TARGETING DIMERIZATION OF BAX TO MODULATE BAX ACTIVITY

20170114100 ยท 2017-04-27

Assignee

Inventors

Cpc classification

International classification

Abstract

Methods are provided for identifying an agent that directly modulates a Bcl-2- associated x-protein (BAX) by promoting or disrupting dimerization of the BAX. Agents that directly modulate BAX by affecting dimerization are also provided.

Claims

1. A method of identifying an agent as a candidate agent for promoting or inhibiting cell death comprising (a) contacting the agent with BCL-2-associated X-protein (BAX) monomers or portions thereof, and/or with BAX dimers, and (b) measuring if the agent inhibits or promotes dimerization of BAX; wherein a decrease in binding of BAX monomers to other BAX monomers or to portions of BAX monomers in the presence of the agent compared to in the absence of the agent indicates the agent inhibits dimerization of BAX, wherein an agent that agent inhibits dimerization of BAX is a candidate agent for promoting cell death; and wherein an increase in binding of BAX monomers or portions thereof to other BAX monomers or portions thereof in the presence of the agent compared to in the absence of the agent indicates that the agent promotes dimerization of BAX, wherein an agent that agent promotes dimerization of BAX is a candidate agent for inhibiting cell death.

2. (canceled)

3. The method of claim 1, wherein the agent binds to the N-terminal of BAX at one or more of binding site residues S16, E17, Q18, I19, M20, K21, T22, G23, A24, L25, L26, 127, Q28, G29, F30, I31, Q32, D33, R34, A35, G36, R37, M38, G39, G40, E41, A42, P43, E44, L45, A46, L47, D48, P49, V50, P51, Q52, D53, A54, V129, P130, E131, L132, I133, R134, T135, I136, M137, G138, W139, T140, L141, D142, F143, L144, R145, E146, and R147.

4. The method of claim 1, wherein the agent binds to the C-terminal of BAX at one or more of binding site residues N73, M74, E75, L76, D98, M99, F 100, S101, D102, G103, N104, F105, N106, W107, G108, R109, I152, Q153, D154, Q155, G156, G157, W158, D159, G160, L161, L162, S163, Y164, F165, G166, T167, P168, T169, W170, Q171, T172, V173, T174, i175, F176, V177, A178, G179, V180, L181, T182, A183, S184, L185, T186, I187, W188, K189 K190, M191, and G192.

5. The method of claim 1, wherein measurement of BAX as a dimer or monomer is carried out using one or more of a fluorescent polarization assay, size exclusion chromatography (SEC), polyacrylamide gel electrophoresis, dynamic light scattering and an antibody that specifically binds to either BAX dimer or BAX monomer.

6. A method for identifying an agent that modulates the activity of BAX comprising contacting 9 helix peptide of BAX with N-terminal binding site of BAX in the presence of the agent and in the absence of the agent; and measuring binding between the 9 helix peptide of BAX and the N-terminal binding site of BAX, wherein decreased binding in the presence of the agent compared to binding in the absence of the agent indicates that the agent is a modulator of the activity of BAX.

7. The method of claim 6, wherein the agent is an inhibitor of BAX.

8. The method of claim 6, wherein the 9 peptide of BAX has the amino acid sequence TWQTVTIFVAGVLTASLTIWKKMG (SEQ ID NO:11).

9. The method of claim 6, wherein the 9 helix peptide of BAX or the N-terminal binding site of BAX is immobilized on a solid substrate.

10. The method of claim 6, wherein binding between the 9 helix peptide of BAX and the N-terminal binding site of BAX is measured using a fluorescence assay.

11-14. (canceled)

15. A peptide consisting of: TABLE-US-00006 a) (SEQIDNO:11) TWQTVTIFVAGVLTASLTIWKKMG, b) (SEQIDNO:12) TWQTVTIFVAGVLTASLT, c) (SEQIDNO:13) TWQTVTIFVAGVLTA, d) (SEQIDNO:14) TWQTVTIFVAGVL, e) 11-30 amino acid residues comprising the sequence TXQTXXIFXAG (SEQ ID NO:15), where X at any position can independently be any amino acid or unnatural amino acid or non-naturally occurring chemically modified amino acid, f) 15-30 amino acid residues comprising the sequence TXQTXXIFXAGVXTA (SEQ ID NO:16), where X at any position can independently be any amino acid or unnatural amino acid or non-naturally occurring chemically modified amino acid, or g) 11-30 amino acid residues comprising the sequence Y1XY2Y3XXY4Y5XY6Y7 (SEQ ID NO:17), where Y1 is threonine or a conserved amino acid, or unnatural amino acid or non-naturally occurring chemically modified amino acid, Y2 is glutamine or a conserved residue or unnatural amino acid or non-naturally occurring chemically modified amino acid, where Y3 is threonine or a conserved amino acid, or unnatural amino acid or non-naturally occurring chemically modified amino acid, where Y4 is isoleucine or a conserved amino acid, or unnatural amino acid or non-naturally occurring chemically modified amino acid, where Y5 is phenylalanine or a conserved amino acid, or unnatural amino acid or non-naturally occurring chemically modified amino acid, where Y6 is alanine or a conserved amino acid, or unnatural amino acid or non-naturally occurring chemically modified amino acid, where Y7 is glycine or a conserved amino acid, or unnatural amino acid or non-naturally occurring chemically modified amino acid, where X at any position can independently be any amino acid, or natural or non-naturally occurring chemically modified amino acid.

16. The peptide of claim 15 consisting of the sequence TXQTXXIFXAG (SEQ ID NO:15) or the sequence TXQTXXIFXAGVXTA (SEQ ID NO:16).

17. A chemically synthesized peptide consisting of any of the peptides of claim 15.

18. A peptide produced by recombinant DNA or cDNA consisting of any of the peptides of claim 15.

19. (canceled)

20. A method of inhibiting BAX comprising contacting BAX with the peptide of claim 15.

21. The method of claim 20, wherein BAX is in a living cell and inhibition of BAX inhibits cell death.

22. The method of claim 20, wherein the BAX is in a subject and the agent is administered to the subject.

23. (canceled)

24. The method of claim 22, wherein the subject has a disease or disorder associated with premature or unwanted cell death and characterized by abnormal activation, expression or function of BAX.

25. The method of claim 24, wherein the disease or disorder is a cardiovascular disease or disorder, a neurodegenerative or neurological disease or disorder, a liver disease or disorder, a kidney disease or disorder, an immunological disorder, ischemia, infertility, a blood disorder, renal hypoxia, hepatitis, asthma or AIDS.

26. A labeled peptide comprising the peptide of claim 15 attached to a fluorescent label or to a radioactive label.

27. A method of identifying an agent as a candidate agent for inhibiting cell death comprising: contacting BCL-2-associated X-protein (BAX) with one or more peptides of claim 15 in the presence of the agent and in the absence of the agent, and measuring binding of the one or more peptides to BAX, wherein decreased binding of the one or more peptides to BAX in the presence of the agent compared to binding of the one or more peptides to BAX in the absence of the agent indicates that the agent is a candidate agent for inhibiting cell death.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

[0019] FIG. 1A-1D. BAX forms an inactive dimer conformation. (A) Representative size exclusion chromatography (SEC) trace of recombinant BAX analyzed by Superdex 200 (HR 10/30) gel filtration column showing eluted monomer (M) and dimer (D) peaks at 15.8 ml and 14.2 ml, respectively. (B) Recombinant BAX (rec. BAX), cytosolic extract of WT MEF and DKO MEF, and cytosolic extract from WT MEF treated with 1% Triton X-100 (cyt. BAX+1% Triton) were analyzed by Superdex 200 (HR 10/30) gel filtration. Fractions corresponding to indicated molecular weights and elution volumes were analyzed by anti-BAX immunoblotting. (C) Dimerization of purified monomeric recombinant BAX at different doses was analyzed by Superdex 75 (HR 10/30) gel filtration chromatography showing eluted monomer (M) and dimer (D) peaks at 11.8 ml and 10.4 ml respectively. (D) Liposome release assay plotted in kinetic format of SEC-isolated BAX monomer and dimer without and with stapled peptide-based BAX activator BIM SAHB.sub.A2 at indicated concentrations. Data shown in (A-C) representative of three experiments and in (D) are mean from four independent experiments.

