Method and reagent for diagnosis and/or evaluation of progression of graft-versus-host disease
09631014 ยท 2017-04-25
Assignee
Inventors
- Tsukasa Hori (Hokkaido, JP)
- Yasuo Kokai (Hokkaido, JP)
- Yasuyoshi Naishiro (Hokkaido, JP)
- Hiroyuki Tsutsumi (Hokkaido, JP)
- Kohzoh Imai (Hokkaido, JP)
Cpc classification
G01N2800/245
PHYSICS
G01N33/6863
PHYSICS
C07K16/24
CHEMISTRY; METALLURGY
A61P37/06
HUMAN NECESSITIES
International classification
A61K39/395
HUMAN NECESSITIES
Abstract
Disclosed is a method of diagnosing graft-versus-host disease, comprising measuring the level of CCL8 protein in a sample obtained from a subject as an indicator for the diagnosis or course of graft-versus-host disease. Also a diagnostic reagent for graft-versus-host disease comprising an anti-CCL8 antibody is disclosed. The method of the present invention enables diagnosis of the onset of graft-versus-host disease and monitoring of the progress, in particular, differential diagnosis between graft-versus-host disease and an infectious disease. The present invention also provides a method for treating graft-versus-host disease utilizing the anti-CCL8 antibody.
Claims
1. A method of treating acute graft-versus-host disease (GVHD) in a human subject who has been treated with a hematopoietic stem cell transplant, the method comprising: (a) measuring or obtaining results of measurements of the level of CCL8 protein in a first sample obtained from the human subject at a first time point and in a second sample obtained from the human subject at a second, later time point; and (b) initiating therapy for acute GVHD when the level of CCL8 protein in the second sample is increased, by administering an anti-CCL8 antibody to the human subject.
2. The method of claim 1, further comprising: (c) measuring the level of CCL8 protein in a third sample obtained from said human subject at a time point after the therapy, or obtaining the result of a measurement of CCL8 protein in the third sample; and (d) evaluating the therapeutic effect for the acute GVHD therapy based on the level of CCL8 protein in the third sample.
3. The method according to claim 1, wherein the human subject is not yet showing any clinical manifestations of acute GVHD.
4. The method according to claim 1, wherein in step (b), the therapy for acute GVHD is initiated before clinical manifestations of acute GVHD in the human subject.
5. The method according to claim 1, wherein the level of CCL8 protein is measured using an anti-CCL8 antibody.
6. The method according to claim 1, wherein the level of CCL8 protein is measured using a method selected from mass spectrometry, high-performance liquid chromatography, and two-dimensional electrophoresis.
7. A method for treating acute graft-versus-host disease (GVHD), comprising administering an anti-CCL8 antibody to a subject suffering from acute GVHD.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
PREFERRED EMBODIMENTS OF THE INVENTION
(18) The present invention features a method for diagnosing GVHD and monitoring the course of GVHD by measuring the expression level of CCL8 in a test sample such as blood from a subject. As specifically illustrated in the following examples, among patients that have undergone bone marrow transplantation or umbilical cord blood transplantation, those who develop GVHD shows significantly higher expression level of CCL8, and a correlation was found between the manifestation of clinical signs of GVHD and the expression level of CCL8.
(19) CCL8 is a basic, heparin-binding secretory protein belonging to the chemokine family, also called MCP-2 (GenBank Accession No. NP_005614). This protein is produced in monocytes, fibroblasts, epithelial cells, etc., and is known to bind to receptors CCR2, CCR3, CCR5 and CCR11. It has been shown that CCL8 targets CD4-positive T cells, CD8-positive T cells, monocytes, NK cells, eosinophils, basophils, and the like. It is believed that GVHD develops through 3 steps subsequent to hematopoietic stem cell transplantation (HSCT). The first step is conditioning, which includes exposure to radiation for preparing the host (patient) for HSCT; the second step is the activation, proliferation, and differentiation of transplanted T cells; and the third step is the appearance of cell-mediated or inflammatory effectors (for the mechanisms, see the following two reviews: Reddy P. Pathophysiology of acute graft-versus-host disease. Hematol Oncol. 2003; 21:149-161, Ferrara J L, Reddy P. Pathophysiology of graft-versus-host disease. Semin Hematol. 2006; 43:3-10). In the second step, antigen presentation by dendrocytes is necessary for activation of transplanted T cell. Chemokines including CCL8 play an important role in the differentiation, proliferation, and activation of these dendrocytes (for the importance of chemokines in the second step, see: Wysocki C A, Panoskaltsis-Mortari A, Blazar B R, Serody J S. Leukocyte migration and graft-versus-host disease. Blood. 2005; 105:4191-4199). However, the role of CCL8 in the body and its significance in regulation of the immune system are not fully understood. Therefore, the mechanism underlying the correlation between the expression of CCL8 and GVHD that was discovered in the present invention is still unknown.
