TARGETING DIMERIZATION OF BAX TO MODULATE BAX ACTIVITY
20170114100 ยท 2017-04-27
Assignee
Inventors
Cpc classification
C07K14/00
CHEMISTRY; METALLURGY
A61P43/00
HUMAN NECESSITIES
G01N2500/04
PHYSICS
G01N2500/02
PHYSICS
A61P35/00
HUMAN NECESSITIES
International classification
C07K14/00
CHEMISTRY; METALLURGY
Abstract
Methods are provided for identifying an agent that directly modulates a Bcl-2- associated x-protein (BAX) by promoting or disrupting dimerization of the BAX. Agents that directly modulate BAX by affecting dimerization are also provided.
Claims
1. A method of identifying an agent as a candidate agent for promoting or inhibiting cell death comprising (a) contacting the agent with BCL-2-associated X-protein (BAX) monomers or portions thereof, and/or with BAX dimers, and (b) measuring if the agent inhibits or promotes dimerization of BAX; wherein a decrease in binding of BAX monomers to other BAX monomers or to portions of BAX monomers in the presence of the agent compared to in the absence of the agent indicates the agent inhibits dimerization of BAX, wherein an agent that agent inhibits dimerization of BAX is a candidate agent for promoting cell death; and wherein an increase in binding of BAX monomers or portions thereof to other BAX monomers or portions thereof in the presence of the agent compared to in the absence of the agent indicates that the agent promotes dimerization of BAX, wherein an agent that agent promotes dimerization of BAX is a candidate agent for inhibiting cell death.
2. (canceled)
3. The method of claim 1, wherein the agent binds to the N-terminal of BAX at one or more of binding site residues S16, E17, Q18, I19, M20, K21, T22, G23, A24, L25, L26, 127, Q28, G29, F30, I31, Q32, D33, R34, A35, G36, R37, M38, G39, G40, E41, A42, P43, E44, L45, A46, L47, D48, P49, V50, P51, Q52, D53, A54, V129, P130, E131, L132, I133, R134, T135, I136, M137, G138, W139, T140, L141, D142, F143, L144, R145, E146, and R147.
4. The method of claim 1, wherein the agent binds to the C-terminal of BAX at one or more of binding site residues N73, M74, E75, L76, D98, M99, F 100, S101, D102, G103, N104, F105, N106, W107, G108, R109, I152, Q153, D154, Q155, G156, G157, W158, D159, G160, L161, L162, S163, Y164, F165, G166, T167, P168, T169, W170, Q171, T172, V173, T174, i175, F176, V177, A178, G179, V180, L181, T182, A183, S184, L185, T186, I187, W188, K189 K190, M191, and G192.
5. The method of claim 1, wherein measurement of BAX as a dimer or monomer is carried out using one or more of a fluorescent polarization assay, size exclusion chromatography (SEC), polyacrylamide gel electrophoresis, dynamic light scattering and an antibody that specifically binds to either BAX dimer or BAX monomer.
6. A method for identifying an agent that modulates the activity of BAX comprising contacting 9 helix peptide of BAX with N-terminal binding site of BAX in the presence of the agent and in the absence of the agent; and measuring binding between the 9 helix peptide of BAX and the N-terminal binding site of BAX, wherein decreased binding in the presence of the agent compared to binding in the absence of the agent indicates that the agent is a modulator of the activity of BAX.
7. The method of claim 6, wherein the agent is an inhibitor of BAX.
8. The method of claim 6, wherein the 9 peptide of BAX has the amino acid sequence TWQTVTIFVAGVLTASLTIWKKMG (SEQ ID NO:11).
9. The method of claim 6, wherein the 9 helix peptide of BAX or the N-terminal binding site of BAX is immobilized on a solid substrate.
10. The method of claim 6, wherein binding between the 9 helix peptide of BAX and the N-terminal binding site of BAX is measured using a fluorescence assay.
11-14. (canceled)
15. A peptide consisting of: TABLE-US-00006 a) (SEQIDNO:11) TWQTVTIFVAGVLTASLTIWKKMG, b) (SEQIDNO:12) TWQTVTIFVAGVLTASLT, c) (SEQIDNO:13) TWQTVTIFVAGVLTA, d) (SEQIDNO:14) TWQTVTIFVAGVL, e) 11-30 amino acid residues comprising the sequence TXQTXXIFXAG (SEQ ID NO:15), where X at any position can independently be any amino acid or unnatural amino acid or non-naturally occurring chemically modified amino acid, f) 15-30 amino acid residues comprising the sequence TXQTXXIFXAGVXTA (SEQ ID NO:16), where X at any position can independently be any amino acid or unnatural amino acid or non-naturally occurring chemically modified amino acid, or g) 11-30 amino acid residues comprising the sequence Y1XY2Y3XXY4Y5XY6Y7 (SEQ ID NO:17), where Y1 is threonine or a conserved amino acid, or unnatural amino acid or non-naturally occurring chemically modified amino acid, Y2 is glutamine or a conserved residue or unnatural amino acid or non-naturally occurring chemically modified amino acid, where Y3 is threonine or a conserved amino acid, or unnatural amino acid or non-naturally occurring chemically modified amino acid, where Y4 is isoleucine or a conserved amino acid, or unnatural amino acid or non-naturally occurring chemically modified amino acid, where Y5 is phenylalanine or a conserved amino acid, or unnatural amino acid or non-naturally occurring chemically modified amino acid, where Y6 is alanine or a conserved amino acid, or unnatural amino acid or non-naturally occurring chemically modified amino acid, where Y7 is glycine or a conserved amino acid, or unnatural amino acid or non-naturally occurring chemically modified amino acid, where X at any position can independently be any amino acid, or natural or non-naturally occurring chemically modified amino acid.