[0020] FIG. 2A-2B. Crystal structure of the inactive BAX dimer. (A) Ribbon representation of the BAX dimer crystal structure. Dimerization interaction interfaces are shown for each BAX protomer. Helices () and loops (L) are depicted on the structures. Secondary structure representation cartoon showing the location of the BCL-2 homology domains (BH), the transmembrane region (TM), and the dimerization interaction interfaces. (B) Ribbon representation of each BAX protomer in view related to the representation in (A) at 90 degrees rotation around a vertical axis, showing the N-terminal and C-terminal dimerization interfaces.

[0021] FIG. 3A-3E. Structural details of the BAX dimerization mechanism. (A) Calculated vacuum electrostatics of the C-terminal and N-terminal interaction surfaces of each BAX protomer in the dimer showing the position of complementary hydrophobic, polar and charged residues. (B) Cartoon representation of the BAX dimer showing the protomers labelled by their dimer interaction interface. The interacting residues are shown in sticks and are highlighted in three different regions of the dimer interaction interface: (C) hydrophobic core of the dimerization interface involving 9 residues 1175 and F176 of one protomer and residues M20 and A24 from 1, M137 and L141 from 6 and L47 and V50 from 1-2 loop, (D) hydrogen bonds between the following residue pairs of different BAX protomer: R145 of 6 and Q171 of 9, El7 of 1 and M74 and E75 of 3 and salt bridge between K21 of 1 and E75 of 3 residue pair and (E) hydrogen bonds between the following residue pairs of different BAX protomer: A46 of 1-2 loop and Y164 of 8, E44 of 1-2 loop and W107 of 5, D48 of 1-2 loop and N106 of 5 and salt bridge between D48 of 1-2 loop and R109 of 4-5 loop residue pair.

[0022] FIG. 4A-4D. Autoinhibited dimer of BAX regulates BAX activation and apoptosis. (A) Dimerization of purified monomeric recombinant BAX WT and mutants was analyzed by SEC and quantified by integration of areas under observed monomer and dimer peaks. (B) Protein lysates of untreated DKO MEFs reconstituted with BAX WT and mutants were subjected to separation of cytosol from mitochondria, followed by SEC using Superdex 200 (HR 10/30). (C) Viability assay of transient transduced DKO MEFs with human BAX WT and mutants as measured by annexin-V binding. P values <0.05 for all mutants compared to BAX WT. (D) BAX WT and BAX P168G cells were treated with 1 M STS treatment for 6 h; BAX E75K and S184L cells were treated for 3 h due to faster cell death. Cytosolic and mitochondrial fractions were isolated and analyzed by SEC. Data shown in (B) and (D) are representative of three independent experiments and in (A) and (C) are meanSD from three independent experiments.

[0023] FIG. 5. Anti-apoptotic BCL-2, BCL-X.sub.L and MCL-1 proteins, established to interact with BAX, are in very low levels in the cytosol compared to BAX and predominantly reside at the mitochondria. Protein levels of BAX, BCL-2, BCL-X.sub.L and MCL-1 in cytosolic and mitochondrial fractions of MEFs as determined by immunodetection. Separation of the cytosolic from the mitochondrial fraction of MEFs is confirmed with b-tubulin and VDAC antibodies respectively.

[0024] FIG. 6A-6B. Cytosolic BAX in dimer conformation is inactive as determined by immunoprecipitation assay with the 6A7 antibody that specifically recognizes the active conformation of BAX. (A) Size-exclusion chromatography analysis of cytosolic extracts of MEFs using Superdex 200 10/300 GL gel filtration column, indicating the elution profile of BAX WT in dimer size (B) Fractions 6 and 8 of BAX WT are 6A7 negative and failed to co-immunoprecipitate with the 6A7 antibody. As a positive control, fractions were incubated with 1% Octylglucoside detergent that activates BAX and exposes the 6A7 epitope on BAX.

[0025] FIG. 7. BAX dimerization is detected using a crosslinking approach. Coomassie stains of BAX in polyacrylamide gel electrophoresis (SDS-PAGE) after treatment with 20 BMH crosslinking reagent for 15 min at indicated BAX concentrations.

[0026] FIG. 8. Protein sequence alignment of BAX sequences from indicated species. Protein sequence alignment of BAX sequences showing identical residues shaded in light grey; conserved residues, similar residues and different residues shaded in white. Asterisks denote the positions of residues in each BAX protomer that is involved in interactions at the interface of the BAX dimer structure. Secondary structure symbols of helices and loops are based on the crystal structure of BAX dimer From top to bottom of sequences: SEQ ID NO:3 (Homo sapiens) to SEQ ID NO:10 (consensus).

[0027] FIG. 9A-9C. Crystal structure of mutant BAX G67R dimer indicates the same dimerization mechanism of BAX as determined in the structure of the BAX P168G dimer. (A) Structural alignment of the crystal structure of BAX G67R dimer (light grey) and BAX P168G dimer (darker grey). (B) Structural alignment of BAX G67R protomer (light grey) and BAX P168G protomer (darker grey) crystal structures in view centered around helix 5. (C) Structural alignment of BAX G67R protomer (light grey) and BAX P168G protomer (darker grey) crystal structures in view centered around the N-terminal trigger site.

[0028] FIG. 10A-10C. Structural insights of cytosolic BAX regulation mechanisms. A) Structural alignment of the BAX protomer:a9 complex and BAX monomer:BIM BH3 complex in ribbon representation showing 9 helix and BIM BH3 helix bound orientations to the N-terminal trigger site. The 1-2 loop in a closed conformation in the BAX protomer:a9 structure and open conformation in the BAX monomer:BIM BH3 structure. Cartoon representation of the B) BAX monomer:BIM BH3 interaction and C) BAX protomer:a9 interaction, highlighting key interacting residues in sticks. Color codes are indicated. Specifically, in the BIM BH3 bound structure (B) the hydrophobic surface of the BAX N-terminal trigger site, comprising residues A24, L25, L27 of 1 and L141, W139, G138, M137 of 6, forms extended hydrophobic interactions with conserved hydrophobic residues F159, 1155, L152, and A149 of BIM BH3 (also FIG. 11B). Additional stabilizing interactions occur between Q28 and Q32 of BAX and N160 of BIM BH3 and complementary charge interactions between residues K21, R134 and E131 of BAX and E158E, D157 and R153 of BIM BH3 (FIG. 10B and FIG. 11B). In the dimer BAX structure (C), residues A24, L25, Q28 and Q32 from 1 interact instead with residues Q52, V50 and D48 of the 1-2 loop of the same BAX molecule, generating an alterantive hydrophobic cavity formed from the positioning of 1 and the 1-2 loop, which facilitates the interaction with 9 residues I175 and F176 of the adjacent BAX molecule (also FIG. 11A). The closed 1-2 loop conformation also positions polar and charged residues of the loop to make stabilizing intermoleuclar interactions (C). These structural insights provide strong evidence that cytosolic BAX forms an autoinhibited dimer which occludes key interactions required for its activation and mitochondrial translocation.

