Agents providing controls and standards for immunoprecipitation assays

09631226 ยท 2017-04-25

Assignee

Inventors

Cpc classification

International classification

Abstract

Control agents for immunoprecipitation assays, methods of using the control agents and kits comprising the control agents are provided.

Claims

1. A method of validating a chromatin immunoprecipitation (ChIP) assay result, the method comprising: (a) obtaining an input sample of the genomic material of interest and of one or more polypeptide-oligonucleotide conjugate of the formula:
A-L-N, wherein A is a polypeptide comprising 5 amino acids, L is a linker and N is an oligonucleotide comprising 10 nucleotides, wherein the sequence of the 10 nucleotides of N uniquely identifies an amino acid sequence and/or amino acid modification of A wherein A comprises an amino acid sequence derived from a histone protein selected from the group consisting of histone HI, H2A, H2AX, H2B, H3 and H4, (b) performing a ChIP assay, thereby processing, in parallel to the genomic material of interest of (a), the one or more polypeptide-oligonucleotide conjugates of (a), (c) obtaining a processed sample of the polypeptide-oligonucleotide conjugate and the genomic material of interest processed in (b), and (d) analyzing the samples obtained in (c), thereby obtaining a value and/or signal for each of the analyzed processed samples, and (e) validating the ChIP assay result based on the value and/or signal obtained in (d).

2. The method of claim 1, wherein validating comprises one or more comparisons of the value and/or signal of the input sample and the value and/or signal of the processed sample of C1 with the value and/or signal of the input sample and the value and/or signal of the processed sample of C2, wherein (a) C1 is the genomic material of interest and C2 is a polypeptide-oligonucleotide conjugate, wherein C2 is a polypeptide-oligonucleotide conjugate immunoprecipitated with an antibody that is specific for the polypeptide-oligonucleotide conjugate (C2S), or C2 is a polypeptide-oligonucleotide conjugate immunoprecipitated with an antibody that is non-specific for the polypeptide-oligonucleotide conjugate (C2N), and/or (b) C1 is a polypeptide-oligonucleotide conjugate immunoprecipitated with an antibody that is specific for the polypeptide-oligonucleotide conjugate and C2 is a polypeptide-oligonucleotide conjugate immunoprecipitated with an antibody that is non-specific for the polypeptide-oligonucleotide conjugate.

3. The method of claim 2, wherein when (i) the value and/or signal of the processed sample in (a) of C1 and C2S is significantly higher than the value and/or signal of the input sample, then the genomic sample comprises an epitope specific for the antibody that is specific for C2S, (ii) the value and/or signal of the processed sample in (a) of C1 and C2N is significantly higher than the value and/or signal of the input sample, then the genomic sample is non-specifically amplified and the value or signal obtained is discarded, (iii) the value and/or signal of the processed sample in (a) of C1 is not significantly higher than the value and/or signal of the input sample and the value and/or signal of the processed sample of C2S is significantly higher than the value and/or signal of the input sample, then the genomic sample does not comprise an epitope specific for the antibody that is specific for C2S, (iv) the value and/or signal of the processed sample in (a) of C1 is significantly higher than the value and/or signal of the input sample and the value and/or signal of the processed sample of C2S is not significantly higher than the value and/or signal of the input sample, then the genomic sample is non-specifically amplified and the value or signal obtained is discarded, (v) the value and/or signal of the processed sample in (b) of C1 is significantly higher than the value and/or signal of the input sample and the value and/or signal of the processed sample of C2 is not significantly higher than the value and/or signal of the input sample, then the data obtained is analyzed, (vi) the value and/or signal of the processed sample in (b) of C1 and C2 is significantly higher than the value and/or signal of the input sample, then the data obtained is not analyzed and is discarded.

4. The method of claim 2, wherein the value and/or signal for the input sample and the processed sample are calculated as ratios.

5. A method of normalizing chromatin immunoprecipitation (ChIP) assay data, the method comprising: (a) obtaining an input sample of the genomic material of interest and of one or more of polypeptide-oligonucleotide conjugate of the formula:
A-L-N, wherein A is a polypeptide comprising 5 amino acids, L is a linker, and N is an oligonucleotide comprising 10 nucleotides, wherein the sequence of the 10 nucleotides of N uniquely identifies an amino acid sequence and/or amino acid modification of A wherein A comprises an amino acid sequence derived from a histone protein selected from the group consisting of histone HI, H2A, H2AX, H2B, H3 and H4, (b) performing a ChIP assay, thereby processing, in parallel to the genomic material of interest in (a), the one or more polypeptide-oligonucleotide conjugates of (a), (c) obtaining a processed sample of the polypeptide-oligonucleotide conjugate and the genomic material of interest processed in (b), (d) analyzing the samples obtained in (c), thereby obtaining a value and/or signal for each of the analyzed processed samples, and (e) normalizing the values and/or signals obtained in (d) for each of the processed samples using the values obtained in (d) for each of the input samples.

6. The method of claim 5, wherein parallel processing in (b) comprises contacting the genomic material with the one or more polypeptide-oligonucleotide conjugates.

7. The method of claim 6, wherein the contacting of the genomic material with the one or more polypeptide-oligonucleotide conjugates is performed after fragmentation of the genomic material and before the resulting sample is contacted with an antibody.

8. The method of claim 5, wherein performing a ChIP assay in (b) comprises one or more steps of: (a) fragmenting genomic material of interest, (b) contacting the fragmented genomic material and the one or more polypeptide-oligonucleotide conjugates with an antibody, (c) immobilizing the antibody and specifically bound material, (d) reducing the amount of non-specifically bound material, (e) releasing the specifically bound material from the antibody, (f) reversing a previous cross-linking reaction, (g) fragmenting proteinaceous material, and/or (h) purifying nucleic acid material.

9. The method of claim 5, wherein analyzing the processed sample in (d) comprises performing a polymerase-chain reaction, a sequencing reaction, and/or a hybridization reaction.

10. The method of claim 5, wherein normalizing in (e) comprises calculating ratios for input sample and processed sample for the genomic material and the one or more polypeptide-oligonucleotide conjugates.

11. The method of claim 1, wherein A comprises 5 consecutive amino acids derived from any one sequence selected from the group consisting of TABLE-US-00011 (SEQIDNO:1) SGRGKQGCKARAK, (SEQIDNO:2) VLLPKKTESHHKAKGK, (SEQIDNO:3) PEPAKSAPAPKKGSKKAVTK, (SEQIDNO:4) AVSEGTKAVTKYTSSK, (SEQIDNO:5) ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVK, (SEQIDNO:6) QRLVREIAQDFKTDLRFQSSAVMALQEA, and (SEQIDNO:7) SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLA.