16. The peptide of claim 15 consisting of the sequence TXQTXXIFXAG (SEQ ID NO:15) or the sequence TXQTXXIFXAGVXTA (SEQ ID NO:16).
17. A chemically synthesized peptide consisting of any of the peptides of claim 15.
18. A peptide produced by recombinant DNA or cDNA consisting of any of the peptides of claim 15.
19. (canceled)
20. A method of inhibiting BAX comprising contacting BAX with the peptide of claim 15.
21. The method of claim 20, wherein BAX is in a living cell and inhibition of BAX inhibits cell death.
22. The method of claim 20, wherein the BAX is in a subject and the agent is administered to the subject.
23. (canceled)
24. The method of claim 22, wherein the subject has a disease or disorder associated with premature or unwanted cell death and characterized by abnormal activation, expression or function of BAX.
25. The method of claim 24, wherein the disease or disorder is a cardiovascular disease or disorder, a neurodegenerative or neurological disease or disorder, a liver disease or disorder, a kidney disease or disorder, an immunological disorder, ischemia, infertility, a blood disorder, renal hypoxia, hepatitis, asthma or AIDS.
26. A labeled peptide comprising the peptide of claim 15 attached to a fluorescent label or to a radioactive label.
27. A method of identifying an agent as a candidate agent for inhibiting cell death comprising: contacting BCL-2-associated X-protein (BAX) with one or more peptides of claim 15 in the presence of the agent and in the absence of the agent, and measuring binding of the one or more peptides to BAX, wherein decreased binding of the one or more peptides to BAX in the presence of the agent compared to binding of the one or more peptides to BAX in the absence of the agent indicates that the agent is a candidate agent for inhibiting cell death.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
DETAILED DESCRIPTION OF THE INVENTION
[0034] A method is provided for identifying an agent as a candidate agent for promoting or inhibiting cell death comprising
[0035] (a) contacting the agent with BCL-2-associated X-protein (BAX) monomers or portions thereof, and/or with BAX dimers, and
[0036] (b) measuring if the agent inhibits or promotes dimerization of BAX;
[0037] wherein a decrease in binding of BAX monomers to other BAX monomers or to portions of BAX monomers in the presence of the agent compared to in the absence of the agent indicates the agent inhibits dimerization of BAX, wherein an agent that agent inhibits dimerization of BAX is a candidate agent for promoting cell death; and
[0038] wherein an increase in binding of BAX monomers or portions thereof to other BAX monomers or portions thereof in the presence of the agent compared to in the absence of the agent indicates that the agent promotes dimerization of BAX, wherein an agent that agent promotes dimerization of BAX is a candidate agent for inhibiting cell death.
[0039] The agent can bind to amino acid residues of the N-terminal binding site and/or C-terminal binding site of BAX. For example, the agent can bind to the N-terminal of BAX at one or more of binding site residues S16, E17, Q18, 119, M20, K21, T22, G23, A24, L25, L26, 127, Q28, G29, F30, I31, Q32, D33, R34, A35, G36, R37, M38, G39, G40, E41, A42, P43, E44, L45, A46, L47, D48, P49, V50, P51, Q52, D53, A54, V129, P130, E131, L132, I133, R134, T135, I136, M137, G138, W139, T140, L141, D142, F143, L144, R145, E146, and R147. Alternatively, or in addition, the agent can bind to the C-terminal of BAX at one or more of binding site residues N73, M74, E75, L76, D98, M99, F100, S101, D102, G103, N104, F105, N106, W107, G108, R109, I152, Q153, D154, Q155, G156, G157, W158, D159, G160, L161, L162, 5163, Y164, F165, G166, T167, P168, T169, W170, Q171, T172, V173, T174, I175, F176, V177, A178, G179, V180, L181, T182, A183, S184, L185, T186, I187, W188, K189 K190, M191, and G192.
[0040] In any of the methods disclosed herein, measurement of BAX as a dimer or monomer is carried out using one or more of a fluorescent polarization assay, size exclusion chromatography (SEC), polyacrylamide gel electrophoresis, dynamic light scattering, and an antibody that specifically binds to either BAX dimer or BAX monomer.
[0041] A method is also provided for identifying an agent that modulates the activity of BAX comprising
[0042] contacting 9 helix peptide of BAX with N-terminal binding site of BAX in the presence of the agent and in the absence of the agent; and
[0043] measuring binding between the 9 helix peptide of BAX and the N-terminal binding site of BAX, wherein decreased binding in the presence of the agent compared to binding in the absence of the agent indicates that the agent is a modulator of the activity of BAX.