[0029] FIG. 11A-11B. Structural differences of the BAX's N-terminal binding site bound to 9 (taken from BAX P168G dimer structure) and BIM BH3 (PDB ID: 2KW7) peptides provide structural insights of cytosolic BAX regulation. N-terminal surfaces of BAX shown in grey and hydrophobic (lighter grey), positively charged (K21, R134, and R145) and negatively charged (D48 and E131) residues of the BAX trigger site and 1-2 loop are highlighted. (A) BAX 9 binding with its hydrophobic residues make contacts with hydrophobic residues of the 1, 6 and 1-2 loop, maintaining the structure of BAX in inactive conformation and 1-2 loop in closed conformation. (B) BIM BH3 binding and its hydrophobic residues make contacts with hydrophobic residues of 1 and 6, ensuing a conformational change in 1-2 loop to an open conformation and change in the orientation of 1 and 6 residues. Furthermore, BIM BH3 has favorable electrostatic interactions with the charged residues of 1 and 6 at the periphery of the hydrophobic site.

[0030] FIG. 12. Structural analysis of the asymmetric BAX dimer crystal structure revealed two novel BAX interaction surfaces forming an autoinhibited dimer conformation. The C-terminal helix 9 of the BAX monomer binds with its solvent inaccessible surface the canonical BH3 pocket (9 helix on right) and with its solvent accessible surface the BH3 trigger site of another BAX molecule (9 helix* on left).

[0031] FIG. 13. A model of inactive BAX dimerization that regulates the BAX activation pathway triggered by select BH3-only proteins. Dimerization of inactive and cytosolic BAX provides an off pathway to BAX activation. Direct activation of BAX is initiated by direct interaction with BH3-only proteins and engagement of the trigger site (helices 1 and 6 indicated) of BAX monomers. Conformational change, mitochondrial translocation and autoactivation of BAX proceed and propagate BAX monomers to assemble an active dimer within the outer mitochondrial membrane and a homooligomeric pore to release key apoptogenic factors such as cytochrome c.

[0032] FIG. 14A-14B. The autoinhibited dimeric form of BAX dissociates to BAX monomer before is activated by high doses of the activator BIM SHAB. (A) Inactive BAX 4MA dimer is competed and dissociated to monomer by the trigger site binder, BIM SHAB, at high doses. Upon reduction of the internally crosslinked BAX 4MA mutant using 20 M DTT, BIM SHAB can activate the 4MA monomer to induce BAX oligomerization. Samples were analyzed by Superdex 75 (HR 10/30) gel filtration chromatography and quantified by integration of areas under observed monomer peaks. Data shown are representative of three independent experiments (B) Liposome permeabilization assay of purified BAX WT dimer and BAX P168G dimer upon treatment with increasing doses of BIM SAHB.sub.A. BAX P168G dimer is more resistant to activation by BIM SHAB compared to BAX WT. Notably, the doses that are required for BIM SHAB.sub.A to activate the BAX WT dimer are significantly higher than the dose used to fully activate the BAX WT monomer in FIG. 1. Bar graphs indicate maximum release at 90 min. Data are mean+SD from experiments performed in triplicate and repeated three times.

[0033] FIG. 15. Structure of the 9 helix peptide with labeled residues that interact with N-terminal binding site of BAX.

DETAILED DESCRIPTION OF THE INVENTION

[0034] A method is provided for identifying an agent as a candidate agent for promoting or inhibiting cell death comprising

[0035] (a) contacting the agent with BCL-2-associated X-protein (BAX) monomers or portions thereof, and/or with BAX dimers, and

[0036] (b) measuring if the agent inhibits or promotes dimerization of BAX;

[0037] wherein a decrease in binding of BAX monomers to other BAX monomers or to portions of BAX monomers in the presence of the agent compared to in the absence of the agent indicates the agent inhibits dimerization of BAX, wherein an agent that agent inhibits dimerization of BAX is a candidate agent for promoting cell death; and

[0038] wherein an increase in binding of BAX monomers or portions thereof to other BAX monomers or portions thereof in the presence of the agent compared to in the absence of the agent indicates that the agent promotes dimerization of BAX, wherein an agent that agent promotes dimerization of BAX is a candidate agent for inhibiting cell death.

[0039] The agent can bind to amino acid residues of the N-terminal binding site and/or C-terminal binding site of BAX. For example, the agent can bind to the N-terminal of BAX at one or more of binding site residues S16, E17, Q18, 119, M20, K21, T22, G23, A24, L25, L26, 127, Q28, G29, F30, I31, Q32, D33, R34, A35, G36, R37, M38, G39, G40, E41, A42, P43, E44, L45, A46, L47, D48, P49, V50, P51, Q52, D53, A54, V129, P130, E131, L132, I133, R134, T135, I136, M137, G138, W139, T140, L141, D142, F143, L144, R145, E146, and R147. Alternatively, or in addition, the agent can bind to the C-terminal of BAX at one or more of binding site residues N73, M74, E75, L76, D98, M99, F100, S101, D102, G103, N104, F105, N106, W107, G108, R109, I152, Q153, D154, Q155, G156, G157, W158, D159, G160, L161, L162, 5163, Y164, F165, G166, T167, P168, T169, W170, Q171, T172, V173, T174, I175, F176, V177, A178, G179, V180, L181, T182, A183, S184, L185, T186, I187, W188, K189 K190, M191, and G192.

[0040] In any of the methods disclosed herein, measurement of BAX as a dimer or monomer is carried out using one or more of a fluorescent polarization assay, size exclusion chromatography (SEC), polyacrylamide gel electrophoresis, dynamic light scattering, and an antibody that specifically binds to either BAX dimer or BAX monomer.

[0041] A method is also provided for identifying an agent that modulates the activity of BAX comprising

[0042] contacting 9 helix peptide of BAX with N-terminal binding site of BAX in the presence of the agent and in the absence of the agent; and

[0043] measuring binding between the 9 helix peptide of BAX and the N-terminal binding site of BAX, wherein decreased binding in the presence of the agent compared to binding in the absence of the agent indicates that the agent is a modulator of the activity of BAX.

[0044] In one embodiment, the agent is an inhibitor of BAX. Alternatively, the agent may be an activator of BAX.

[0045] The 9 peptide of BAX has the amino acid sequence TWQTVTIFVAGVLTASLTIWKKMG (SEQ ID NO:11). The 9 helix peptide of BAX is illustrated in FIG. 15. In different embodiments, the 9 helix peptide of BAX or the N-terminal binding site of BAX can be immobilized on a solid substrate. Binding between the 9 helix peptide of BAX and the N-terminal binding site of BAX can be measured, for example, using a fluorescence assay or a surface plasmon resonance assay or a co-immunoprecipitation assay or an NMR assay.

[0046] Methods are also disclosed for identifying an agent as a modulator of a BCL-2-associated X-protein (BAX) comprising contacting the agent with the BAX and measuring if the agent inhibits or promotes the dimerization of BAX with another BAX or portion thereof, wherein a decrease in binding in the presence of the agent compared to in the absence of the agent indicates that the agent inhibits dimerization of BAX and an increase in binding of BAX to another BAX molecule in the presence of the agent compared to the absence of the agent indicates that the agent promotes dimerization of BAX.