(20) A test sample to be measured for the level of CCL8 protein includes, for example, body fluid, blood, serum, and plasma from a human subject or animal subject. Tissue and cells collected from a subject may also be used as a test sample.
(21) The amount of CCL8 protein in a test sample obtained from a subject can be measured by using an anti-CCL8 antibody in immunological assay methods well known in the art. The anti-CCL8 antibody may be a polyclonal antibody or a monoclonal antibody. Various types of anti-CCL8 polyclonal antibodies and monoclonal antibodies are commercially available, and any of these antibodies can be used in the present invention.
(22) Alternatively, an antibody can be prepared by any of the methods well known in the art. A polyclonal antibody that binds to CCL8 can be obtained by a well-known method in the art that involves immunizing an animal using CCL8 or a peptide fragment thereof as the sensitizing antigen, isolating antiserum containing the antibody from the immunized animal, and verifying the presence of an antibody with the desired binding specificity by an ELISA assay, Western blot analysis, radioimmunoassay and the like.
(23) A monoclonal antibody that binds to CCL8 can be obtained in accordance with a well-known method in the art that involves immunizing an animal using CCL8 or a peptide fragment thereof as the sensitizing antigen, collecting the resulting immune cells and fusing them with myeloma cells, selecting a hybridoma producing the antibody, and culturing the hybridoma.
(24) The anti-CCL8 monoclonal antibody used in the present invention encompasses not only antibodies produced by hybridomas, but also recombinant antibodies produced by transformants transfected with an expression vector carrying the antibody gene. A recombinant antibody can be produced by cloning cDNA encoding a monoclonal antibody that binds to CCL8 from an antibody-producing hybridoma, inserting the cDNA into an expression vector, transforming an animal cell or a plant cell with the vector, and culturing the transformant. Alternatively, the gene encoding the anti-CCL8 antibody may be introduced into a transgenic animal to obtain the anti-CCL8 antibody produced in the transgenic animal.
(25) For use in treating a human patient, it is preferable for the anti-CCL8 antibody of the present invention to be a human chimeric antibody or humanized antibody. A human chimeric antibody is an antibody constructed from an antibody heavy-chain variable region and light-chain variable region of an nonhuman animal, and a heavy-chain constant region and light-chain constant region of a human antibody. A humanized antibody is constructed from an antibody complementarity determining region (CDR) originating in a nonhuman animal and a framework region (FR) and C region originating in a human antibody. Human chimeric antibodies and humanized antibodies will have reduced antigenicity in the human body, and therefore are useful as an active ingredient of the pharmaceutical composition of the present invention. Conventional gene recombination techniques for obtaining human chimeric antibodies and humanized antibodies, and the methods for evaluating the binding activity of these antibodies are well known in the art. Alternatively, an anti-CCL8 human antibody can be obtained by introducing CCL8 into a transgenic animal having a complete repertoire of human antibody genes.
(26) In addition, an antibody fragment may also be used in the present invention. An antibody fragment refers to a peptide that lacks a part of the entire anti-CCL8 antibody but still has CCL8 binding capability. Examples of antibody fragments include Fab, Fab, F(ab)2, Fv, and the like. The antibody fragment can be obtained by enzymatic treatment of the antibody to produce fragments. The antibody fragment of the present invention also includes antibody fragments and dimers thereof constructed by joining a VL chain and VH chain of an anti-CCL8 antibody with a linker. Examples include an ScFv, diabody, sc(Fv).sub.2, and the like.
(27) The CCL8 protein in a test sample obtained from a human subject or animal subject is assayed by an immunological method using an antibody obtained in this manner. The assay may be qualitative or quantitative. An immunoassay for the expression of CCL8 in a sample obtained from a subject can be carried out using a radioimmunoassay, ELISA, immunoprecipitation, immunoagglutination, Western blotting, and the like.