[0044] In one embodiment, the agent is an inhibitor of BAX. Alternatively, the agent may be an activator of BAX.
[0045] The 9 peptide of BAX has the amino acid sequence TWQTVTIFVAGVLTASLTIWKKMG (SEQ ID NO:11). The 9 helix peptide of BAX is illustrated in
[0046] Methods are also disclosed for identifying an agent as a modulator of a BCL-2-associated X-protein (BAX) comprising contacting the agent with the BAX and measuring if the agent inhibits or promotes the dimerization of BAX with another BAX or portion thereof, wherein a decrease in binding in the presence of the agent compared to in the absence of the agent indicates that the agent inhibits dimerization of BAX and an increase in binding of BAX to another BAX molecule in the presence of the agent compared to the absence of the agent indicates that the agent promotes dimerization of BAX.
[0047] In any of the methods disclosed herein, the BAX can be a human BAX.
[0048] The agent can be, for example, a small molecule, an isolated peptide, a synthetic peptide, a peptide-based agent with natural or non-natural amino acids or combinations, a hydrocarbon stapled peptide, a constrained peptide, a macrocycle, a peptoid, a peptidomimetic, a foldamer, an aptamer, an antibody, a monobody, a nanobody, or combinations thereof. In an embodiment, an agent is a peptidomimetic of the 9 helix of BAX.
[0049] In an embodiment of the methods described herein, the agent is a small molecule of 2000 daltons or less. In an embodiment of the methods described herein, the agent is a small molecule of 1500 daltons or less. In an embodiment of the methods described herein, the agent is a small molecule of 1000 daltons or less. In an embodiment of the methods described herein, the agent is a small molecule of 800 daltons or less. In an embodiment of the methods described herein, the agent is a small molecule of either 2000, 1500, 1000, 800, 700, 600, 500 or 400 daltons or less. In an embodiment of the methods described herein, the agent is a small organic molecule.
[0050] The methods disclosed herein can further comprise administering an agent identified as promoting dimerization of BAX or as inhibiting BAX to a subject with a disease or disorder associated with premature or unwanted cell death and characterized by abnormal activation, expression or function of BAX, and testing the efficacy of the agent in treating the disease. The methods can further comprise administering an agent identified as inhibiting dimerization of BAX or as activating BAX to a subject with a cancer and testing the efficacy of the agent in treating cancer.
[0051] Also provided are the following peptides that interact with the N-terminal binding site of BAX:
TABLE-US-00002 (SEQIDNO:11) 1.
Highlighted amino acid residues interact with the N-terminal binding site of BAX. Other residues that do not interact with the N-terminal binding site of BAX can be mutated to any residue but the peptide sequences can still have binding and inhibitory function. Accordingly, the invention provides a peptide of 11-30 amino acid residues comprising the sequence: TXQTXXIFXAG (SEQ ID NO:15) where X at any position can independently be any amino acid or unnatural amino acid. In one embodiment, the peptide of 11-30 amino acid residues comprising the sequence TXQTXXIFXAG (SEQ ID NO:15) does not include any of SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13 and SEQ ID NO:14. The invention also provides a peptide of 15-30 amino acid residues comprising the sequence: TXQTXXIFXAGVXTA (SEQ ID NO:16) where X at any position can independently be any amino acid or unnatural amino acid. In one embodiment, the peptide of 15-30 amino acid residues comprising the sequence TXQTXXIFXAGVXTA (SEQ ID NO:16) does not include any of SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13 and SEQ ID NO:14. The invention also provides a peptide of 11-30 amino acid residues comprising the sequence Y1XY2Y3XXY4Y5XY6Y7 (SEQ ID NO:17), where Y1 is threonine or a conserved amino acid, or unnatural amino acid, Y2 is glutamine or a conserved residue or unnatural amino acid, where Y3 is threonine or a conserved amino acid, or unnatural amino acid, where Y4 is isoleucine or a conserved amino acid, or unnatural amino acid, where Y5 is phenylalanine or a conserved amino acid, or unnatural amino acid, where Y6 is alanine or a conserved amino acid, or unnatural amino acid, where Y7 is glycine or a conserved amino acid, or unnatural amino acid, where X at any position can independently be any amino acid, or natural or unnatural chemically modified amino acid. Preferably at least one X or one Y in each sequence is an unnatural amino acid or a non-naturally occurring chemically modified amino acid. By, e.g., 11-30 amino acids, it is meant any number of amino acids between 11-30, i.e., 11, 12, 13, 14, . . . 29, or 30 amino acid residues. In one embodiment, the peptide consists of the sequence TXQTXXIFXAG (SEQ ID NO:15) or the sequence TXQTXXIFXAGVXTA (SEQ ID NO:16). In different embodiments, the interacting residues could be also mutated to conserved or similar residues that will maintain the interaction with BAX. In different embodiments, the peptides can be labeled with a label such as a fluorescent label or a radioactive label. In one embodiment, the peptides claimed herein are chemically synthesized peptides or peptides produced by recombinant DNA or cDNA. For example, the peptides can be made by liquid phase synthesis or by solid phase synthesis. The peptides can be synthesized, e.g., using recombinant DNA or cDNA. In one embodiment, the peptides are not directly obtained from a larger naturally-occurring BAX protein, for example, by digestion of the protein. In one embodiment, the peptides are isolated and purified peptides.