12. The method of claim 1, wherein A comprises an amino acid modification.

13. The method of claim 12, wherein the amino acid modification is selected from the group consisting of acetylation, methylation (mono-, di-, tri-), phosphorylation, ubiquitination (mono-, di-, tri-, poly-), sumoylation, ADP-ribosylation, citrullination, biotinylation and cis-trans isomerization.

14. The method of claim 5, wherein A comprises 5 consecutive amino acids derived from any one sequence selected from the group consisting of TABLE-US-00012 (SEQIDNO:1) SGRGKQGCKARAK, (SEQIDNO:2) VLLPKKTESHHKAKGK, (SEQIDNO:3) PEPAKSAPAPKKGSKKAVTK, (SEQIDNO:4) AVSEGTKAVTKYTSSK, (SEQIDNO:5) ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVK, (SEQIDNO:6) QRLVREIAQDFKTDLRFQSSAVMALQEA, and (SEQIDNO:7) SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLA.

15. The method of claim 5, wherein A comprises an amino acid modification.

16. The method of claim 15, wherein the amino acid modification is selected from the group consisting of acetylation, methylation (mono-, di-, tri-), phosphorylation, ubiquitination (mono-, di-, tri-, poly-), sumoylation, ADP-ribosylation, citrullination, biotinylation and cis-trans isomerization.

Description

BRIEF DESCRIPTION OF THE FIGURES

(1) FIG. 1 is a schematic depicting some common posttranslational modifications of human nucleosomal histones. The modifications include acetylation (ac), methylation (me), phosphorylation (ph) and ubiquitination (ubl). Globular domains of each core histone are represented as ovals.

(2) FIGS. 2-1 and 2-2 are schematics depicting some common posttranslational modifications of histones and the names of the enzymes thought to be responsible for the modification. Globular domains of each core histone are represented as ovals.

(3) FIG. 3A is a schematic depicting various modifications that may occur at specific amino acid residues. FIG. 3B is a schematic depicting the modifications listed in FIG. 3A at their location on the histones.

(4) FIG. 4 is a schematic depicting various kits. The circles represent one or more receptacles for one or more reagents. The dotted lines represent various expanded kits that further contain optional receptacles/reagents that may be combined in any number or order with the polypeptide-oligonucleotide conjugate A-L-N.

DEFINITIONS

(5) Amino acids may be referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Amino acid residues in proteins or peptides are abbreviated as follows: phenylalanine is Phe or F; leucine is Leu or L; isoleucine is Ile or I; methionine is Met or M; valine is Val or V; serine is Ser or S; proline is Pro or P; threonine is Thr or T; alanine is Ala or A; tyrosine is Tyr or Y; histidine is His or H; glutamine is Gln or Q; asparagine is Asn or N; lysine is Lys or K; aspartic acid is Asp or D; glutamic Acid is Glu or E; cysteine is Cys or C; tryptophan is Trp or W; arginine is Arg or R; and glycine is Gly or G. For further description of amino acids, see Proteins: Structure and Molecular Properties by Creighton T. E. (1983), W. H. Freeman & Co., New York, incorporated herein by reference.

(6) The term amino acid refers to naturally occurring and non-natural amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids. Naturally encoded amino acids are the 20 common amino acids (alanine, arginine, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine, and valine) and pyrrolysine and selenocysteine. Amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, i.e., an a carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, such as, homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs have modified R groups (such as, norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid.

(7) A non-natural amino acid refers to an amino acid that is not one of the 20 common amino acids, pyrrolysine or selenocysteine; The term non-natural amino acid includes, but is not limited to, amino acids that occur naturally by modification of a naturally encoded amino acid (including but not limited to, the 20 common amino acids or pyrrolysine and selenocysteine) but are not themselves incorporated into a growing polypeptide chain by the translation complex. Examples of naturally-occurring amino acids that are not naturally-encoded include, but are not limited to, N-acetylglucosaminyl-L-serine, N-acetylglucosaminyl-L-threonine, and O-phosphotyrosine.

(8) As to amino acid sequences, one of skill will recognize that individual substitutions, deletions or additions to a nucleic acid, peptide, polypeptide, or protein sequence which alters, adds or deletes a single amino acid or a small percentage of amino acids in the encoded sequence is a conservatively modified variant where the alteration results in the substitution of an amino acid with a chemically similar amino acid. Conservative substitution tables providing functionally similar amino acids are known to those of ordinary skill in the art. Such conservatively modified variants are in addition to and do not exclude polymorphic variants, interspecies homologs/orthologs, and alleles of the agents described herein.

(9) Conservative amino acid substitutions are amino acid substitution in which the substituted amino acid residue is of similar charge as the replaced residue and/or is of similar or smaller size than the replaced residue. Conservative substitutions of amino acids include substitutions made amongst amino acids within the following groups: (a) the small non-polar amino acids, A, M, I, L, and V; (b) the small polar amino acids, G, S, T, and C; (c) the amido amino acids, Q and N; (d) the aromatic amino acids, F, Y, and W; (e) the basic amino acids, K, R, and H; and (f) the acidic amino acids, E and D. Substitutions which are charge neutral and which replace a residue with a smaller residue may also be considered conservative substitutions even if the residues are in different groups (e.g., replacement of phenylalanine with the smaller isoleucine). Methods for making amino acid substitutions, additions, or deletions are well known in the art, e.g., polymerase chain reaction (PCR)-directed methods (Molecular Biology: Current Innovations and Future Trends. by Griffin A. M. and Griffin H. G. (1995) Horizon Scientific Press, Norfolk, U.K; Modern Genetic Analysis. by Griffith A. J., Second Edition, (2002) H. Freeman and Company, New York, N.Y.).

(10) An antigen as used herein may be any amino acid fragment (modified or unmodified) of 5 amino acids or more which are recognized by an antibody or for which recognizing antibodies can be raised. In certain embodiments, antigens may comprise modifications of an amino acid, such as acetylation, methylation (e.g. mono-, di-, tri-), phosphorylation, ubiquitination e.g. mono-, di-, tri-, poly-), sumoylation, ADP-ribosylation, citullination, biotinylation, and cis-trans isomerization. In other embodiments, antigens may comprise specific mutations, such as point mutations. In other yet embodiments, antigens may comprise wild-type amino acid sequence.

(11) A bifunctional linker refers to a polymer comprising two discrete functional groups that are capable of reacting specifically with other moieties (including but not limited to, NH.sub.2, SH, COOH, CO, and C.sub.nH.sub.n groups) to form covalent or non-covalent linkages. Many procedures and linker molecules for attachment of various compounds to peptides are known. e.g. U.S. Pat. Nos. 4,671,958; 4,659,839; 4,680,338; and 4,569,789. A bi-functional linker or multi-functional linker may be any desired length or molecular weight, and may be selected to provide a particular desired spacing or conformation between one or more molecules linked to the polypeptide.