[0047] In any of the methods disclosed herein, the BAX can be a human BAX.

[0048] The agent can be, for example, a small molecule, an isolated peptide, a synthetic peptide, a peptide-based agent with natural or non-natural amino acids or combinations, a hydrocarbon stapled peptide, a constrained peptide, a macrocycle, a peptoid, a peptidomimetic, a foldamer, an aptamer, an antibody, a monobody, a nanobody, or combinations thereof. In an embodiment, an agent is a peptidomimetic of the 9 helix of BAX.

[0049] In an embodiment of the methods described herein, the agent is a small molecule of 2000 daltons or less. In an embodiment of the methods described herein, the agent is a small molecule of 1500 daltons or less. In an embodiment of the methods described herein, the agent is a small molecule of 1000 daltons or less. In an embodiment of the methods described herein, the agent is a small molecule of 800 daltons or less. In an embodiment of the methods described herein, the agent is a small molecule of either 2000, 1500, 1000, 800, 700, 600, 500 or 400 daltons or less. In an embodiment of the methods described herein, the agent is a small organic molecule.

[0050] The methods disclosed herein can further comprise administering an agent identified as promoting dimerization of BAX or as inhibiting BAX to a subject with a disease or disorder associated with premature or unwanted cell death and characterized by abnormal activation, expression or function of BAX, and testing the efficacy of the agent in treating the disease. The methods can further comprise administering an agent identified as inhibiting dimerization of BAX or as activating BAX to a subject with a cancer and testing the efficacy of the agent in treating cancer.

[0051] Also provided are the following peptides that interact with the N-terminal binding site of BAX:

TABLE-US-00002 (SEQIDNO:11) 1. [00001]embedded image (correspondsto9ofBAX) (SEQIDNO:12) 2. [00002]embedded image (SEQIDNO:13) 3. [00003]embedded image (SEQIDNO:14) 4. [00004]embedded image
Highlighted amino acid residues interact with the N-terminal binding site of BAX. Other residues that do not interact with the N-terminal binding site of BAX can be mutated to any residue but the peptide sequences can still have binding and inhibitory function. Accordingly, the invention provides a peptide of 11-30 amino acid residues comprising the sequence: TXQTXXIFXAG (SEQ ID NO:15) where X at any position can independently be any amino acid or unnatural amino acid. In one embodiment, the peptide of 11-30 amino acid residues comprising the sequence TXQTXXIFXAG (SEQ ID NO:15) does not include any of SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13 and SEQ ID NO:14. The invention also provides a peptide of 15-30 amino acid residues comprising the sequence: TXQTXXIFXAGVXTA (SEQ ID NO:16) where X at any position can independently be any amino acid or unnatural amino acid. In one embodiment, the peptide of 15-30 amino acid residues comprising the sequence TXQTXXIFXAGVXTA (SEQ ID NO:16) does not include any of SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13 and SEQ ID NO:14. The invention also provides a peptide of 11-30 amino acid residues comprising the sequence Y1XY2Y3XXY4Y5XY6Y7 (SEQ ID NO:17), where Y1 is threonine or a conserved amino acid, or unnatural amino acid, Y2 is glutamine or a conserved residue or unnatural amino acid, where Y3 is threonine or a conserved amino acid, or unnatural amino acid, where Y4 is isoleucine or a conserved amino acid, or unnatural amino acid, where Y5 is phenylalanine or a conserved amino acid, or unnatural amino acid, where Y6 is alanine or a conserved amino acid, or unnatural amino acid, where Y7 is glycine or a conserved amino acid, or unnatural amino acid, where X at any position can independently be any amino acid, or natural or unnatural chemically modified amino acid. Preferably at least one X or one Y in each sequence is an unnatural amino acid or a non-naturally occurring chemically modified amino acid. By, e.g., 11-30 amino acids, it is meant any number of amino acids between 11-30, i.e., 11, 12, 13, 14, . . . 29, or 30 amino acid residues. In one embodiment, the peptide consists of the sequence TXQTXXIFXAG (SEQ ID NO:15) or the sequence TXQTXXIFXAGVXTA (SEQ ID NO:16). In different embodiments, the interacting residues could be also mutated to conserved or similar residues that will maintain the interaction with BAX. In different embodiments, the peptides can be labeled with a label such as a fluorescent label or a radioactive label. In one embodiment, the peptides claimed herein are chemically synthesized peptides or peptides produced by recombinant DNA or cDNA. For example, the peptides can be made by liquid phase synthesis or by solid phase synthesis. The peptides can be synthesized, e.g., using recombinant DNA or cDNA. In one embodiment, the peptides are not directly obtained from a larger naturally-occurring BAX protein, for example, by digestion of the protein. In one embodiment, the peptides are isolated and purified peptides.

[0052] Methods are provided for inhibiting BAX comprising contacting BAX with the any of the peptides disclosed herein. The BAX can be in a living cell where preferably inhibition of BAX inhibits cell death. The BAX can in a subject, such as a mammal such as a human, and the agent is administered to the subject. The subject can have a disease or disorder associated with premature or unwanted cell death and characterized by abnormal activation, expression or function of BAX.

[0053] Diseases and disorder associated with premature or unwanted cell death and characterized with abnormal activation, expression or function of BAX include, for example, cardiovascular diseases and disorders (e.g. arteriosclerosis, heart failure, heart transplantation, aneurism, chronic pulmonary disease, ischemic heart disease, hypertension, thrombosis, cardiomyopathies), neurodegenerative and neurological diseases and disorders (e.g. Alzheimer's disease, Parkinson's disease, Huntington's disease, retinitis pigmentosa, spinal muscular atrophy, various forms of cerebellar degeneration, amyotrophic lateral sclerosis), liver diseases and disorders, kidney diseases and disorders, immunological disorders (e.g. organ transplant rejection, arthritis, lupus, IBD, Crohn's disease, asthma, multiple sclerosis, diabetes), ischemia (e.g. stroke, myocardial infarction and reperfusion injury), infertility (e.g. premature menopause, ovarian failure or follicular atresia), blood disorders (e.g. fanconi anemia, aplastic anemia, thalassemia, congenital neutropenia, myelodysplasia), renal hypoxia, hepatitis, asthma and AIDS. Diseases associated with inhibition of cell death and characterized by abnormal inhibition, expression or function of BAX include, for example, cancer and autoimmune diseases.

[0054] Method are also provided for identifying an agent as a candidate agent for inhibiting cell death comprising:

[0055] contacting BCL-2-associated X-protein (BAX) with one or more of any of the peptides disclosed herein in the presence of the agent and in the absence of the agent, and

[0056] measuring binding of the one or more peptides to BAX,

[0057] wherein decreased binding of the one or more peptides to BAX in the presence of the agent compared to binding of the one or more peptides to BAX in the absence of the agent indicates that the agent is a candidate agent for inhibiting cell death. In one embodiment, the peptides are fluorescently labeled, for example with fluorescein isothiocyanate (FITC).

[0058] As used herein, BAX is BCL-2-associated X-protein. In an embodiment, the BAX is mammalian. In a preferred embodiment, the BAX is a human BAX. In an embodiment, the BAX comprises consecutive amino acid residues having the following sequence:

TABLE-US-00003 (SEQIDNO:1) MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPV PQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFERVAADME SDGNENWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLG WIQDQGGWDGLLSYEGTPTWQTVTIEVAGVLTASLTIWKKMG.