(28) As a typical example, sandwich ELISA can be carried out in the following manner. Peripheral blood is collected from the subject and plasma is prepared, added to a plate or chip where the anti-CCL8 antibody is immobilized, and incubated for a suitable period of time. After the plate or chip is washed to remove unbound components, another anti-CCL8 antibody is added. The antibody can be detectably labeled with an enzyme, fluorescent dye, chemoluminescent substance, biotin, radioactive compound, and the like. After incubation for a suitable period of time, the plate or chip is washed, and the label is detected by fluorescence, luminescence, radioactivity, and the like. Optionally, after the anti-CCL8 antibody is bound to the protein, a secondary antibody (for example, goat anti-mouse antibody) may be added in order to amplify the signal. The secondary antibody can be detectably labeled with an enzyme, fluorescent dye, chemoluminescent substance, biotin, radioactive compound, and the like. The amount of CCL8 protein in plasma obtained from the subject can be measured in this manner.
(29) In another aspect, the CCL8 protein can be detected using a detection method involving an agglutination reaction. In this method CCL8 can be detected using a carrier, for example latex particles carrying the anti-CCL8 antibody. When the latex particles carrying the anti-CCL8 antibody are mixed with the test sample and incubated for a predetermined period of time, the particles will agglutinate if CCL8 is contained in the sample. The CCL8 in the sample can be detected by observing the extent of the agglutination with the naked eye or by quantifying using a spectrophotometer.
(30) In still another aspect, the CCL8 protein can be detected using a biosensor utilizing the surface plasmon resonance phenomenon. A biosensor based on the surface plasmon resonance phenomenon enables monitoring protein-protein interactions as a surface plasmon resonance signal. For example, binding between the CCL8 protein and the anti-CCL8 antibody can be detected using a biosensor such as BIAcore (Pharmacia). More specifically, the test sample is brought into contact with a sensor chip having the anti-CCL8 antibody and the CCL8 protein bound to the anti-CCL8 antibody can be detected as a change in the resonance signal.
(31) In another embodiment, the test sample is partially purified (enriched) using a metal chelating agent and an affinity support such as heparin, and the CCL8 protein can be detected and quantified by MS, as shown in Example 2. Furthermore, the CCL8 protein can be detected and quantified by HPLC as shown in Example 3, or it can be detected and quantified by two-dimensional electrophoresis and silver staining.
(32) The present invention also provides a diagnostic reagent for GVHD comprising an anti-CCL8 antibody. The diagnostic reagent for GVHD of the present invention can be provided in the form of a test kit. The test kit contains a reagent for detecting CCL8, e.g., an anti-CCL8 antibody, as the active ingredient. The kit may also contain suitable reagents necessary for the assay such as a buffer solution, diluent, reaction stopping solution, washing solution, control sample, and the like.
(33) In the present invention, the level of CCL8 protein measured in this manner may be used as an indicator for diagnosis of GVHD. According to the present invention, GVHD can be diagnosed objectively by using the CCL8 protein as a marker rather than depending on observations such as visual examination and the amount of diarrhea, and thus the development and course of GVHD can be monitored. The diagnostic method of the present invention is useful, for example, for diagnosis before the manifestation of GVHD (early diagnosis), definitive diagnosis of the development, scoring of severity, monitoring the course of the disease, evaluating therapeutic efficacy and prognosis. In particular, as shown in
(34) As shown in the following examples, the CCL8 expression level in patients is significantly higher after the development of GVHD than before the development. Example 8 demonstrates that in a bone marrow transplant model mouse, the amount of CCL8 expression began to increase two days before clinical signs of GVHD were recognized. In addition, as shown in
(35) Furthermore, as shown in
(36) In addition, the method of the present application is useful for the development and improvement of therapeutic modes for GVHD. As shown in
(37) Furthermore, because at present no magic drug for GVHD is available, the present invention is also useful in screening for candidate substances that would be a powerful drug for the treatment of GVHD based on the CCL8 expression level as an indicator. Screening is carried out by administering a test substance to a GVHD model animal, and measuring the amount of CCL8 protein in a test sample obtained from the model animal. For example, an anti-CCL8 antibody can be used as a test substance. Also the test substance can be obtained from a library such as a library of various synthetic or naturally occurring compounds, a combinatorial library, oligonucleotide library, peptide library, and the like. The test substance may also include an extract of a natural substance or partially refined product originating in bacteria, fungi, algae, plants, animals and the like. If the level of CCL8 protein is lower in animals receiving the test substance, the test substance can be selected as a candidate substance for a therapeutic agent for GVHD. In other words, the diagnostic method of the present invention provides a platform for the development of new modes of therapy for GVHD.
(38) In another aspect, the present invention provides a pharmaceutical composition for treating GVHD comprising an anti-CCL8 antibody as the active ingredient, as well as a method for the treatment of GVHD comprising administrating an anti-CCL8 antibody. As shown in Example 9 below, when an anti-CCL8 antibody was administered to a GVHD model animal and evaluating pathological conditions, a decrease in inflammatory cell infiltration into the dermoepidermal junction in the skin and amelioration of damage to hair follicles and sebaceous glands were observed, demonstrating that administration of the anti-CCL8 antibody is effective in the treatment of GVHD.