[0052] Methods are provided for inhibiting BAX comprising contacting BAX with the any of the peptides disclosed herein. The BAX can be in a living cell where preferably inhibition of BAX inhibits cell death. The BAX can in a subject, such as a mammal such as a human, and the agent is administered to the subject. The subject can have a disease or disorder associated with premature or unwanted cell death and characterized by abnormal activation, expression or function of BAX.
[0053] Diseases and disorder associated with premature or unwanted cell death and characterized with abnormal activation, expression or function of BAX include, for example, cardiovascular diseases and disorders (e.g. arteriosclerosis, heart failure, heart transplantation, aneurism, chronic pulmonary disease, ischemic heart disease, hypertension, thrombosis, cardiomyopathies), neurodegenerative and neurological diseases and disorders (e.g. Alzheimer's disease, Parkinson's disease, Huntington's disease, retinitis pigmentosa, spinal muscular atrophy, various forms of cerebellar degeneration, amyotrophic lateral sclerosis), liver diseases and disorders, kidney diseases and disorders, immunological disorders (e.g. organ transplant rejection, arthritis, lupus, IBD, Crohn's disease, asthma, multiple sclerosis, diabetes), ischemia (e.g. stroke, myocardial infarction and reperfusion injury), infertility (e.g. premature menopause, ovarian failure or follicular atresia), blood disorders (e.g. fanconi anemia, aplastic anemia, thalassemia, congenital neutropenia, myelodysplasia), renal hypoxia, hepatitis, asthma and AIDS. Diseases associated with inhibition of cell death and characterized by abnormal inhibition, expression or function of BAX include, for example, cancer and autoimmune diseases.
[0054] Method are also provided for identifying an agent as a candidate agent for inhibiting cell death comprising:
[0055] contacting BCL-2-associated X-protein (BAX) with one or more of any of the peptides disclosed herein in the presence of the agent and in the absence of the agent, and
[0056] measuring binding of the one or more peptides to BAX,
[0057] wherein decreased binding of the one or more peptides to BAX in the presence of the agent compared to binding of the one or more peptides to BAX in the absence of the agent indicates that the agent is a candidate agent for inhibiting cell death. In one embodiment, the peptides are fluorescently labeled, for example with fluorescein isothiocyanate (FITC).
[0058] As used herein, BAX is BCL-2-associated X-protein. In an embodiment, the BAX is mammalian. In a preferred embodiment, the BAX is a human BAX. In an embodiment, the BAX comprises consecutive amino acid residues having the following sequence:
TABLE-US-00003 (SEQIDNO:1) MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPV PQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFERVAADME SDGNENWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLG WIQDQGGWDGLLSYEGTPTWQTVTIEVAGVLTASLTIWKKMG.
[0059] In an embodiment of the methods described herein, the methods are useful for identifying therapeutic cell death inhibitors. In an embodiment of the methods described herein, the methods are useful for identifying therapeutic cell death activators.
[0060] All combinations of the various elements described herein are within the scope of the invention unless otherwise indicated herein or otherwise clearly contradicted by context.
[0061] This invention will be better understood from the Experimental Details, which follow. However, one skilled in the art will readily appreciate that the specific methods and results discussed are merely illustrative of the invention as described more fully in the claims that follow thereafter.
EXPERIMENTAL DETAILS
Materials and Methods
[0062] ReagentsHydrocarbon-stapled peptide corresponding to the BH3 domain of BIM, BIM SAHB.sub.A2: N-acetylated .sup.145EIWIAQELRS5IGDS5FNAYYA.sup.164-CONH.sub.2 (SEQ ID NO:2), where S5 represents the non-natural amino acid inserted for olefin metathesis, was synthesized, purified and characterized as previously described by CPC Scientific (11).
[0063] Production of recombinant BAXHuman BAX wild type and mutants were generated using a standard PCR-based cloning strategy and PCR-based site-directed mutagenesis in pTYB1 vector (New England Biolabs) and constructs were confirmed by sequencing. Recombinant proteins are expressed in BL21 (DE3) codon+E. coli strain and purified as previously described (16).
[0064] Size-Exclusion ChromatographySuperdex 75 10/300 GL and 200 10/300 GL (GE Healthcare) columns were used for size exclusion chromatography of recombinant proteins and cell extracts. Recombinant protein was injected in columns equilibrated with a buffer containing 20 mM HEPES pH 7.2, 150 mM KCl, 1 mM DTT. 1 mg of cytosolic or membrane extracts was applied to a Superdex 200 10/300 GL equilibrated in buffer containing 10 mM Tris, pH 7.5, 1 mM EGTA, 200 mM Sucrose and Complete Protease Inhibitors. Fractions of 500 l were collected, and 30 l of each fraction was analyzed by SDS-PAGE and immunoblotting. All operations were run at 4 C. Gel filtration molecular weight markers (GE Healthcare) were also subjected to the columns to obtain a standard curve for the estimation of the molecular weight of the proteins.