(12) The terms polypeptide, peptide and protein are used interchangeably herein to refer to a polymer of amino acid residues. That is, a description directed to a polypeptide applies equally to a description of a peptide and a description of a protein, and vice versa. The terms apply to naturally occurring amino acid polymers as well as amino acid polymers in which one or more amino acid residues is a non-natural amino acid. As used herein, the terms encompass amino acid chains of any length, including full length proteins, wherein the amino acid residues are linked by covalent peptide and/or pseudopeptide bonds.

(13) The term post-translational modification refers to any modification of a natural or non-natural amino acid that occurs or would occur to such an amino acid after it has been incorporated into a polypeptide chain in vivo or in vitro. Such modifications include, but are not limited to, acetylation, methylation (e.g. mono-, di-, tri-), phosphorylation, ubiquitination (e.g. mono-, di-, tri-, poly-), sumoylation, ADP-ribosylation, citullination, biotinylation, and cis-trans isomerization. Such modifications may be introduced synthetically, e.g. chemically, during polypeptide synthesis or enzymatically after polypeptide synthesis or polypeptide purification.

(14) By screen or screening is meant to test a compound (e.g. an antibody) with a particular characteristic or desired property. Testing may be conducted in vivo or in vitro, for example in a biochemical assay, such as those described herein. These characteristics or desired properties of the compound (e.g. antibody) may be chemical, biological, or physical in nature or a combination thereof. Desired characteristics or desired properties of antibodies in ChIP may, for example, be high affinity and/or high specificity for a particular antigen of interest.

DETAILED DESCRIPTION OF CERTAIN EMBODIMENTS OF THE INVENTION

(15) Controls for immunoprecipitation assays, e.g., ChIP assays, that are currently used have several major drawbacks with regard to their specificity and their ability to distinguish between true and false negative or positive results obtained by the procedure. For example, a positive antibody control for the ChIP technique that is commonly used is Histone H3 (tri methyl K4) when analyzing active genes. As a negative control, use of an antibody that recognizes a non-chromatin epitope, such as an anti-GFP antibody, is common. Such control antibodies however, do not validate the ChIP procedure (i.e. are not positive and negative controls for the success of the ChIP experiment) per se. For example, if Histone H3 tri methyl K4 is absent at the particular genomic locus of interest, then even a highly efficient and specific ChIP antibody will not immuno-precipitate chromatin from this region and thus will not be an appropriate positive control. An anti-GFP antibody will not provide a good negative control for non-specific binding of antibodies directed to histone modifications. Further, chromatin remodeling may move or remove histones at a particular locus e.g. an active promoter, so use of a control antibody against a non-modified histone, such as Histone H3, may be necessary to confirm the preservation of nucleosomes at particular genomic loci. If a ChIP signal is weak or non-existent, troubleshooting may include use of different antibody, optimizing of the cross-linkage time course, the fragmentation, binding, wash, and/or elution conditions. Current ChIP protocols recommend using purified histone H3 and H1 as positive controls for the quality of the experimental histone preparation, when analyzing histone modifications.

(16) Existing technologies for ChIP antibody validation and ChIP quality controls, e.g. using primer and probe sets specific for particular genes or chromatin regions. For example, probes and primers may be provided for certain housekeeping gene loci, tissue-specific gene loci, heterochromatic loci or gamma actin loci (Abcam, Cambridge Mass.). These control kits can be limiting in that the source material can only be detected by the primer/probe pairs in a species-specific manner (e.g. to human genes, such as hsGAPDH, hsMyoD, hsSATa, and hsAct1) and in that the histone modification, for which a control is necessary, needs to be determined prior to conducting the ChIP assay. For example, hsGAPDH primer/probe sets may provide a positive control for a specific histone modification associated with active gene transcription, such as Histone H3 K9 acetylation, and may provide a negative control for a specific histone modification associated with silencing, such as Histone H3 K9 tri methylation. hsMyoD primer/probe sets may provide a positive control for a specific histone modification associated with gene silencing, such as Histone H3 K27 dimethylation, and may provide a negative control for a specific histone modification associated with active gene transcription, such as Histone H3 K9 acetylation. hsSATa primer/probe sets may provide a positive control for a specific histone modification associated with heterochromatin, such as Histone H3 K9 trimethylation, and may provide a negative control for a specific histone modifications associated with active gene transcription, such as Histone H3 K4 trimethylation.

(17) These controls are based on empirically acquired knowledge of specific gene regions and since biological systems are dynamic, these controls can vary, for example, between cell types or between the same cells exposed to different conditions. These controls are not available for all of the known histone modifications. Moreover, it is very difficult to obtain and/or use such controls for assays that analyze non-histone proteins, such as DNA-binding proteins (chromatin-associated factors, e.g. transcription factors, activator/repressor complex constituents, DNA replication or DNA repair factors, etc.) and non-histone modifications, such as, for example, post-translational modifications of transcription factors.

(18) Further, as it is difficult to combine these controls in cases involving several modifications that are probed in a ChIP assay these control experiments would need to be conducted sequentially, requiring more sample and more hands-on time.

(19) Polypeptide-Oligonucleotide Conjugates as Controls for IP Assayse.g., ChIP:

(20) It would be a distinct advantage to be able to monitor the steps of an ChIP protocol and its efficiency using just one set of antibodies, for example those that are directed to the histone modification of interest, and to have specific control agents that can undergo all the process steps required for ChIP in parallel to the genomic material. Pre-determined amounts of such control could, for example, be added to the assay at the beginning of the immunoprecipitation procedure (e.g. at the step when fragmented chromatin is contacted with the ChIP antibody). Further it would be useful to provide a pool of controls for several histone modifications that can be processed in parallel without the need to determine the control prior to performing the ChIP assay.

(21) Provided herein are IP assays (e.g., ChIP assays) control agents that are i) specific for an antigen of interest (e.g. a post-translational histone modification or non-histone protein modification and corresponding unmodified sequences) and ii) can be pooled. In certain embodiments, the ChIP assays control agents may be provided as part of a kit, for example a kit that comprises one or more additional reagents necessary to perform ChIP assays and or nucleic acid sequence analysis.

(22) Provided herein are polypeptide-oligonucleotide conjugates of the general formula:
A-L-N,
wherein A is a polypeptide of at least 5 amino acids, L is a linker, and N is an oligonucleotide of at least 10 bases as ChIP assays control agents.

(23) A as used herein consists of at least 5 amino acids. In certain embodiments, A is 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, or 150 amino acids. In certain embodiments, A is 151 or more amino acids. In certain embodiments, A is 5-15, 5-25, 5-50, 5-100, 5-250, 5-500, 5-1000, 5-2500, 5-5000, 5-10,000, 5-25,000, 5-50,000 or 5-100,000 amino acids.

