific antibodies of the present disclosure are independent from a particular CD3 format.
Example 14: K.SUB.D .Determination Using SPR in Antibody Capture Setup
(358) Affinities for 3 HER2 IgG×CD3 scFv bispecific antibodies on recombinant human CD3 epsilon was determined as described in Example 6.
(359) As shown in TABLE 12, the bispecific antibodies comprising humanized CD3 specific binding domains according to the present disclosure bind to human CD3 epsilon with significant weaker affinity when compared to the affinity of control antibody bsAb_RefMab #1.
(360) TABLE-US-00017 TABLE 12 KD values of HER2 [IgG] × CD3 [scFv] bispecific antibodies determined on CD3 antigen pMAX_hCD3e(22-118)_F-chLys_avi K.sub.D k.sub.on k.sub.off K.sub.D restriction Construct [1/Ms] [1/s] [nM] Comment (yes/no) bsAb_RefMab#1 3.63E+05 3.67E−04 1.0 no BsAb#Freiburg 3.13E+04 3.36E−03 110 hetero- yes geneous binding BsAb#München 3.65E+04 1.80E−03 49 slightly no hetero- geneous binding BsAb#Bremen 6.15E+04 2.07E−03 34 slightly no hetero- geneous binding