[0065] Dynamic Light-ScatteringThe dynamic light scattering of various samples was measured using a DynaPro801 instrument from Wyatt Technology and DYNAMICS v.5.25.44 software for data collection and analysis. The protein samples after elution from the size-exclusion chromatography were centrifuged for 10 min at 13,000 rpm and loaded to plastic cuvettes. Typically, one hundred scans of five seconds was acquired for each 100 l sample. Normalized intensity versus hydrodynamic radius (nm) measured in 20 mM HEPES pH 7.2, 150 mM KCl, 1 mM DTT buffer.
[0066] CrystallizationHomogeneous BAX protein in 20 mM HEPES pH 7.2, 150 mM KCl, 1 mM DTT buffer was concentrated to 10 mg/ml using a filtration unit (Milipore). Initial screening of crystallization conditions for BAX wild type and mutants were carried out by the sitting-drop vapor-diffusion method using 96-well Intelli-Plates (Hampton Research) at 293 K. The BAX protein was concentrated to 10 mg/ml in 20 mM HEPES pH 7.2, 150 mM KCl, 1 mM DTT and centrifuged prior to crystallization setup. Diffraction quality rod-shaped crystals were generated in 0.1 M Bis-Tris pH 6.5, 1.5 M ammonium sulfate via the hanging-drop vapour-diffusion method using 24-well VDX plates (Hampton Research). 1 l of protein solution and reservoir solution were mixed and equilibrated against 1 ml of reservoir solution. Crystals were cryoprotected by soaking for 5 s in 20 l of cryoprotectant solution containing 0.1 M Bis-Tris pH 6.5, 1.5 M ammonium sulphate and 25% (v/v) glycerol, and flash-frozen in liquid nitrogen.
[0067] Data collection and structure determinationX-ray diffraction data were collected at beamlines in National Synchrotron Light Source and Advanced Photon Source. All data were integrated and scaled with HKL2000 (19) and further processing was carried out with CCP4 software suite (20). The crystal structure of BAX was determined by molecular replacement method using the monomeric NMR structure of BAX (PDB ID: 1F 16) as a search model. Model was mutated to poly Ala. Multiple cycles of manual editing and adjustment of the model using COOT (21) followed refinement by simulated annealing, energy minimizations and individual isotropic B factor refinement with REFMAC (22). A break chain of the loop between helices 1 and 2 was realized due to poor diffraction data at the model building stage. The final models were validated with PROCHECK (23), PISA (24) and molecular models were rendered using PYMOL (25). Data collection and statistics are summarized in Table 2.
[0068] NMR samples and spectroscopyProtein samples were prepared in 25 mM sodium phosphate, 50 mM NaCl solution at pH 6.0 in 5% D.sub.2O. Correlation .sup.1H-.sup.15N HSQC, .sup.1H-.sup.15N TROSY spectra and triple resonance spectra for backbone .sup.1H, .sup.13C, .sup.15N assignments of BAX P168G monomer: HNCO, HNCA, HNCOCA, HNCACB, HNCOCACB and N.sup.15 NNH-NOESY were acquired at 25 C. on a Inova 600 MHz NMR spectrometer equipped with a cryogenic probe, processed using Topsin, and analyzed with CCPNMR (26). BAX wild type cross-peak assignments were applied as previously reported (11,16). The weighted average chemical shift difference A at the indicated molar ratio was calculated as (H.sup.1).sup.2+(N.sup.15/5).sup.2 in p.p.m. The absence of a bar indicates no chemical shift difference, or the presence of a proline or a residue that is overlapped and not used in the analysis. The significance threshold for backbone amide chemical shift changes was calculated based on the average chemical shift across all residues plus the standard deviation, in accordance with standard methods.
[0069] BAX dimerization assaysBAX wild type and mutants were concentrated to 0.5 mM in BAX buffer (10 mM HEPES pH 7, 150 mM KCl, 1 mM DTT) and incubated at 20 C. for 1-3 days before diluting to a total volume of 250 l and loaded onto a Superdex 75 HR 10/30 size exclusion column (GE Healthcare). These conditions allow a controlled dimerization process than aggregation due to BAX activation. Separation of monomeric and dimeric BAX was achieved using a flow rate of 0.5 ml/min at 4 C. The chromatogram traces show the monomeric and dimeric peaks at 11.8 and 10.4 ml, respectively. Protein standards (GE Healthcare) were used to calibrate the molecular mass of gel filtration peaks. Chromatogram traces are representative of several independent preparations of freshly SEC-purified monomeric BAX.
[0070] BAX crosslinkingDimerization was detected using a crosslinking approach by incubating BAX at indicated doses with 20 BMH on ice for 15 min followed by quenching with 1 mM DTT. Samples were denatured at 90 degrees and analyzed with SDS-PAGE.