(24) In certain embodiments, A comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 18, 19, 20 or more amino acids at least in part derived from a histone protein, such as, for example, histone H2A, H2B, H3, or H4. In certain embodiments, A comprises 5-15, 5-25, 5-50, 5-100, 5-250, 5-500, 5-1000, 5-2500, 5-5000, 5-10,000, 5-25,000, or 5-50,000 amino acids at least in part derived from a histone protein, such as histone H2A, H2B, H3, or H4. In certain embodiments, A comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 18, 19, 20 or more (up to the total amino acid sequence of the histone) amino acids derived from the N-terminus of a histone protein, such as the N-terminus of histone H2A, H2B, H3, or H4. In other embodiments, A comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 18, 19, 20 or more (up to the total amino acid sequence of the histone) amino acids derived from the C-terminus of a histone protein, such as the C-terminus of histone H2A, H2B, H3, or H4. In certain embodiments, A comprises an amino acid sequence of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 18, 19, 20 or more (up to 36) amino acids of the following sequences: H2A N-terminus: SGRGKQGCKARAK (SEQ ID NO: 1) H2A C-terminus: VLLPKKTESHHKAKGK (SEQ ID NO: 2) H2B N-terminus: PEPAKSAPAPKKGSKKAVTK (SEQ ID NO: 3) H2B C-terminus: AVSEGTKAVTKYTSSK (SEQ ID NO: 4) H3 N-terminus: ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVK (SEQ ID NO: 5) H3 globular domain: QRLVREIAQDFKTDLRFQSSAVMALQEA (SEQ ID NO: 6) H4 N-terminus: SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLA (SEQ ID NO: 7)

(25) In certain embodiments, A comprises an amino acid sequence of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 18, 19, 20 or more (up to 36) amino acids of SEQ ID NOs: 1-7, wherein one or more of the amino acids is modified. In certain embodiments, the one or more modification is an acetylation, a methylation (e.g. mono-, di-, tri-), a phosphorylation, or an ubiquitination (e.g. mono-, di-, tri-, poly-), sumoylation, ADP-ribosylation, citullination, biotinylation, or cis-trans isomerization.

(26) In certain embodiments, A comprises:
X.sub.nY[M]X.sub.n,
wherein X is an amino acid, n is a number of amino acids, Y is a modified amino acid, M is a modification. n in certain embodiments, is 0-15, 0-25, 0-50, 0-100, 0-150, 0-250, 0-500, 0-1000, 0-2500, 0-5000, 0-10,000, 0-25,000, or 0-50,000 amino acids.

(27) Non-limiting examples of A comprising either no modifications or one or more modifications are: 1) Non-limiting examples for A derived from H2A are:

(28) TABLE-US-00001 (SEQIDNO:8) X.sub.nS[ph]GRGX.sub.n, (SEQIDNO:9) X.sub.nGRGK[ac]QGCX.sub.n, (SEQIDNO:10) X.sub.nS[ph]GRGKQGCX.sub.n, (SEQIDNO:11) X.sub.nSGRGK[ac]QGCX.sub.n, (SEQIDNO:12) X.sub.nQGCK[ac]ARAX.sub.n, (SEQIDNO:13) X.sub.nK[ub]TESX.sub.n, (SEQIDNO:14) X.sub.nKT[ph]ESHX.sub.n, (SEQIDNO:15) X.sub.nK[ub]TESHX.sub.n, (SEQIDNO:16) X.sub.nKT[ph]ESHX.sub.n, (SEQIDNO:17) X.sub.nSGRGKQGCKARAKX.sub.n (SEOIDNO:18) X.sub.nVLLPKKTESHHKAKGKX.sub.n 2) Non-limiting examples for A derived from H2B are:

(29) TABLE-US-00002 (SEQIDNO:19) X.sub.nPEPAK[ac]SX.sub.n, (SEQIDNO:20) X.sub.nK[ac]GSKKX.sub.n, (SEQIDNO:21) X.sub.nKGS[ph]KKX.sub.n, (SEQIDNO:22) X.sub.nKGSK[ac]KX.sub.n, (SEQIDNO:23) X.sub.nK[ub]AVTKYTSSX.sub.n, (SEQIDNO:24) X.sub.nPAPKK[ac]GSKKAX.sub.n (SEQIDNO:25) X.sub.nPAPKKGSK[ac]KAVTKX.sub.n,, (SEQIDNO:26) X.sub.nKGS[ph]KKX.sub.n, (SEQIDNO:27) X.sub.nPEPAKSAPAPKKGSKKAVTKX.sub.n (SEQIDNO:28) X.sub.nAVSEGTKAVTKYTSSKX.sub.n 3) Non-limiting examples for A derived from H3 are:

(30) TABLE-US-00003 (SEQIDNO:29) X.sub.nARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKX.sub.n, (SEQIDNO:30) X.sub.nAR[me]TKX.sub.n, (SEQIDNO:31) X.sub.nRT[ph]KX.sub.n, (SEQIDNO:32) X.sub.nARTK[me]QTAX.sub.n, (SEQIDNO:34) X.sub.nARKS[ph]TGGK[ac]APRX.sub.n (SEQIDNO:35) X.sub.nARTKQTAR[me]KSTGGKAX.sub.n, (SEQIDNO:36) X.sub.nRKST[ph]GGK[ac]AP.sub.n, (SEQIDNO:37) X.sub.nARTKQTARKSTGGKAPRKQLATKAAR[me]KSAPATGGVKX.sub.n, (SEQIDNO:38) X.sub.nR[me]KSAX.sub.n, (SEQIDNO:39) X.sub.nARK[me]SAPX.sub.n, (SEQIDNO:40) X.sub.nRK[ac]SAX.sub.n, (SEQIDNO:41) X.sub.nS[ph]APAX.sub.n, (SEQIDNO:42) X.sub.nQRLVREIAQDFKTDLRFQSSAVMALQEAX.sub.n (SEQIDNO:43) X.sub.nDFK[me]TDX.sub.n (SEQIDNO:44) X.sub.nK[me]TDLRFQSSX.sub.n (SEQIDNO:45) X.sub.nARTKQTARKS[ph]TGGKAPRKQLATKAARKS[ph]APATGGVKX.sub.n (SEQIDNO:46) X.sub.nARKS[ph]TGGK[ac]APRX.sub.n (SEQIDNO:47) X.sub.nRTK[me]QTARK[me]STX.sub.n (SEQIDNO:48) X.sub.nTK[me]QTARK[me]STGGKAPRKQLATKAARK[me]SAPATX.sub.n 4) Non-limiting examples for A derived from H4 are:

(31) TABLE-US-00004 (SEQIDNO:49) X.sub.nS[ph]GRX.sub.n (SEQIDNO:50) X.sub.nSGR[me]GKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLAX.sub.n (SEQIDNO:51) X.sub.nSGRGK[ac]GGKX.sub.n (SEQIDNO:52) X.sub.nSGRGKGGK[ac]GLGKGGAKRHRKVLRX.sub.n (SEQIDNO:53) X.sub.nGKGGKGLGK[ac]GGAKRX.sub.n (SEQIDNO:54) X.sub.nGKGGAK[ac]RHRKVLRDNIQGITKX.sub.n (SEQIDNO:55) X.sub.nK[me]VLX.sub.n (SEQIDNO:56) X.sub.nKGLGKGGAKRHRK[me]VLRDNIQGITKX.sub.n (SEQIDNO:57) X.sub.nSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLAX.sub.n (SEQIDNO:58) X.sub.nGRGK[ac]GGKGLGK[ac]GGAKRHX.sub.n (SEQIDNO:59) X.sub.nGGK[ac]GLGKGGAK[ac]RHX.sub.n,

(32) wherein [ac] is acetylation, [ph] is phosphorylation, [ub] is ubiquitination, [me] is mono-, di- or tri-methylation, X is any amino acid and n is a number of amino acids. n in certain embodiments, is 0-15, 0-25, 0-50, 0-100, 0-150, 0-250, 0-500, 0-1000, 0-2500, 0-5000, 0-10,000, 0-25,000, or 0-50,000 amino acids. Other modifications are known in the art and are depicted for example in FIGS. 1, 2, and 3. The examples given here are for illustrative purposes only and are not meant to be limiting in any way. One of ordinary skill would know how to modify the examples given here for A, for example, the number of amino acids derived from the wild-type sequence of histones H2A, H2B, H3, and H4 exemplified here may be reduced or additional wild-type sequence may be added (N- and/or C-terminal of the exemplified sequence), one or more amino acids may be changed, e.g. using a conservative amino acid exchange or a non-conservative amino acid exchange (for example species-specific exchanges to generate homologs/orthologs), one or more non-natural amino acids may replace the amino acids exemplified, pseudopeptide units may be inserted, additional combinations of modifications e.g. acetylation, phosphorylation, ubiquitination, mono-, di- or tri-methylation, sumoylation, ADP-ribosylation, citullination, biotinylation, and cis-trans isomerization may be generated. Such modifications are well within the skills of an ordinary artisan (and depicted in FIGS. 3A and 3B), any desired A segments may be generated and all such A segments are contemplated herein. For example, lysine (K) may be acetylated, sumoylated, ubiquitinated, biotinylated, or methylated; arginine (R) may be methylated, citullinated or ADP-ribosylated; glutamic acid (E) may be ADP-ribosylated; serine (S) and threonine (T) may be phosphorylated, and proline may be cis-trans-isomerated as depicted in FIGS. 3A and 3B. Such modifications may be specific to certain histones or all histones. Modifications may also be specific to certain species, such as mammals (human, mouse, rat, hamster, dog, cat, monkey, horse, sheep, cow), fish (e.g. zebrafish), yeast (e.g. Saccharomyces cerevisiae, Schizosaccharomyces pombe, Candida albicans), plant (e.g. Arabidopsis thaliana, Nicotiana tabacum, corn, algae), fruit fly (e.g. Drosophila melanogaster), nematodes (Caenorhabditis elegans) and others.

(33) Further, additional A segments may be generated that comprise wild-type sequence of other histones, such as Histone H1 and H2AX. Histone H1, for example comprises a modification at lysine 26 (K26[me]) and histone H2AX comprises a modification at serine 139 (S139[ph]).

(34) A segments for any known histone modification may be generated, including, but not limited to:

(35) 1) Modifications for Histone H1, for example H1 (phospho S1+T3), H1 (phospho S35), H1 (acetyl K63);

(36) 2) Modifications for Histone H2A, for example H2A (asymmetric di methyl R3), H2A (symmetric di methyl R3), H2A (acetyl K5), H2A (mono methyl R17), H2A (symmetric di methyl R77), H2A (Hydroxy P26), H2A (mono methyl K125), H2A (tri methyl K125), H2A (mono methyl K127), H2A (tri methyl K127), H2A (phospho S129);

(37) 3) Modifications for Histone H2B, for example H2B (acetyl K5), H2B (di methyl K5), H2B (Hydroxy P10), H2B (di methyl K43);

(38) 4) Modifications for Histone H3, for example H3 (mono methyl R2), H3 (citrulline 2+8+17), H3 (mono methyl K4), H3 (di methyl K4), H3 (tri methyl K4), H3 (di+tri methyl K4), H3 (acetyl K9), H3 (acetyl K9, phospho S10), H3 (mono methyl K9), H3 (di methyl K9), H3 (tri methyl K9), H3 (phospho S10), H3 (asymmetric di methyl R17), H3 (acetyl K18), H3 (acetyl K27), H3 (di methyl K27), H3 (tri methyl K27), H3 (mono methyl K27, tri methyl K27+K4), H3 (mono methyl K36), H3 (tri methyl K36), H3 (Hydroxy P38), H3 (mono methyl K79), H3 (di methyl K79), H3 (tri methyl K79), H3 (mono+di+tri methyl K79), H3 (Hydroxy P121), H3 (tri methyl K122);

(39) 5) Modifications for Histone H4, for example H4 (symmetric di methyl R3), H4 (acetyl K8), H4 (acetyl K12), H4 (mono methyl K20), H4 (tri methyl K20), H4 (phospho T30), H4 (Hydroxy P32), H4 (tri methyl K59), H4 (phospho T80), H4 (acetyl K91), H4 (phospho T96).

(40) N as used herein consists of at least 10 nucleotides. In certain embodiments, N is 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 297, 298, 299, 300, 301, 302, 303, 304, 305, 306, 307, 308, 309, 310, 311, 312, 313, 314, 315, 316, 317, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331, 332, 333, 334, 335, 336, 337, 338, 339, 340, 341, 342, 343, 344, 345, 346, 347, 348, 349, 350, 351, 352, 353, 354, 355, 356, 357, 358, 359, 360, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382, 383, 384, 385, 386, 387, 388, 389, 390, 391, 392, 393, 394, 395, 396, 397, 398, 399, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 435, 436, 437, 438, 439, 440, 441, 442, 443, 444, 445, 446, 447, 448, 449, 450, 451, 452, 453, 454, 455, 456, 457, 458, 459, 460, 461, 462, 463, 464, 465, 466, 467, 468, 469, 470, 471, 472, 473, 474, 475, 476, 477, 478, 479, 480, 481, 482, 483, 484, 485, 486, 487, 488, 489, 490, 491, 492, 493, 494, 495, 496, 497, 498, 499, or 500 nucleotides. In certain embodiments, N is 10-25, 10-50, 10-100, 10-250, 10-500, 10-1000, 10-2500, 10-5000, 10-10,000, 10-25,000, 10-50,000 or 10-100,000 nucleotides.