(39) The pharmaceutical composition of the present invention may be formulated by a method known in the art. For example, the composition may be formulated by suitably combining with a pharmaceutically acceptable carrier or excipient, such as sterile water and physiological saline, vegetable oil, emulsifier, suspending agent, surfactant, stabilizer, flavoring, filler, vehicle, preservative, binder, and the like, and compounding them into the form of a unit dose required for generally recognized pharmaceutical manufacturing.
(40) For oral administration, the compound of the present invention can be formulated into a tablet, pill, dragee, capsule, liquid, gel, syrup, slurry, suspension, and the like by admixing with a pharmaceutically acceptable carrier well known in the art.
(41) For parenteral administration, the compound of the present invention can be formulated into an injectable, an aerosol spray, product for dermal administration and the like using a pharmaceutically acceptable vehicle well known in the art.
(42) The pharmaceutical composition of the present invention can be administered to a patient by oral or parenteral administration. Parenteral administration is preferred. Examples of the route of administration include intravenous injection, intramuscular injection, intraperitoneal injection, subcutaneous injection, intrarectal administration, transnasal administration, transpulmonary administration, transcutaneous administration and the like. The dosage can be selected from a range of 0.0001 mg to 1000 mg/kg of body weight for a single dose. The route of administration and dose can be selected as needed by the attending physician in consideration of the age of the patient, severity of symptoms, concomitant drugs, and the like.
(43) The content of all patents and reference documents specifically cited in the present description are hereby incorporated by reference in its entirety.
(44) The present invention is described in greater detail below through the following examples, but is by no means limited by the examples.
Example 1
Bone Marrow Transplantation (BMT)
(45) Acute GVHD was induced in mice via allogeneic bone marrow transplantation. BALB/c (H-2.sup.d) mice were used as the recipients, C57BL/6 (H-2.sup.b) mice were used as the allogeneic BMT donors, and BALB/c (H-2.sup.d) mice were used as the syngeneic BMT donors. All mice were 7 to 12 weeks old (Sankyo Labo Service Corporation, Japan).
(46) On the day of BMT, the donor mice were sacrificed by cervical dislocation. Donor bone marrow cells were collected by flushing the shaft of the femur and tibia. The cells were placed in modified Eagle's medium containing 2% fetal calf serum/1% penicillin-streptomycin, and prepared as a single cell suspension. The cells were rinsed with RPMI 1640 medium and resuspended in that same medium. The bone marrow cell inoculum was prepared to contain 210.sup.7 bone marrow cells/200 L for allogeneic BMT and 110.sup.6 bone marrow cells/100 L for syngeneic BMT.
(47) The recipient BALB/c mice were raised on acidic water for at least 7 days before BMT to prevent sepsis after a lethal dose of radiation. The recipient mice were given a total of 8.5 Gy of total body irradiation at a rate of 0.34 Gy/min, and within 3 hours after irradiation the donor bone marrow cells were injected intravenously via the caudal vein.
(48) Monitoring of GVHD
(49) The recipient mice were observed every day for clinical signs of GVHD, i.e., weight loss, hunched posture, skin erythema, alopecia, and diarrhea. In the allogeneic BMT mice, clinical signs of acute GVHD, e.g., diarrhea and ruffled fur within 7 days post-transplantation, and skin erythema and alopecia within 21 days. Some animal deaths were found at days 14 and 21 post-transplantation.
(50) Histopathologic Analysis
(51) The recipient mice were sacrificed on post-transplantation days 7, 14, 21, and 28. The skin, liver, and small intestine were removed and fixed in 10% buffered formalin. The fixed tissue was embedded in paraffin, sections were prepared and stained with hematoxylin/eosin, and then observations were made under an optical microscope. Histologic changes thought to correspond to GVHD in typical organs were as follows: skin (mononuclear infiltration into the dermoepidermal junction, and damage to hair follicles or sebaceous glands); liver (periportal mononuclear infiltration and hepatocellular necrosis); and small intestine (apoptosis of crypt cells and dilatation or flattening of the villi). For each of these changes in the organs the scoring system assigned a score of zero for negative findings and a score of 1 for positive findings (the maximum possible score for each mouse was 6).
(52) Plasma Samples
(53) Blood samples were taken before BMT and on days 7, 14, 21, and 28 after BMT. The blood samples were collected using a heparin-coated capillary tube from the caudal veins of living mice, and centrifuged at 10,000 rpm for 5 min within 30 min to prepare plasma. The plasma samples were stored at 80 C. until assay.