[0059] In an embodiment of the methods described herein, the methods are useful for identifying therapeutic cell death inhibitors. In an embodiment of the methods described herein, the methods are useful for identifying therapeutic cell death activators.

[0060] All combinations of the various elements described herein are within the scope of the invention unless otherwise indicated herein or otherwise clearly contradicted by context.

[0061] This invention will be better understood from the Experimental Details, which follow. However, one skilled in the art will readily appreciate that the specific methods and results discussed are merely illustrative of the invention as described more fully in the claims that follow thereafter.

EXPERIMENTAL DETAILS

Materials and Methods

[0062] ReagentsHydrocarbon-stapled peptide corresponding to the BH3 domain of BIM, BIM SAHB.sub.A2: N-acetylated .sup.145EIWIAQELRS5IGDS5FNAYYA.sup.164-CONH.sub.2 (SEQ ID NO:2), where S5 represents the non-natural amino acid inserted for olefin metathesis, was synthesized, purified and characterized as previously described by CPC Scientific (11).

[0063] Production of recombinant BAXHuman BAX wild type and mutants were generated using a standard PCR-based cloning strategy and PCR-based site-directed mutagenesis in pTYB1 vector (New England Biolabs) and constructs were confirmed by sequencing. Recombinant proteins are expressed in BL21 (DE3) codon+E. coli strain and purified as previously described (16).

[0064] Size-Exclusion ChromatographySuperdex 75 10/300 GL and 200 10/300 GL (GE Healthcare) columns were used for size exclusion chromatography of recombinant proteins and cell extracts. Recombinant protein was injected in columns equilibrated with a buffer containing 20 mM HEPES pH 7.2, 150 mM KCl, 1 mM DTT. 1 mg of cytosolic or membrane extracts was applied to a Superdex 200 10/300 GL equilibrated in buffer containing 10 mM Tris, pH 7.5, 1 mM EGTA, 200 mM Sucrose and Complete Protease Inhibitors. Fractions of 500 l were collected, and 30 l of each fraction was analyzed by SDS-PAGE and immunoblotting. All operations were run at 4 C. Gel filtration molecular weight markers (GE Healthcare) were also subjected to the columns to obtain a standard curve for the estimation of the molecular weight of the proteins.

[0065] Dynamic Light-ScatteringThe dynamic light scattering of various samples was measured using a DynaPro801 instrument from Wyatt Technology and DYNAMICS v.5.25.44 software for data collection and analysis. The protein samples after elution from the size-exclusion chromatography were centrifuged for 10 min at 13,000 rpm and loaded to plastic cuvettes. Typically, one hundred scans of five seconds was acquired for each 100 l sample. Normalized intensity versus hydrodynamic radius (nm) measured in 20 mM HEPES pH 7.2, 150 mM KCl, 1 mM DTT buffer.

[0066] CrystallizationHomogeneous BAX protein in 20 mM HEPES pH 7.2, 150 mM KCl, 1 mM DTT buffer was concentrated to 10 mg/ml using a filtration unit (Milipore). Initial screening of crystallization conditions for BAX wild type and mutants were carried out by the sitting-drop vapor-diffusion method using 96-well Intelli-Plates (Hampton Research) at 293 K. The BAX protein was concentrated to 10 mg/ml in 20 mM HEPES pH 7.2, 150 mM KCl, 1 mM DTT and centrifuged prior to crystallization setup. Diffraction quality rod-shaped crystals were generated in 0.1 M Bis-Tris pH 6.5, 1.5 M ammonium sulfate via the hanging-drop vapour-diffusion method using 24-well VDX plates (Hampton Research). 1 l of protein solution and reservoir solution were mixed and equilibrated against 1 ml of reservoir solution. Crystals were cryoprotected by soaking for 5 s in 20 l of cryoprotectant solution containing 0.1 M Bis-Tris pH 6.5, 1.5 M ammonium sulphate and 25% (v/v) glycerol, and flash-frozen in liquid nitrogen.

[0067] Data collection and structure determinationX-ray diffraction data were collected at beamlines in National Synchrotron Light Source and Advanced Photon Source. All data were integrated and scaled with HKL2000 (19) and further processing was carried out with CCP4 software suite (20). The crystal structure of BAX was determined by molecular replacement method using the monomeric NMR structure of BAX (PDB ID: 1F 16) as a search model. Model was mutated to poly Ala. Multiple cycles of manual editing and adjustment of the model using COOT (21) followed refinement by simulated annealing, energy minimizations and individual isotropic B factor refinement with REFMAC (22). A break chain of the loop between helices 1 and 2 was realized due to poor diffraction data at the model building stage. The final models were validated with PROCHECK (23), PISA (24) and molecular models were rendered using PYMOL (25). Data collection and statistics are summarized in Table 2.

[0068] NMR samples and spectroscopyProtein samples were prepared in 25 mM sodium phosphate, 50 mM NaCl solution at pH 6.0 in 5% D.sub.2O. Correlation .sup.1H-.sup.15N HSQC, .sup.1H-.sup.15N TROSY spectra and triple resonance spectra for backbone .sup.1H, .sup.13C, .sup.15N assignments of BAX P168G monomer: HNCO, HNCA, HNCOCA, HNCACB, HNCOCACB and N.sup.15 NNH-NOESY were acquired at 25 C. on a Inova 600 MHz NMR spectrometer equipped with a cryogenic probe, processed using Topsin, and analyzed with CCPNMR (26). BAX wild type cross-peak assignments were applied as previously reported (11,16). The weighted average chemical shift difference A at the indicated molar ratio was calculated as (H.sup.1).sup.2+(N.sup.15/5).sup.2 in p.p.m. The absence of a bar indicates no chemical shift difference, or the presence of a proline or a residue that is overlapped and not used in the analysis. The significance threshold for backbone amide chemical shift changes was calculated based on the average chemical shift across all residues plus the standard deviation, in accordance with standard methods.

[0069] BAX dimerization assaysBAX wild type and mutants were concentrated to 0.5 mM in BAX buffer (10 mM HEPES pH 7, 150 mM KCl, 1 mM DTT) and incubated at 20 C. for 1-3 days before diluting to a total volume of 250 l and loaded onto a Superdex 75 HR 10/30 size exclusion column (GE Healthcare). These conditions allow a controlled dimerization process than aggregation due to BAX activation. Separation of monomeric and dimeric BAX was achieved using a flow rate of 0.5 ml/min at 4 C. The chromatogram traces show the monomeric and dimeric peaks at 11.8 and 10.4 ml, respectively. Protein standards (GE Healthcare) were used to calibrate the molecular mass of gel filtration peaks. Chromatogram traces are representative of several independent preparations of freshly SEC-purified monomeric BAX.

[0070] BAX crosslinkingDimerization was detected using a crosslinking approach by incubating BAX at indicated doses with 20 BMH on ice for 15 min followed by quenching with 1 mM DTT. Samples were denatured at 90 degrees and analyzed with SDS-PAGE.