[0071] Liposomal permeabilization assayLiposomes were composed of the following molar percentages of lipids (Avanti Polar Lipids): phosphatidylcholine, 48%; phosphatidylethanolamine, 28%; phosphatidylinositol, 10%; dioleoyl phosphatidylserine, 10%; and tetraoleoyl cardiolipin, 4% and were loaded with ANTS/DPX (Molecular Probe) upon extrusion. BAX (400 nM) was combined with BIM SAHB.sub.A2 at the indicated concentrations in 96-well format (Corning) and then liposomes were added (10 l from 50 mM total lipid stock) in assay buffer (10 mM HEPES, pH 7, 200 mM KCl, 5 mM MgCl.sub.2, and 0.2 mM EDTA) to a final volume of 100 l. ANTS/DPX release was quantified based on the increase in fluorescence intensity that occurs when the ANTS fluorophore is separated from the DPX quencher upon release from the liposomes into the supernatant. Fluorescence (.sub.ex=355 nm and .sub.em=520 nm) was measured over time at 30 C. using a Tecan Infinite M1000 plate reader. The percentage release of ANTS/DPX at 90 min was calculated as percentage release=((FF.sub.0)/(F.sub.100F.sub.0))100, where F.sub.0 and F.sub.100 are baseline and maximal fluorescence, respectively. 1% Triton treatment is used to determine the maximum amount of liposomal release per assay, and this value sets the 100% value.
[0072] Cell culture, cell transfection and apoptosis assayWild type MEFs and SV40-transformed Bax.sup./ Bak.sup./ (DKO) MEFs were maintained in DMEM high glucose (Invitrogen) supplemented with 10% FBS, 100 Ul.sup.1 penicillin/streptomycin, 2 mM 1-glutamine, 0.1 mM MEM nonessential amino acids, and 50 M -mercaptoethanol. Reconstitution of BAX and BAX mutant into DKO cells was achieved by retroviral transduction of BAX-IRES-GFP or BAX(P168G)-IRES-GFP plasmids, followed by MoFlo sorting for GFP-positive cells. The production of retroviruses was performed as described previously (17). Comparable expression of BAX WT and mutant protein was confirmed by western analysis. For staurosporine treatment, MEFs (510.sup.4 per well) were seeded in six-well clear-bottom plates for 16-18 hours in serum-containing media and then treated with 1 M staurosporine. For transient retroviral transduction of BAX or BAX mutant, DKO MEFs were infected with retrovirus expressing BAX or BAX mutant for 30-36 hours. Cell death was quantified by annexin-V (BioVision) staining. Flow cytometry was performed using a LSRFortessa (BD Biosciences) and data were analyzed using FACSDiva (BD Biosciences). The expression of BAX or BAX mutant was assessed by anti-BAX western blot. P values for statistical analyses were obtained using Student's t test.
[0073] Subcellular fractionationMEFs were maintained in DMEM (Invitrogen) supplemented with 10% FBS, 100 U ml.sup.1 penicillin/streptomycin, 2 mM 1-glutamine, 0.1 mM MEM nonessential amino acids, and 50 M -mercaptoethanol. MEFs (2010.sup.6 per well) were seeded in a 150 mm dish for 12 hours. To isolate cytosol and mitochondrial fractions, cells were lysed by Dounce homogenizer in lysis buffer LB containing 10 mM Tris, pH 7.5, 1 mM EGTA, 200 mM Sucrose and Complete Protease Inhibitors. The cell lysates were centrifuged at 700g for 10 min to remove unlysed cells and nuclei. The supernatants were centrifuged at 12000g for 10 min at 4 C. and the resulting pellet was collected as the mitochondrial fraction. The membrane pellet was resuspended in LB+1% CHAPS.
[0074] Western Blotting20 g of whole-cell protein was electrophoretically separated on 4-12% NuPage (Invitrogen) gels, transferred to Immobilon-FL PVDF membranes (Millipore) and subjected to immunoblotting. For visualization of proteins with Odyssey Infrared Imaging System (LI-COR Biosciences) membranes were blocked in PBS containing 2.5% milk powder. Primary BAX antibody (Cell Signaling 2772S) was incubated overnight at 4 C. in a 1:1,000 dilution. After washing, membranes were incubated with an IRdye800-conjugated goat anti-rabbit IgG secondary antibody (LI-COR Biosciences) in a 1:5,000 dilution. Proteins were detected with Odyssey Infrared Imaging System.
[0075] BAX conformational change assayCytosolic fractions were subjected to immunoprecipitation followed by immunoblotting against total BAX. Briefly, 100-300 g total protein was collected and incubated with pre-equilibrated protein G Sepharose beads (Santa Cruz Biotechnology Inc.) for 1 hour. The precleared samples were then incubated with the 6A7 antibody (6 g/ml) (1:1,000, sc-23959, Santa Cruz Biotechnology) for four hours at 4 C. followed by the addition of pre-equilibrated protein G Sepharose beads for 1 hour. The beads were pelleted, washed with lysis buffer 3 times at 4 C., and protein eluted by heating the beads at 90 C. for 10 minutes in LDS/DTT loading buffer. The immunoprecipitates were subjected to electrophoresis and Western blot analysis using anti-BAX antibody (1:1,000) (Cell Signaling 2772S).