Example 2
SELDI Protein Chip Array Analysis
(54) To 10 L of each plasma sample was added 20 L of a solution comprising 9 mol/L urea and 10 g/L CHAPS in Tris-HCl (pH 7.4). The mixture was mixed for 15 min at 4 C. with a vortex mixer, and was then diluted to 1:40 in Tris-HCl. Eight-spot immobilized metal affinity capture arrays (IMAC-30) were activated with 50 mmol/L CuSo.sub.4. Diluted samples (50 L) were applied to each spot of the protein chip array, and incubated for 1 h on a shaker. After washed with the same Tris-HCl, the chip was gently rinsed with water, and 0.5 L of saturated sinapinic acid (SPA) was applied twice to each spot, and then air-dried. The mass/charge (m/z) spectra of the proteins bound to the chelated metal were measured using a Ciphergen Protein Biology System II Time-Of-Flight mass spectrometer (PBS II, Ciphergen Biosystems, Inc.) The data were calculated by averaging 65 laser shots obtained at a laser intensity of 200 and a detector sensitivity of 8.
(55) Statistical Analysis of SELDI-TOF MS
(56) All spectra were compiled and the data was preliminary analyzed using Ciphergen Protein Chip Software 3.2.0. For the plasma samples, 50 samples from the GVHD group (post-transplantation days 7, 14, 21, and 28) and 28 samples from the control group (before BMT) were used for a total of 78 samples. A total of 169 peaks that appeared to differ were detected in the range of m/z=2 k to 200 k. When peaks with a change in intensity of 5-fold or greater and a level of significance of p<0.05 were extracted by making a comparison between the two groups using Biomarker Pattern's Software, in the GVHD group there were 10 peaks that were higher and 9 peaks that were lower than in the control.
(57) Protein Profiling by SELDI-TOF MS
(58) The 169 peaks in the above mass range of 2.0 to 200 kDa was further analyzed using the peak intensity values. A classification tree was developed with Biomarker Pattern's Software (BPS, Ciphergen Biosystems, Inc.) using all 169 peaks by a cross variation procedure. Simply put, in a classification tree the data are split into two nodes using one rule at a time in the form of a question. In this study the splitting decisions were made based on the normalized intensity level of peaks or clusters identified from the SELDI protein expression profile. In other words, each peak or cluster identified from the SELDI profile becomes a variable in the classification process. The splitting process was continued until terminal nodes were reached and further splitting yielded no gain in data classification.
(59) A plurality of classification trees were generated using this process, and the best performing tree was selected based on classification tree analysis. As a result, a peak at 8972 Da was selected as one peak that was significantly higher in the GVHD group than in the control group. The 8972 Da peak provided differentiation of the GVHD group and the control group at 100% both in terms of sensitivity and specificity.
(60)
(61) CsA Treatment Model
(62) Cyclosporin-A (CsA) (Novartis Pharma), a therapeutic drug for GVHD, was diluted to 1.67 mg/mL in a 0.9% NaCl solution. CsA was administered intraperitoneally at a dose of 20 mg/kg daily from post-transplantation day 8 through day 13.
(63) Syngeneic Transplantation Model
(64) In an syngeneic transplantation model using BALB/c mice with a bone marrow graft transplanted from a BALB/c mouse, GVHD was not induced, and no significant difference in average peak expression was found between pre-transplantation and post-transplantation samples (
Example 3
Separation of Proteins
(65) The three most abundant proteins in the plasma (albumin, IgG, transferrin) were removed from the pooled plasma sample by immunodepletion chromatography (Multiple Affinity Removal Column MS-3, 4.6 mm ID50 mm; Agilent). A 5-fold dilution of 50 L of plasma in Buffer A (Agilent) was prepared and injected into the immunodepletion column. The flow-through fractions were collected and further separated by high-performance liquid chromatography (HPLC). The separation column used in HPLC was an Inertsil Ph column (5 m, 4.6 mm ID150 mm; GL Sciences, Japan). The elution gradient profile was as follows: (1) Elution solvent A: 2% ACN/0.1% TFA, solvent B: 80% ACN/0.1% TFA; (2) Linear gradient: 0 to 100% for solvent B for 50 min; flow rate 1.0 mL/min.