(41) In certain embodiments, N comprises a nucleotide sequence that is unique for a certain species (e.g. mammal, fish, yeast, plant, etc.) and/or produces a product that when amplified (e.g. by PCR) is unique to the species. In certain embodiments, the unique nucleotide sequence of N may not hybridize to a genomic fragment derived from the species. In certain embodiments, primers amplifying a unique portion of N will not amplify a fragment of genomic DNA derived from the species. In certain embodiments, primers amplifying a unique portion of N will not efficiently amplify a fragment of genomic DNA derived from the species, such as, that the size of the amplified genomic fragment may be much larger than the size of the portion amplified in N.

(42) In certain embodiments, the nucleotide sequence of N is unique to the amino acid sequence and/or amino acid modification of A, such that each different nucleotide sequence (N) in a set of nucleotide sequences (N1, N2, N3, N4, N5, . . . ) uniquely identifies a different amino acid sequence and/or amino acid modification (A) in a set of such amino acid sequences and/or amino acid modifications (A1, A2, A3, A4, A5, . . . ). For example, if A1 is X.sub.nY[M.sub.1]X.sub.n, wherein X is an amino acid, n is a number of amino acids, Y is a modified amino acid, M.sub.1 is a modification, and A2 is X.sub.nY[M.sub.2]X.sub.n, wherein M.sub.2 is a different modification form M.sub.1, then N1 comprises a nucleotide sequence that is unique to A1 and N2 comprises a nucleotide sequence that is unique to A2. n in certain embodiments, is 0-15, 0-25, 0-50, 0-100, 0-150, 0-250, 0-500, 0-1000, 0-2500, 0-5000, 0-10,000, 0-25,000, or 0-50,000 amino acids. A unique sequence U may for example have a size from 10 nucleotides to 500 nucleotides, from 20 to 400, from 30 to 300, from 40 to 200, from 15 to 150, from 50 to 100, from 25 to 75, 45 to 65, or may be around 20, around 30, around 40, around 50, around 60, around 70, around 80, around 90, or around 100 nucleotides. In certain embodiments, U has a size from 10-1000, 10-2500, 10-5000, 10-10,000, 10-25,000, or 10-50,000 nucleotides. A unique sequence may differ from any other unique sequence by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 18, 19, 20 or more nucleotides. In certain embodiments, the unique sequence differs from any other unique sequence by 25, 50, 75, 100, 250, 500, 1000, 2500, 5000, 10,000, 20,000 or more nucleotides.

(43) In certain embodiments, N comprises:
x.sub.nP1-UP2x.sub.n,

(44) wherein x is any nucleotide, n is a number of nucleotides, P1 and P2 are primer sequences, and U is a unique sequence. In certain embodiments, the primer sequences can be between 10 and 35 nucleotides long, e.g. 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, or 35 nucleotides. In certain embodiments, the primer sequences can be 10-40, 10-45, 10-50, 10-55, 10-60, 10-65, 10-70, 10-75, 10-100, 10-250, 10-500, or 10-1000 nucleotides long. n in certain embodiments, is 0-15, 0-25, 0-50, 0-100, 0-150, 0-250, 0-500, 0-1000, 0-2500, 0-5000, 0-10,000, 0-25,000, 0-50,000 or 0-100,000 nucleotides.

(45) In certain embodiments, a specific A, comprising either X.sub.n or X.sub.nY[M]X.sub.n, is joined via a linker L with a specific N, comprising x.sub.nP1-UP2x.sub.n. In certain embodiments, wherein U is unique, P1 and P2 are the same for every specific A.

(46) For example, the following A segments may be joined via L with the following N segments of A-L-N:
X.sub.naY.sub.1[M.sub.1]X.sub.na-L-x.sub.nnP1-U.sub.1-P2x.sub.nn
X.sub.naY.sub.2[M.sub.2]X.sub.na-L-x.sub.nnP1-U.sub.2-P2x.sub.nn
X.sub.naY.sub.2[M.sub.2]X.sub.na-L-x.sub.nnP1-U.sub.3-P2x.sub.nn

(47) wherein X is an amino acid; na is a number of amino acids; Y.sub.1, Y.sub.2, Y.sub.3 are different modified amino acids; M.sub.1, M.sub.2, M.sub.3 are different modifications, wherein X.sub.naY.sub.1[M.sub.1]X.sub.na is least 5 amino acids; L is a linker; x is any nucleotide, nn is a number of nucleotides, P1 and P2 are primer sequences, and U.sub.1, U.sub.2, U.sub.3 are unique nucleotide sequences. In certain embodiments, the primer sequences P1 and P2 are independently 10-35, 10-40, 10-45, 10-50, 10-55, 10-60, 10-65, 10-70, 10-75, 10-100, 10-250, 10-500, or 10-1000 nucleotides long. na in certain embodiments, is 0-15, 0-25, 0-50, 0-100, 0-150, 0-250, 0-500, 0-1000, 0-2500, 0-5000, 0-10,000, 0-25,000, or 0-50,000 amino acids. nn in certain embodiments, is 0-15, 0-25, 0-50, 0-100, 0-150, 0-250, 0-500, 0-1000, 0-2500, 0-5000, 0-10,000, 0-25,000, 0-50,000 or 0-100,000 nucleotides. In certain embodiments, U has a size from 10-25, 10-50, 10-100, 10-250, 10-500, 10-1000, 10-2500, 10-5000, or 10-10,000 nucleotides.

(48) As will be apparent to one of skill in the art, by using the same primer pair (P1 and P2), N comprising the three unique sequences U.sub.1, U.sub.2, U.sub.3 can be sequenced. In this example, every specific U in N is linked to a specific A, comprising a modified amino acid.

(49) It should be appreciated that an amplification sequence, e.g. P1 and/or P2, is not always needed and/or not always desired. In certain embodiments, N comprises:
x.sub.nUx.sub.n,

(50) wherein x is any nucleotide, n is a number of nucleotides and U is a unique sequence. n in certain embodiments, is 0-15, 0-25, 0-50, 0-100, 0-150, 0-250, 0-500, 0-1000, 0-2500, 0-5000, 0-10,000, 0-25,000, 0-50,000 or 0-100,000 nucleotides. In certain embodiments, U has a size from 10-25, 10-50, 10-100, 10-250, 10-500, 10-1000, 10-2500, 10-5000, or 10-10,000 nucleotides.