[0071] Liposomal permeabilization assayLiposomes were composed of the following molar percentages of lipids (Avanti Polar Lipids): phosphatidylcholine, 48%; phosphatidylethanolamine, 28%; phosphatidylinositol, 10%; dioleoyl phosphatidylserine, 10%; and tetraoleoyl cardiolipin, 4% and were loaded with ANTS/DPX (Molecular Probe) upon extrusion. BAX (400 nM) was combined with BIM SAHB.sub.A2 at the indicated concentrations in 96-well format (Corning) and then liposomes were added (10 l from 50 mM total lipid stock) in assay buffer (10 mM HEPES, pH 7, 200 mM KCl, 5 mM MgCl.sub.2, and 0.2 mM EDTA) to a final volume of 100 l. ANTS/DPX release was quantified based on the increase in fluorescence intensity that occurs when the ANTS fluorophore is separated from the DPX quencher upon release from the liposomes into the supernatant. Fluorescence (.sub.ex=355 nm and .sub.em=520 nm) was measured over time at 30 C. using a Tecan Infinite M1000 plate reader. The percentage release of ANTS/DPX at 90 min was calculated as percentage release=((FF.sub.0)/(F.sub.100F.sub.0))100, where F.sub.0 and F.sub.100 are baseline and maximal fluorescence, respectively. 1% Triton treatment is used to determine the maximum amount of liposomal release per assay, and this value sets the 100% value.

[0072] Cell culture, cell transfection and apoptosis assayWild type MEFs and SV40-transformed Bax.sup./ Bak.sup./ (DKO) MEFs were maintained in DMEM high glucose (Invitrogen) supplemented with 10% FBS, 100 Ul.sup.1 penicillin/streptomycin, 2 mM 1-glutamine, 0.1 mM MEM nonessential amino acids, and 50 M -mercaptoethanol. Reconstitution of BAX and BAX mutant into DKO cells was achieved by retroviral transduction of BAX-IRES-GFP or BAX(P168G)-IRES-GFP plasmids, followed by MoFlo sorting for GFP-positive cells. The production of retroviruses was performed as described previously (17). Comparable expression of BAX WT and mutant protein was confirmed by western analysis. For staurosporine treatment, MEFs (510.sup.4 per well) were seeded in six-well clear-bottom plates for 16-18 hours in serum-containing media and then treated with 1 M staurosporine. For transient retroviral transduction of BAX or BAX mutant, DKO MEFs were infected with retrovirus expressing BAX or BAX mutant for 30-36 hours. Cell death was quantified by annexin-V (BioVision) staining. Flow cytometry was performed using a LSRFortessa (BD Biosciences) and data were analyzed using FACSDiva (BD Biosciences). The expression of BAX or BAX mutant was assessed by anti-BAX western blot. P values for statistical analyses were obtained using Student's t test.

[0073] Subcellular fractionationMEFs were maintained in DMEM (Invitrogen) supplemented with 10% FBS, 100 U ml.sup.1 penicillin/streptomycin, 2 mM 1-glutamine, 0.1 mM MEM nonessential amino acids, and 50 M -mercaptoethanol. MEFs (2010.sup.6 per well) were seeded in a 150 mm dish for 12 hours. To isolate cytosol and mitochondrial fractions, cells were lysed by Dounce homogenizer in lysis buffer LB containing 10 mM Tris, pH 7.5, 1 mM EGTA, 200 mM Sucrose and Complete Protease Inhibitors. The cell lysates were centrifuged at 700g for 10 min to remove unlysed cells and nuclei. The supernatants were centrifuged at 12000g for 10 min at 4 C. and the resulting pellet was collected as the mitochondrial fraction. The membrane pellet was resuspended in LB+1% CHAPS.

[0074] Western Blotting20 g of whole-cell protein was electrophoretically separated on 4-12% NuPage (Invitrogen) gels, transferred to Immobilon-FL PVDF membranes (Millipore) and subjected to immunoblotting. For visualization of proteins with Odyssey Infrared Imaging System (LI-COR Biosciences) membranes were blocked in PBS containing 2.5% milk powder. Primary BAX antibody (Cell Signaling 2772S) was incubated overnight at 4 C. in a 1:1,000 dilution. After washing, membranes were incubated with an IRdye800-conjugated goat anti-rabbit IgG secondary antibody (LI-COR Biosciences) in a 1:5,000 dilution. Proteins were detected with Odyssey Infrared Imaging System.

[0075] BAX conformational change assayCytosolic fractions were subjected to immunoprecipitation followed by immunoblotting against total BAX. Briefly, 100-300 g total protein was collected and incubated with pre-equilibrated protein G Sepharose beads (Santa Cruz Biotechnology Inc.) for 1 hour. The precleared samples were then incubated with the 6A7 antibody (6 g/ml) (1:1,000, sc-23959, Santa Cruz Biotechnology) for four hours at 4 C. followed by the addition of pre-equilibrated protein G Sepharose beads for 1 hour. The beads were pelleted, washed with lysis buffer 3 times at 4 C., and protein eluted by heating the beads at 90 C. for 10 minutes in LDS/DTT loading buffer. The immunoprecipitates were subjected to electrophoresis and Western blot analysis using anti-BAX antibody (1:1,000) (Cell Signaling 2772S).

Results

[0076] The current invention makes use of the discovery that cytosolic BAX forms a dimeric autoinhibited form that is mediated by the N-terminal trigger site of one protomer and a novel interacting C-terminal surface that includes 9 of the second protomer. These interacting protein surfaces of BAX provide important insights for understanding the structural basis of BAX inhibition and designing drugs for pharmacological modulation of BAX. It was found that monomeric wild type BAX (BAX WT), in the absence of a BH3 activating domain, reversibly forms a dimer over time as measured by size exclusion chromatography (SEC) and polyacrylamide gel electrophoresis (PAGE). A single point mutation such as P168G in the 8-9 loop of BAX, which controls helix 9 mobilization, generates the identical dimeric peak by SEC. BAX P168G forms a more stable dimer, which persists several days at room temperature.

[0077] The conformations of recombinant BAX and cytosolic BAX from mouse embryonic fibroblasts (MEFs) were investigated. Recombinant full-length BAX was purified from E. coli extracts using chitin affinity chromatography followed by size-exclusion chromatography (SEC) (17). Recombinant BAX elutes from SEC predominantly in a peak that corresponds to its monomeric form (11,17) and additionally in a second distinct peak that corresponds to a dimeric form (FIG. 1A, 1B). Cultured MEFs were lysed, without detergents in the buffer, and cytosolic and mitochondrial fractions were separated followed by fractionation with SEC. Surprisingly, endogenous BAX eluted in fractions that corresponds to a BAX dimer using the same SEC conditions for recombinant BAX (FIG. 1B). Next, SEC was repeated with MEFs that are doubly deficient in BAX.sup./ and BAK.sup./ (DKO MEFs) and stably express human BAX at endogenous levels, and again cytosolic BAX appeared to be a dimer (FIG. 1B). To exclude the possibility that cytosolic BAX is a heterodimer with anti-apoptotic BCL-2 proteins in the cytosol, cytosolic and mitochondrial fractions were subjected to western blot analysis, confirming that anti-apoptotic proteins are in very low levels in the cytosol compared to BAX and predominantly reside at the mitochondria (FIG. 5). Furthermore, the cytosolic BAX dimer is in inactive conformation as proved by immunoprecipitation analysis using the 6A7 antibody that only recognizes the active BAX conformation (FIG. 6) (18). However, when cytosolic BAX was treated with a detergent that promotes its activation, BAX appeared predominantly at high molecular weight, presumably forming the BAX oligomer. In addition, a minor portion eluted as BAX monomer, suggesting that BAX activation requires disruption of the BAX dimer conformation (FIG. 1B). Taken together, these results demonstrate that cytosolic BAX predominantly adopts a dimeric and inactive conformation.