(66) The fractions were collected at 30 sec intervals, 2 L of each fraction was applied to an Au chip (Cipheragen), processed with an SPA matrix, and the composition of each fraction was monitored by SELDI-TOF MS. The HPLC fraction from 31.0 to 31.5 min (approximately 38% acetonitrile) was collected based on SELDI-TOF MS monitoring. A large amount of the 8972 Da protein was contained in the GVHD sample, but almost none was present in the control sample (
(67) Next, the sample concentrated in that manner was separated with two-dimensional electrophoresis. After sonication the sample solutions were loaded onto IPG gel strips (pH 3-11, NL, 11 cm long, Amersham Bioscience), and the strips were rehydrated for 10 hours at 30 V. The first-dimensional separation by isoelectric focusing (IEF) was performed at 20 C. for a total of 12 kV/hr using the IPGphor system (Amersham Bioscience). After IEF, the IPG strips were equilibrated for 15 min in 50 mM Tris-HCl (pH 8.8) containing 6 M urea, 2% SDS, 30% glycerol, 0.002% bromophenol blue, and 1% dithiothreitol. Next, the strips were equilibrated for 15 min in the same buffer except 2.5% iodoacetamide replaced the dithiothreitol. For the second-dimensional separation, SDS-PAGE was performed using a polyacrylamide gel with an 8 to 20% gradient at a constant current of 40 mA/gel. After two-dimensional electrophoresis, the proteins were made visible by silver nitrate staining. By comparing the images of the two gels from the GVHD and control samples, a spot located at 6,500 Da to 12,300 Da was identified that was highly expressed in the GVHD sample (
(68) Protein Identification
(69) The spot of the 8972 Da candidate protein was digested in the gel. In short, the gel spot was cut out and washed with 100% ACN and 100 mM NH.sub.4HCO.sub.3, vacuum dried, and incubated at 37 C. for 16 hours in 5 L of trypsin solution (12.5 ng/L in 50 mM NH.sub.4HCO.sub.3 and 5 mM CaCl.sub.2). The resulting peptides were extracted once in 20 L of 20 mM NH.sub.4HCO.sub.3 and three times in 20 L of 5% formic acid in 50% ACN. The collected extracts were vacuum dried to approximately 40 L, and analyzed by nanoflow HPLC-ESI-MS/MS. For HPLC a DiNa system (KYA Technology) was used, and the trypsin-digested samples were separated on a HIQsil C18 column (75 m ID50 mm; KYA Technology). The separation conditions were as follows: Elution solvent A: 0.1% formic acid, solvent B: 0.1% formic acid in 70% ACN; gradient: 0 to 100% for solvent B for 40 min; flow rate: 200 nL/min. The properties of the separated peptides were determined using a QSTAR XL Q-TOF mass spectrometer (Applied Biosystems). A search of the NCBI protein database was performed with MASCOT software (Matrix Science Inc.) using the obtained mass spectral data.
(70) The result of the search showed that a partial amino acid sequence of the 8972 Da protein matched the sequence of a CCL8 precursor.
(71) TABLE-US-00001 (SEQIDNO:1) 1 MKIYAVLLCLLLIAVPVSPEKLTGPDKAPVTCCFHVLKLKIPLRVLKSYE 51 RINNIQCPMEAVVFQTKQGMSLCVDPTQKWVSEYMEILDQKSQILQP
(72) The predicted mass of the CCL8 precursor is 11,017 Da, and the predicted pI is 8.64. The CCL8 precursor contains a signal peptide of 19 amino acids followed by a mature CCL8 sequence of 78 amino acid residues. The predicted mass of the mature CCL8 is 8972 Da, and the predicted pI is 8.45. These numbers are consistent with the data obtained by SELDI-TOF MS and two-dimensional electrophoresis (2D-PAGE).
Example 4
Verification of CCL8 Expression by Immunoassay
(73) The fact that the 8972 Da marker is CCL8 was verified by SELDI immunoassay using a specific anti-mouse CCL8 rabbit antibody. To each spot on a PS20 (preactivated surface) ProteinChip (Ciphergen Biosystems) was added 0.1 g of anti-mouse CCL8 antibody, and the chip was incubated for 2 hours at room temperature in a humidified chamber. After the residual active sites were blocked for 30 min with 5 L of 1M ethanolamine (pH 8.0), the spots were washed three times with 0.5% Triton X-100 in PBS and twice with PBS. The plasma sample was diluted 1:75 in PBS, applied to the antibody-immobilized spots on the PS20 chip, and incubated for 2 hours with gentle mixing at room temperature using a bioprocessor. Each spot was washed twice with 0.5% Triton X-100 in PBS and twice with PBS. After a brief wash with 5 mM HEPES, SPA matrix was added, and MS analysis was performed using a PBS II ProteinChip reader. CCL8 was detected in the GVHD plasma sample, but was only barely detected in the control sample (
Example 5
CCL8 Expression in Human Clinical Samples
(74) Plasma obtained from patients that had undergone bone marrow transplantation was diluted 1:25 in PBS and used for human clinical samples. As in Example 4, a PS20 ProteinChip was used together with an anti-human CCL8 antibody to investigate the expression of CCL8 in human patients by SELDI immunoassay.