(51) For example, certain sequencing and microarray approaches interrogate whole samples by incorporating all DNA into a library. These methods may be amplification-free (as described for example by Kozarewa et al. Amplification-free Illumina sequencing-library preparation facilitates improved mapping and assembly of (G+C)-biased genomes Nature Methods 6:291-295 (2009); Meyer and Kircher Illumina sequencing library preparation for highly multiplexed target capture and sequencing Cold Spring Harb Protoc. 2010(6):pdb.prot5448 (2010). Amplification-free methods may be used reduce or avoid sampling biases during library preparation that can result in libraries that are lower in complexity than the genomic DNA from which they were derived. For such uses, N may comprise a unique sequence U of an appropriate length that is compatible with the specific procedure. In certain embodiments, N comprises x.sub.nUx.sub.n of a length appropriate to be incorporated into the library and/or N comprises x.sub.nUx.sub.n which is capable of hybridization to specific oligonucleotides, such as oligonucleotides immobilized on a chip or a flow cell. The specific length requirement may vary between methods. In certain embodiments, x.sub.nUx.sub.n has a length of approximately 100, 200, 300, 400, or 500 nucleotides. In certain embodiments, x.sub.nUx.sub.n has a length between 50-150, 100-200, 150-250, 200-300, 250-350, 300-400, 350-450, or 400-500 nucleotides. In certain embodiments, x.sub.nUx.sub.n has a length between 10-25, 10-50, 10-100, 10-250, 10-500, 10-1000, 10-2500, 10-5000, 10-10,000, 10-25,000, 10-50,000, 10-100,000 or more nucleotides.

(52) L as used herein is a linker. In certain embodiments, L is a chemical linker. The linker L associating polypeptide A with oligonucleotide N may be any chemical moiety capable of associating the two segments A and N. This linker can have any length or other characteristic and minimally comprises two reactive terminal groups that can chemically interact with (and covalently bind to) the two segments A and N. The linker may be as simple as a covalent bond, or it may be a polymeric linker many atoms in length (e.g., polyethylene, polyethylene glycol, polyamide, polyester, etc.). In certain embodiments, linker L is 1-10 atoms, 1-25 atoms, 1-50 atoms, 1-100 atoms, 1-200 atoms, 1-500, 1-1000, 1-5000, 1-10,000, 1-50,000 or 1-100,000 atoms in length. In certain embodiments, the linker is a covalent bond (e.g., a carbon-carbon bond, disulfide bond, carbon-heteroatom bond, etc.). The linker may included functionalized moieties to facilitate attachment of a nucleophile (e.g., thiol, amino) from the polypeptide segment A to the linker L. Any electrophile may be used as part of the linker. Exemplary electrophiles include, but are not limited to, activated esters, activated amides, Michael acceptors, alkyl halides, aryl halides, acyl halides, and isothiocyanates.

(53) In certain embodiments, L is a heterobifunctional linker. In certain embodiments, N is modified to comprise one or more primary amines or thiols attached to specific bases of the nucleotides. After modification of the one or more bases in N, amine- or sulfhydryl-reactive crosslinkers can be used for their conjugation to A.

(54) Another functional group that can be chemically modified to allow the coupling of polypeptide A to oligonucleotide N is the 5-phosphate group. Using the 5 end of oligonucleotide N as the conjugation point by attaching a 5-phosphate group has an advantage of keeping the remainder of the nucleic acid sequence unmodified and free to interact or easily hybridize to a complementary target (for example a primer). The alkyl phosphate may, for example, be reactive with the water-soluble carbodiimide EDC (Pierce, Rockford, Ill.), which forms a phosphate ester. Subsequent coupling to the amine-containing A segment can be performed to form a stable phosphoramidate linkage. 1-Ethyl-3-[3-dimethylaminopropyl]carbodiimide hydrochloride (EDC or EDAC) is a zero-length crosslinking agent used to couple carboxyl groups to primary amines. EDC reacts with a carboxyl to form an amine-reactive O-acylisourea intermediate. If this intermediate does not encounter an amine, it will hydrolyze and regenerate the carboxyl group. In the presence of N-hydroxysulfosuccinimide (Sulfo-NHS), EDC can be used to convert carboxyl groups to amine-reactive Sulfo-NHS esters. This is for example, accomplished by mixing the EDC with a carboxyl containing molecule and adding Sulfo-NHS.

(55) If a diamine molecule is used to modify the DNA 5-phosphate, then the resultant amine-modified oligonucleotide N can be coupled to the A segment using a heterobifunctional reagent. For example, using a diamine compound that contains a disulfide (e.g., cystamine) and then reducing the disulfide group results in a sulfhydryl that may be conjugated with A segments rendered sulfhydryl-reactive (e.g., maleimide-activated) using the heterobifunctional reagent Sulfo-SMCC (Pierce, Rockford, Ill.). Sulfosuccinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (Sulfo-SMCC) is a water-soluble, non-cleavable and membrane impermeable crosslinker. It contains an amine-reactive N-hydroxysuccinimide (NHS ester) and a sulfhydryl-reactive maleimide group. NHS esters react with primary amines at pH 7-9 to form stable amide bonds. Maleimides react with sulfhydryl groups at pH 6.5-7.5 to form stable thioether bonds. The maleimide groups of Sulfo-SMCC and SMCC are unusually stable up to pH 7.5 because of the cyclohexane bridge in the spacer arm.

(56) Alternatively, N may be biotinylated, using e.g. photoreactive reagents. Photoactivatable biotin (Pierce, Rockford, Ill.) may be used that comprises a phenyl azide group at the end of a spacer arm and the biotin group at the other end, which allows the biotin to be non-selectively inserted into the nucleic acid structure e.g. by photolyzing.

(57) Other methods and reagents for coupling the oligonucleotide segment N to the polypeptide segment A are well known in the art, described for example in Nitta et al., FEBS 166(1):194-198 (1984).

(58) Polypeptide-Oligonucleotide Conjugates as Controls for Immunoprecipitations of Non-Histone Proteins:

(59) It would be appreciated by one of skill in the art that the polypeptide-oligonucleotide conjugates of the general formula A-L-N provided herein are also suitable for generating controls and/or internal standards for immunoprecipitation assays of non-histone proteins. In certain embodiments, polypeptide-oligonucleotide conjugates described herein are provided as internal standards for antibodies raised against non-histone proteins. In certain embodiments, the polypeptide-oligonucleotide conjugates are provided as internal standards for antibodies specific for amino acid mutations of the non-histone polypeptide of interest, e.g. point mutations, antibodies specific for post-translational modifications of the non-histone polypeptide of interest, or antibodies designed to distinguish between similar epitopes.