[0078] To elucidate the physiological role of the cytosolic BAX dimer conformation, the molecular basis of BAX dimerization was investigated. First, a method to reproducibly generate sufficient amounts of the BAX dimer was established by incubation of the BAX monomer at high concentrations as shown by SEC or treatment with the BMH crosslinker followed by polyacrylamide gel electrophoresis (FIGS. 1C, 7). The monomeric and dimeric peaks of SEC were confirmed by dynamic light scattering to correspond to homogenous populations of BAX monomer (21KD) and dimer (42KD) respectively (Table 1). In liposomal assay, while the BAX monomer is not able to permeabilize membranes alone, it was activated and induced membrane permeabilization upon activation by the hydrocarbon-stapled BIM BH3 helix, BIM SAHB.sub.A2, (FIG. 1D) (11,12). In contrast, SEC-isolated BAX dimer alone showed no capacity to induce membrane permeabilization in liposomal permeabilization assays and upon addition of BIM SAHB.sub.A2 it was nearly inactive (FIG. 1D). Therefore, the BAX dimer conformation is inactive and resistant to activation compared to monomeric BAX suggesting that the BAX dimer may form an autoinhibited conformation.

[0079] X-ray crystallographic studies were performed to gain further insights into the inactive BAX dimer. The stability of the SEC dimer peak was monitored with wild type BAX and mutants to predict successful crystallization. Quality of crystals for diffraction was better with mutants that produce more stable dimer than wild type BAX. The BAX P168G mutant, which does not alter the structure of BAX but reduces the dynamics of the 8-9 loop, successfully produced crystals and a native X-ray data set was obtained to a resolution of 1.9 . The crystal structure was solved and refined by a molecular replacement approach using the NMR structure of full-length BAX as a search model (Table 2). The asymmetric unit contained two BAX molecules with excellent electron density map, in which all BAX residues could be traced except from residues of the N-terminal unstructured region (residues 1-13) and four residues of the unstructured loop between helices 1 and 2 (residues 37-40) (FIG. 2). The dimerization interface is formed by conserved residues and is extensive, burying almost 1900 .sup.2 surface area (FIGS. 2A and 8). Remarkably, the BAX dimer structure reveals a dimerization interface that includes the interaction of two structural surfaces critical for the activation of BAX; the N-terminal trigger site from one BAX protomer and a novel C-terminal surface from the second BAX protomer that includes the C-terminal 9 helix (FIGS. 2B, 14). Of note, this dimeric structure and dimerization interface is irrelevant of the BAX P168G mutant as a BH3 residue mutant, G67R, that introduces a new hydrogen bond with helix 1, yields the same asymmetric dimer conformation as determined by X-ray crystallography at resolution of 3.3 (FIG. 9, Table 2).

[0080] The BAX protomers within the asymmetric BAX dimer structure resemble the inactive monomeric BAX structure determined by solution NMR, however, they have noticeable differences in orientation of helices and conformation of loops (backbone r.m.s.d. of 2.1 ) (17). Most pronounced differences correspond to residues located in the N-terminal trigger site surface, including helices 1, 6, 2 and 1-2 loop. Furthermore, the comparison with the structure of full length BAX bound to the BIM BH3 helix (backbone r.m.s.d. 3.0 ) (11) indicates that, in the asymmetric dimer, the 1-2 loop is in a closed conformation, forming specific intramolecular contacts with helices 1 and 6, whereas the BIM BH3-bound BAX structure has the 1-2 loop in an open and active conformation (11,12). Therefore, the structural analysis indicates that the asymmetric dimer structure contains two BAX molecules in distinct but inactive conformation in agreement with the evidence of the cytosolic inactive BAX dimer (FIG. 1).

[0081] The asymmetric BAX dimer conformation highlights two novel interaction surfaces of BAX (FIG. 3). The interaction surface of one BAX protomer includes mostly the BAX trigger site residues previously identified for binding to BIM SAHB.sub.A2 with a number of additional interactions at its periphery (11). Moreover, the interaction site at the C-terminal surface is a novel and unforeseen binding surface of BAX that includes the C-terminal helix 9. The C-terminal binding surface has a hydrophobic center from solvent exposed hydrophobic residues of 9 that are surrounded by polar and charged residues of helices 8, 7, 3, the 4-5 loop and the 8-9 loop (FIG. 3A). The N-terminal binding surface has a hydrophobic center from solvent exposed hydrophobic residues of 1, 6 and the 1-2 loop that are surrounded by charged residues, which complement charged residue of the C-terminal binding surface (FIG. 3A). The core of the dimerization interface is hydrophobic (FIG. 3B,C). Several residues form a network of hydrophobic interactions that complement the binding of helix 9 to the N-terminal BH3-binding site (FIG. 3C). However, a number of hydrogen bonds and salt bridges contribute to the dimer formation and stability (FIG. 3B, D, E). Thus, hydrophobic, polar interactions and salt bridges are involved in the extensive and highly complementary dimerization interface.

[0082] Upon BH3 binding to the N-terminal trigger site, the 1-2 loop is displaced into an open conformation, a conformational change essential for exposure of the 6A7 epitope (residues 12-24) and BAX activation (11,12,17,18) (FIG. 10A). In contrast, in the dimer BAX structure, 9 binds the N-terminal BH3-binding site in an orientation that preserves the conformation of the 1-2 loop in a closed and inactive conformation (FIG. 10A). Specifically, BIM BH3 binding is mediated by exposed hydrophobic residues of 1 and 6, with conserved hydrophobic residues of BIM BH3 (FIG. 10B, 11A). However in the dimer BAX structure, many of these 1 residues are buried and interact instead with residues of the 1-2 loop of the same BAX protomer. This generates an alternative hydrophobic cavity formed from the positioning of 1 and the 1-2 loop, which facilitates the interaction with hydrophobic residues of 9 (FIG. 10C). This closed 1-2 loop conformation also positions polar and charged residues of the loop to make stabilizing intermolecular hydrogen bonds (FIGS. 10C, 11B). Therefore, these novel interactions within the 1/6 site and 1-2 loop stabilize an inactive BAX conformation, block access to the BAX trigger site as well as maintaining helix 9 in place within its own hydrophobic pocket (FIG. 12). These structural insights provide strong evidence that cytosolic BAX forms an autoinhibited dimer that occludes key interactions required for its activation and mitochondrial translocation.

[0083] To confirm the dimerization interface in the crystal structure and that the BAX dimer observed in solution is not the domain-swapped dimer previously reported for truncated BAX C21 (13), use was made of an internally cross-linked mutant (C62S, C126S, V121C, I136C) termed 4MA, which is resistant to activation and incapable of forming the domain-swapped dimer as previously reported (13). Expectedly, BAX 4MA retains the ability to form the BAX dimer since these mutations preserve the inactive conformation as in the BAX WT structure (FIG. 4A). Consistent with the dimer crystal structure, mutations in residues forming key interactions at the dimerization interface, E75K and T172K or S184L, which destabilizes the interaction of 9 with the BH3 groove, disrupt dimer formation (FIG. 4A). Next, it was tested whether a N-terminal trigger site binder, BIM SHAB.sub.A, can compete and dissociate the dimer. An isolated BAX 4MA dimer was incubated with or without increasing amounts of BIM SHAB.sub.A. The results show that BIM SHAB.sub.A at high doses can compete and dissociate the dimer into monomers (FIG. 14A). Furthermore, in the presence of a reducing agent (DTT), which reduces the internally cross-linked BAX 4MA mutant, the BIM SHAB.sub.A can also activate BAX 4MA monomer to induce BAX oligomerization. These biochemical data further validate the autoinhibited dimeric BAX as a mechanism to suppress activation by the BH3-only proteins.