(75) Patient 1 (
(76) Five-year-old male
(77) Diagnosis: Fanconi anemia
(78) Treatment: Umbilical cord blood stem cell transplantation from unrelated donor (CBSCT (UR))
(79) Prophylaxis: CsA+MMF
(80) Course: GVHD first developed on post-transplantation day 13 with a skin rash, and methylprednisolone (mPSL) therapy was started the same day. CCL8 was detected on post-transplantation day 10 before the clinical manifestation of GVHD. The level of CCL8 temporarily decreased with this treatment. However, the amount of CCL8 expression rose once again together with the recurrence of GVHD. The patient had responded to treatment at first, but ultimately died due to treatment-resistant GVHD. The amount of CCL8 expression correlated with the development of GVHD and therapeutic efficacy. The level of CCL8 no longer fell after resistance to therapy developed.
(81) Patient 2 (
(82) Ten-year-old male
(83) Diagnosis: Chronic myelogenous leukemia (CML)
(84) Treatment: Bone marrow transplantation from unrelated donor (BMT (UR))
(85) Prophylaxis: FK+MTX
(86) Course: GVHD first developed on post-transplantation day 19 with a skin rash, and methylprednisolone (mPSL) therapy was started the same day. On that day the level of CCL8 showed a clear increase. The GVHD progressed temporarily from stage 2 to stage 3, but improved with therapy, and a high level of CCL8 expression was not found thereafter.
(87) Patient 3 (
(88) Three-year-old female
(89) Diagnosis: Acute lymphoblastic leukemia (ALL)
(90) Treatment: Bone marrow transplantation from matched sibling (BMT (matched-sib.))
(91) Prophylaxis: MTX
(92) Course: GVHD did not develop. No elevation of CCL8 expression was found at any time throughout the course.
(93) Patient 4 (
(94) Eleven-year-old female
(95) Diagnosis: Acute lymphoblastic leukemia (ALL)
(96) Treatment: Bone marrow transplantation from matched sibling donor (MSD-BMT)
(97) Prophylaxis: Short-term MTX
(98) Course: GVHD developed on post-transplantation day 11. The level of CCL8 expression showed an increase. On the same day cyclosporin-A was administered by continuous intravenous infusion (C.I.V.). On day 14 the symptoms of GVHD had improved, and the level of CCL8 expression had fallen.
(99) Patient 5 (
(100) A 19-year-old female with severe aplastic anemia underwent bone marrow stem cell transplantation from a parent without a matching HLA-1 antigen. The patient underwent pre-transplantation conditioning consisting of 150 mg/m.sup.2 fludarabine (Flu), 120 mg/kg cyclophosphamide (CY), and 24 mg/kg anti-thymocyte globulin (ATG), and prophylaxis for GVHD with tacrolimus. On day 10, the patient developed a high fever, and on day 16 an atypical skin rash appeared on the limbs and trunk, but without diarrhea. On day 20 the level of CCL8 showed a clear increase. On day 23 a skin rash biopsy was performed, and methylprednisolone (mPSL) therapy was started. On day 31 the symptoms of GVHD had improved, and the level of CCL8 expression had fallen.
Example 6
CCL8 Plasma Concentration in GVHD Patients and Normal Individuals
(101) The amount of CCL8 was quantified in the plasma of normal individuals, and among post-HSCT patients, in the plasma of those who developed GVHD and those who did not.
(102) The above results clearly indicate that there is a strong correlation between the amount of CCL8 expression and the development and course of GVHD in human patients.
Example 7
Infection and Differential Diagnosis
(103) The level of CCL8 expression was measured in mice administered a TLR ligand.
(104) Male BALB/c (H-2.sup.d) mice were purchased from Sankyo Labo Service Corporation (Tokyo, Japan). The mice were 8 to 10 weeks old at the start of testing. Unless otherwise indicated, all reagents were purchased from SIGMA/ALDRICH (Tokyo, Japan).