Results
[0076] The current invention makes use of the discovery that cytosolic BAX forms a dimeric autoinhibited form that is mediated by the N-terminal trigger site of one protomer and a novel interacting C-terminal surface that includes 9 of the second protomer. These interacting protein surfaces of BAX provide important insights for understanding the structural basis of BAX inhibition and designing drugs for pharmacological modulation of BAX. It was found that monomeric wild type BAX (BAX WT), in the absence of a BH3 activating domain, reversibly forms a dimer over time as measured by size exclusion chromatography (SEC) and polyacrylamide gel electrophoresis (PAGE). A single point mutation such as P168G in the 8-9 loop of BAX, which controls helix 9 mobilization, generates the identical dimeric peak by SEC. BAX P168G forms a more stable dimer, which persists several days at room temperature.
[0077] The conformations of recombinant BAX and cytosolic BAX from mouse embryonic fibroblasts (MEFs) were investigated. Recombinant full-length BAX was purified from E. coli extracts using chitin affinity chromatography followed by size-exclusion chromatography (SEC) (17). Recombinant BAX elutes from SEC predominantly in a peak that corresponds to its monomeric form (11,17) and additionally in a second distinct peak that corresponds to a dimeric form (
[0078] To elucidate the physiological role of the cytosolic BAX dimer conformation, the molecular basis of BAX dimerization was investigated. First, a method to reproducibly generate sufficient amounts of the BAX dimer was established by incubation of the BAX monomer at high concentrations as shown by SEC or treatment with the BMH crosslinker followed by polyacrylamide gel electrophoresis (
[0079] X-ray crystallographic studies were performed to gain further insights into the inactive BAX dimer. The stability of the SEC dimer peak was monitored with wild type BAX and mutants to predict successful crystallization. Quality of crystals for diffraction was better with mutants that produce more stable dimer than wild type BAX. The BAX P168G mutant, which does not alter the structure of BAX but reduces the dynamics of the 8-9 loop, successfully produced crystals and a native X-ray data set was obtained to a resolution of 1.9 . The crystal structure was solved and refined by a molecular replacement approach using the NMR structure of full-length BAX as a search model (Table 2). The asymmetric unit contained two BAX molecules with excellent electron density map, in which all BAX residues could be traced except from residues of the N-terminal unstructured region (residues 1-13) and four residues of the unstructured loop between helices 1 and 2 (residues 37-40) (
[0080] The BAX protomers within the asymmetric BAX dimer structure resemble the inactive monomeric BAX structure determined by solution NMR, however, they have noticeable differences in orientation of helices and conformation of loops (backbone r.m.s.d. of 2.1 ) (17). Most pronounced differences correspond to residues located in the N-terminal trigger site surface, including helices 1, 6, 2 and 1-2 loop. Furthermore, the comparison with the structure of full length BAX bound to the BIM BH3 helix (backbone r.m.s.d. 3.0 ) (11) indicates that, in the asymmetric dimer, the 1-2 loop is in a closed conformation, forming specific intramolecular contacts with helices 1 and 6, whereas the BIM BH3-bound BAX structure has the 1-2 loop in an open and active conformation (11,12). Therefore, the structural analysis indicates that the asymmetric dimer structure contains two BAX molecules in distinct but inactive conformation in agreement with the evidence of the cytosolic inactive BAX dimer (
[0081] The asymmetric BAX dimer conformation highlights two novel interaction surfaces of BAX (
[0082] Upon BH3 binding to the N-terminal trigger site, the 1-2 loop is displaced into an open conformation, a conformational change essential for exposure of the 6A7 epitope (residues 12-24) and BAX activation (11,12,17,18) (
[0083] To confirm the dimerization interface in the crystal structure and that the BAX dimer observed in solution is not the domain-swapped dimer previously reported for truncated BAX C21 (13), use was made of an internally cross-linked mutant (C62S, C126S, V121C, I136C) termed 4MA, which is resistant to activation and incapable of forming the domain-swapped dimer as previously reported (13). Expectedly, BAX 4MA retains the ability to form the BAX dimer since these mutations preserve the inactive conformation as in the BAX WT structure (