[0084] To investigate the physiological role of the BAX dimerization mechanism, an investigation was undertaken of the capacity of BAX WT and mutants to form the autoinhibited dimer and regulate BAX activation. DKO MEFs was reconstituted with BAX WT and mutants at physiological expression levels. P168G mutant forms a more stable autoinhibited dimer than BAX WT (FIG. 4A, FIG. 14B) whereas E75K and S184L mutants disrupt BAX dimerization (FIG. 4A). In agreement with this, both BAX WT and BAX P168G proteins form only dimers in the cytosol; however, the BAX E75K and BAX S184L form monomers in the cytosol (FIG. 4B). Strikingly, constitutive expression of BAX mutants with monomeric BAX showed significantly increased activity in cell death induction compared to BAX WT (FIG. 4C). In contrast, the BAX P168G mutant cells with a more stable cytosolic dimer have impaired activity compared to BAX WT (FIG. 4C). Moreover, upon staurosporine treatment, BAX P168G dimer was more resistant to undergo translocation and oligomerization in the outer mitochondrial membrane compared to BAX WT (FIG. 4D). However, upon staurosporine treatment, monomeric BAX E75K and S184L undergo faster activation and transformation to an oligomer at the outer mitochondrial membrane than the corresponding BAX WT dimer (FIG. 4D). Taken together, the data indicate that cytosolic BAX may switch its conformation from the autoinhibited dimer to a monomer and that monomeric BAX favors faster BAX activation and more potent cell death activity while the dimeric BAX hinders BAX activation and ultimately cell death activity.

[0085] During initiation of apoptosis, cytosolic BAX is activated through an interaction of activator BH3-only proteins with the N-terminal trigger site, followed by the N-terminal conformational change and the displacement of 9 from its C-terminal hydrophobic groove, in order to translocate to the mitochondria Moreover, mitochondrial attached BAX with the 9 displaced from its hydrophobic groove undergoes N-terminal conformational change upon further activation by activator BH3-only proteins (13). Regardless of the step of BAX activation, conformational changes at the N-terminal and C-terminal surfaces are required for complete BAX activation leading to membrane permeabilization. The work herein suggests that cytosolic BAX forms an autoinhibited dimer conformation to prevent either the N-terminal or C-terminal conformational change in each protomer and maintain BAX activation under control (FIG. 13). Induction of apoptosis in a cell should require commitment of pro-apoptotic signals (e.g. BH3-only proteins) beyond stochastic fluctuations of their expression levels or active state; therefore, BAX autoinhibition provides a mechanism for blocking BAX activation and preventing unwanted apoptosis. Finally, these structural and functional insights have important implications for the development of pharmacological modulators that engage either the N-terminal site or the C-terminal site to modulate apoptosis in diseases characterized by excessive cell death or survival (2,3).

TABLE-US-00004 TABLE 1 Representative dynamic light scattering data of BAX monomer and dimer from size-exclusion chromatography elution peaks. BAX Monomer Dimer Radius/nm 2.730 2.955 Molecular Weight 22 41 Polydispersity/% 6.8 3.2 Mass fraction/% 97.0 98.5

TABLE-US-00005 TABLE 2 Structural statistics of data collection and refinement. Data Collection Protein BAX P168G BAX G67R Beamline BNL (X29) APS (23IDD) Space group P2.sub.1 P2.sub.1 Molecule in asymmetric 2 2 unit Resolution () 50.0-1.90 (1.93-1.90) 50.0-3.31 (3.31-3.25) Cell Dimensions a, b, c () 63.65, 40.27, 65.30 40.58, 65.01, 65.59 , , () 90.0, 90.01, 90.0 90.0, 89.8, 90.0 No. unique observations 26198 4866 Completeness (%) 98.5 (100) 89.8 (78.3) R.sub.sym.sup. 0.06 (0.65) 0.13 (0.18) I/ (I) 22.1 (2.3) 26.4 (13.4) Redundancy 4.6 3.0 (2.7) Refinement Resolution () 19.1-1.90 46.1-3.30 Reflections 24766 4484 Completeness (%) 98.6 90.1 Number of atoms 2754 2756 Solvent atoms 124 n/a R.sub.work 0.20 0.22 R.sub.free 0.23 0.26 R.m.s. deviations Bond lengths () 0.008 0.014 Bond angles () 1.21 1.42 B-factors (.sup.2) Overall 34.7 59.1 Main chain 32.5 58.5 Side chain 36.6 59.5 Water 40.6 n/a Ramachandran plot (%) most favorable region 98 90 additionally allowed 2 10 region Numbers in parentheses are for the highest resolution shell. .sup.R.sub.sym = (I <I>)/<I>, where I is the intensity measurement for a given refraction and <I> is the average intensity for multiple measurements of this refraction.

REFERENCES

[0086] 1. N. N. Danial, S. J. Korsmeyer, Cell 116, 205 (2004). [0087] 2. R. W. Johnstone, A. A. Ruefli, S. W. Lowe, Cell 108, 153 (2002). [0088] 3. D. E. Bredesen, R. V. Rao, P. Mehlen, Nature 443, 796 (2006). [0089] 4. R. J. Youle, A. Strasser, Nat. Rev. Mol. Cell. Biol. 9, 47-59 (2008). [0090] 5. J. E. Chipuk, et al., Mol. Cell. 37, 299-310, (2010). [0091] 6. K. G. Wolter, et al., J. Cell Biol. 139, 1281-1292 (1997). [0092] 7. I. S. Goping, et al., J. Cell Biol. 143, 207-215 (1998). [0093] 8. A. Nechushtan, C. L. Smith, Y. T. Hsu, R. J. Youle, EMBO J. 18 2330-2341 (1999). [0094] 9. M. C. Wei et al., Science 292, 727 (2001). [0095] 10. S. W. Tait, D. R. Green, Cold Spring Harb. Perspect. Biol. 5, (2013). [0096] 11. E. Gavathiotis et al., Nature 455, 1076 (2008). [0097] 12. E. Gavathiotis et al., Mol. Cell 40, 481 (2010). [0098] 13. P. E. Czabotar, et al., Cell 152, 519-531 (2013). [0099] 14. G. Lessene, P. E. Czabotar, P. M. Colman, Nat. Rev. Drug Disc. 7, 989 (2008). [0100] 15. E. Gavathiotis et al., Nat. Chem. Bio. 8, 639 (2012). [0101] 16. M. Suzuki, R. J. Youle, N. Tjandra, Cell 103, 645 (2000). [0102] 17. H. Kim et al., Mol. Cell 36, 487 (2009). [0103] 18. Y. T. Hsu, R. J. Youle, J. Biol. Chem. 272, 13829 (1997). [0104] 19. Z. Otwinowski, W. Minor, Methods Enzymol. 276, 307-326 (1997). [0105] 20. Collaborative Computational Project, Acta Crystallogr D Biol Crystallogr 50, 760-3, (1994). [0106] 21. P. Emsley, K. Cowtan, Acta Crystallogr D Biol Crystallogr 60, 2126-2132, (2004). [0107] 22. M. D. Winn, G. N. Murshudov, M. Z. Papiz, Methods Enzymol. 374, 300-321, (2003). [0108] 23. Laskowski, R. A., et al., Journal of Biomolecular NMR 8, 477-486 (1996). [0109] 24. E. Krissinel, K. Henrick, J. Mol. Biol. 372, 774-797. (2007). [0110] 25. W. L. DeLano, DeLano Scientific, San Carlos, Calif., USA (2002). [0111] 26. Vranken, W. F., et al., Proteins 59, 687-696, (2005).