(105) Wild type BALB/c mice were given an intraperitoneal injection of 5 g lipopolysaccharide (LPS) (Escherichia coli), 5 g of poly(I:C) (GE Healthcare Bio-sciences, Tokyo, Japan), and 20 mg of D-GalN, 100 mg of peptide glycan (PGN (Staphylococcus aureus) (Invitrogen, CA, USA), 20 mg of Zymosan-A (Invitrogen, CA, USA), and 20 nmol Cpg-ODN (Invitrogen, CA, USA) in 500 L of PBS. The control mice were given an intraperitoneal injection of 500 of PBS. Four hours after the injection, a plasma sample was collected. The doses of LPS, poly(I:C), PGN, Zymosan-A, and CpG-ODN were determined by preliminary experiments.
(106) Four hours after the injection, the mouse blood was sampled using a heparin-coated syringe, and centrifugal separation was performed on the blood for 7 min at 5000 rpm within 30 min of sampling to obtain plasma. The divided plasma samples were stored at 80 C. until assay. Blood samples were collected from human volunteers and patients, plasma samples were prepared, and those divided samples were stored at 80 C. until assay.
(107) The human CCL8 was measured by enzyme-linked immunosorbent assay (ELISA). An ELISA kit for human CCL8 was purchased from RayBiotech (Norcross, Ga.), and the manufacturer's protocol was followed. The plates were read with a plate reader at 450 nm (Multiskan JX, Thermo Labsystems, Helsinki, Finland).
(108) The results were expressed as meanS.E. A statistical analysis for significance was performed using either a two-tailed or one-tailed t-test. The level of significance was set at p<0.05. A Bonferroni correction for multiple comparisons was used. The results shown are representative data for a series of tests.
(109) As shown in
Example 8
Diagnosis Before Manifestation of GVHD
(110) As in Example 1 syngeneic BMT was performed in mice, blood was collected on post-transplantation days 1, 3, 5, and 7, and heparin-plasma samples were obtained. The concentration of CCL8 in the plasma was quantified using ELISA for mouse CCL8.
(111) Change in weight from syngeneic BMT post-transplantation day 0 to 7 and weight loss, hunched posture, coat, skin, and diarrhea on day 7 were evaluated on a 3-step scale of 0, 1, or 2 points. A score of 0 was assigned to a weight loss of <10%; score of 1 to a weight loss of 10% to <25%; and score of 2 to a weight loss of 25%. For hunched posture, a score of 0 was assigned to a normal posture; score of 1 to a slightly hunched posture; and score of 2 to a very hunched posture. For coat, a score of 0 was assigned to normal; a score of 1 to slightly ruffled fur; and a score of 2 to whole body ruffled fur with almost no grooming. For skin, a score of 0 was assigned to normal skin; a score of 1 to visible sclerosis on the tail and legs; and a score of 2 to mice with patchy alopecia. For diarrhea, a score of 0 was assigned to normal; a score of 1 to slight diarrhea; and a score of 2 to full-blown diarrhea. The clinical GVHD score represents the total number of points for each criterion, and the maximum number of points is 10.
(112)
(113) Based on these findings it is believed that the quantitation of the CCL8 protein in the blood is useful for the pre-clinical or early stage diagnosis of GVHD in mice.
Example 9
Treatment of GVHD with Anti-CCL8 Antibody
(114) An anti-mouse CCL8 rabbit antibody was prepared by administering a synthesized CCL8 peptide to a rabbit, and purifying the anti-CCL8 IgG fraction from the resulting antiserum using an affinity column. An IgG fraction from the serum of a normal rabbit was used as a normal rabbit antibody control.
(115) Bone marrow transplantation was performed on mice as in Example 1. Anti-mouse CCL8 rabbit antibody or normal rabbit antibody was administered in a dose of 100 g to the recipient mouse via the caudal vein for 3 consecutive days counting from the day before allogeneic BMT. Three mice each were treated with anti-mouse CCL8 antibody (treatment group) and normal rabbit antibody (control group). On post-BMT day 14 the mice were sacrificed by cervical dislocation. The skin, liver and small intestine were removed and fixed in 10% buffered formalin. The fixed tissue was embedded in paraffin, sections were prepared and stained with hematoxylin/eosin, and then observations were made under an optical microscope to look for pathological signs considered indicative of GVHD. The scoring method was as follows: skin (infiltration of monocytes into the dermoepidermal junction, and damage to follicles or sebaceous glands); liver (periportal mononuclear infiltration and hepatocellular necrosis); and small intestine (apoptosis of crypt cells and dilatation or flattening of villi). Findings were given an interpretation of positive (+), intermediate (+/), or negative () on a 3-step scale.
(116) A typical image of stained skin tissue is shown in
(117)
INDUSTRIAL APPLICABILITY
(118) The present invention is useful for the diagnosis, course monitoring, and treatment of GVHD.