[0084] To investigate the physiological role of the BAX dimerization mechanism, an investigation was undertaken of the capacity of BAX WT and mutants to form the autoinhibited dimer and regulate BAX activation. DKO MEFs was reconstituted with BAX WT and mutants at physiological expression levels. P168G mutant forms a more stable autoinhibited dimer than BAX WT (
[0085] During initiation of apoptosis, cytosolic BAX is activated through an interaction of activator BH3-only proteins with the N-terminal trigger site, followed by the N-terminal conformational change and the displacement of 9 from its C-terminal hydrophobic groove, in order to translocate to the mitochondria Moreover, mitochondrial attached BAX with the 9 displaced from its hydrophobic groove undergoes N-terminal conformational change upon further activation by activator BH3-only proteins (13). Regardless of the step of BAX activation, conformational changes at the N-terminal and C-terminal surfaces are required for complete BAX activation leading to membrane permeabilization. The work herein suggests that cytosolic BAX forms an autoinhibited dimer conformation to prevent either the N-terminal or C-terminal conformational change in each protomer and maintain BAX activation under control (
TABLE-US-00004 TABLE 1 Representative dynamic light scattering data of BAX monomer and dimer from size-exclusion chromatography elution peaks. BAX Monomer Dimer Radius/nm 2.730 2.955 Molecular Weight 22 41 Polydispersity/% 6.8 3.2 Mass fraction/% 97.0 98.5
TABLE-US-00005 TABLE 2 Structural statistics of data collection and refinement. Data Collection Protein BAX P168G BAX G67R Beamline BNL (X29) APS (23IDD) Space group P2.sub.1 P2.sub.1 Molecule in asymmetric 2 2 unit Resolution () 50.0-1.90 (1.93-1.90) 50.0-3.31 (3.31-3.25) Cell Dimensions a, b, c () 63.65, 40.27, 65.30 40.58, 65.01, 65.59 , , () 90.0, 90.01, 90.0 90.0, 89.8, 90.0 No. unique observations 26198 4866 Completeness (%) 98.5 (100) 89.8 (78.3) R.sub.sym.sup. 0.06 (0.65) 0.13 (0.18) I/ (I) 22.1 (2.3) 26.4 (13.4) Redundancy 4.6 3.0 (2.7) Refinement Resolution () 19.1-1.90 46.1-3.30 Reflections 24766 4484 Completeness (%) 98.6 90.1 Number of atoms 2754 2756 Solvent atoms 124 n/a R.sub.work 0.20 0.22 R.sub.free 0.23 0.26 R.m.s. deviations Bond lengths () 0.008 0.014 Bond angles () 1.21 1.42 B-factors (.sup.2) Overall 34.7 59.1 Main chain 32.5 58.5 Side chain 36.6 59.5 Water 40.6 n/a Ramachandran plot (%) most favorable region 98 90 additionally allowed 2 10 region Numbers in parentheses are for the highest resolution shell. .sup.R.sub.sym = (I <I>)/<I>, where I is the intensity measurement for a given refraction and <I> is the average intensity for multiple measurements of this refraction.
REFERENCES
[0086] 1. N. N. Danial, S. J. Korsmeyer, Cell 116, 205 (2004). [0087] 2. R. W. Johnstone, A. A. Ruefli, S. W. Lowe, Cell 108, 153 (2002). [0088] 3. D. E. Bredesen, R. V. Rao, P. Mehlen, Nature 443, 796 (2006). [0089] 4. R. J. Youle, A. Strasser, Nat. Rev. Mol. Cell. Biol. 9, 47-59 (2008). [0090] 5. J. E. Chipuk, et al., Mol. Cell. 37, 299-310, (2010). [0091] 6. K. G. Wolter, et al., J. Cell Biol. 139, 1281-1292 (1997). [0092] 7. I. S. Goping, et al., J. Cell Biol. 143, 207-215 (1998). [0093] 8. A. Nechushtan, C. L. Smith, Y. T. Hsu, R. J. Youle, EMBO J. 18 2330-2341 (1999). [0094] 9. M. C. Wei et al., Science 292, 727 (2001). [0095] 10. S. W. Tait, D. R. Green, Cold Spring Harb. Perspect. Biol. 5, (2013). [0096] 11. E. Gavathiotis et al., Nature 455, 1076 (2008). [0097] 12. E. Gavathiotis et al., Mol. Cell 40, 481 (2010). [0098] 13. P. E. Czabotar, et al., Cell 152, 519-531 (2013). [0099] 14. G. Lessene, P. E. Czabotar, P. M. Colman, Nat. Rev. Drug Disc. 7, 989 (2008). [0100] 15. E. Gavathiotis et al., Nat. Chem. Bio. 8, 639 (2012). [0101] 16. M. Suzuki, R. J. Youle, N. Tjandra, Cell 103, 645 (2000). [0102] 17. H. Kim et al., Mol. Cell 36, 487 (2009). [0103] 18. Y. T. Hsu, R. J. Youle, J. Biol. Chem. 272, 13829 (1997). [0104] 19. Z. Otwinowski, W. Minor, Methods Enzymol. 276, 307-326 (1997). [0105] 20. Collaborative Computational Project, Acta Crystallogr D Biol Crystallogr 50, 760-3, (1994). [0106] 21. P. Emsley, K. Cowtan, Acta Crystallogr D Biol Crystallogr 60, 2126-2132, (2004). [0107] 22. M. D. Winn, G. N. Murshudov, M. Z. Papiz, Methods Enzymol. 374, 300-321, (2003). [0108] 23. Laskowski, R. A., et al., Journal of Biomolecular NMR 8, 477-486 (1996). [0109] 24. E. Krissinel, K. Henrick, J. Mol. Biol. 372, 774-797. (2007). [0110] 25. W. L. DeLano, DeLano Scientific, San Carlos, Calif., USA (2002). [0111] 26. Vranken, W. F., et al., Proteins 59, 687-696, (2005).