(60) Non-histone proteins can be for example DNA-binding proteins or chromatin-associated factors, such as transcription factors, cofactors of activator or repressor complexes, chromatin-modifying enzymes, e.g. histone acetylases, histone deacetylases, methylases, demethylases, replication factors, repair factors, etc. DNA-binding proteins or chromatin-associated factors include, but are not limited to, ASH1L, ASH2, ATF2, ASXL1, BAP1, bc110, Bmil, BRG1, CARM1, KAT3A/CBP, CDC73, CHD1, CHD2, CTCF, DNMT1, DOTL1, EHMT1, ESET, EZH1, EZH2, FBXL10, FRP(Plu-1), HDAC1, HDAC2, HMGA1, hnRNPA1, hp1 gamma, Hset1b, Jarid1A, Jarid1C, KIAA1718_JHDM1D, KAT5, KMT4, LSD1, NFKB P100, NSD2, MBD2, MBD3, MLL2, MLL4, P300, pRB, RbAP46/48, RBP1, RbBP5, RING1B, RNApolII P S2, RNApolII P S5, ROC1, sap30, setDB1, Sf3b1, SIRT1, Sirt6, SMYD1, SP1, SUV39H1, SUZ12, TCF4, TET1, TRRAP, TRX2, WDR5, WDR77, YY1. Commercial antibodies are available for all of these factors.

(61) Specific posttranscriptional modifications include but are not limited to phosphorylation, acetylation, and ubiquitination. For example, the polypeptide-oligonucleotide conjugates may serve as controls for p53-specific modifications, such as phospho-serine 6, phospho-threonine 18, acetyl-lysine 373, acetyl-lysine 382, phosphor-serine 392, or pRB-specific modifications, such as phospho-serine 601, phospho-serine 605, phospho-serine 773, acetyl-873, and acetyl-874. Such controls may be generated according to the teachings provided herein. The polypeptide-oligonucleotide conjugates of the general formula A-L-N may comprise A comprising X.sub.nY[M]X.sub.n and N comprising x.sub.nP1-UP2x.sub.n or x.sub.nUx.sub.n as described herein. Non-limiting examples for A of p53 modification-specific controls are: X.sub.nS[ph]X.sub.n, X.sub.nT[ph]X.sub.n, and X.sub.nK[ac]X.sub.n, wherein X is any amino acid, preferably an amino acid derived from p53 amino acid sequence. For example, A specific for human p53 phospho-serine 6 may comprise 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more amino acids of the human p53 amino acid sequence, such as

(62) TABLE-US-00005 (SEQIDNO:60) MEEPQS[ph]DPSVEPPLSQETFSDLWKLLPENN, (SEQIDNO:61) PQS[ph]DPS, (SEQIDNO:62) QS[ph]DPSVEPPLSQ, and (SEQIDNO:63) MEEPQS[ph]D.
A specific for human p53 acetyl-lysine 373, may comprise 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more amino acids of the human p53 amino acid sequence, such as

(63) TABLE-US-00006 (SEQIDNO:64) GSRAHSSHLKSKK[ac]GQSTSRHKKLMFKTEGPDSD, (SEQIDNO:65) SKK[ac]GQ, (SEQIDNO:66) HLKSKK[ac]GQSTSRH, and (SEQIDNO:67) K[ac]G.
A specific for human pRb acetyl-873, and acetyl-874, may comprise 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more amino acids of the human pRb amino acid sequence, such as

(64) TABLE-US-00007 (SEQIDNO:68) TSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLK[ac]K[ac] LRFDIEGSDEADGSKHLPGESKFQQK, (SEQIDNO:69) PLK[ac]K[ac]LRFD, and (SEQIDNO:70) PPKPLK[ac]K[ac]LRFDIEGSDEADGS.

(65) In certain embodiments, A comprises more than 20 amino acids of the DNA-binding protein or chromatin-associated factor that may comprise a specific amino acid modification. In certain embodiments, A comprises is 25, 50, 75, 100, 250, 500, 1000, 2500, 5000, 10,000, 25,000, or 50,000 amino acids of the DNA-binding protein, chromatin-associated factor or protein complexes thereof (e.g. multi-subunit comprising chromatin-remodeling complexes). In certain embodiments, A comprises the amino acids of the full-length DNA-binding protein or chromatin-associated factor.

(66) As described herein, N may comprise a unique sequence and primer sequences, e.g. x.sub.nP1-UP2x.sub.n, wherein the unique sequence may be used to identify the specific amino acid modification represented in A. In certain embodiments, N does not comprise an amplification sequence (e.g. P1 and P2) and comprises a unique sequence x.sub.nUx.sub.n that may be used to identify the specific amino acid modification represented in A. One of ordinary skill would appreciate that polypeptide-oligonucleotide conjugates may be generated that represent specific posttranscriptional modifications or specific mutations for any polypeptide of interest for which such modifications and/or mutations are known.

(67) For many of the commercially available antibodies specific for DNA-binding proteins or chromatin-associated factors their suitability in immunoprecipitation assays is unknown. Controls and internal standards that could be used to test the suitability of such antibodies are generally not available. Using existing controls is often costly and time consuming because data about the genomic regions that are bound by the DNA-binding proteins and chromatin-associated factors is not always available. Such lack of information requires the generation of multiple primers specific for different genomic regions and/or requires performing ChIP-Seq assays. To overcome these limitations, the polypeptide-oligonucleotide conjugates described herein may be used as internal standards for any experiment involving antibodies specific for non-histone proteins, such as DNA-binding proteins and chromatin-associated factors. In certain embodiments, the polypeptide-oligonucleotide conjugates described herein may be used for immunoprecipitation experiments. In other embodiments, the polypeptide-oligonucleotide conjugates described herein may be used as internal standards for comparing and/or using data obtained from any type of suitable assay or experiment in combination with data obtained from ChIP, e.g. when using antibodies specific for DNA-binding proteins and chromatin-associated factors. The polypeptide-oligonucleotide conjugates described herein may be used as internal standards for normalization purposes (as described herein), for example, when measuring the effect of a gene knock-down on a cell (such as by an antisense or RNAi-mediated knock-down, by a knock-out mutation, or by a misregulated cellular pathway) and comparing the ChIP data obtained from the knock-down cell with the ChIP data obtained from a wild-type cell. It would be understood by one of ordinary skill that the polypeptide-oligonucleotide conjugates described herein may be used in circumstances not involving knock-down, such as, for example, in circumstances when a DNA-binding protein and chromatin-associated factor is modified differently (e.g. post-transcriptionally modified) in any two cells. The two cells may be of different cell type, the same cell type but derived from different tissue or from a different species, or may be derived from a wild-type and a mutant cell (e.g. a normal cell/cancer cell pair).

(68) Polypeptide/Polynucleotide-Oligonucleotide Conjugates as Controls for Immunoprecipitations of Non-Histone Proteins:

(69) Other aspects of the invention relate to control agents for immunoprecipitation (IP) assays, including but not limited to RNA-IP followed by sequencing (RIP-seq), methylated-DNA IP followed by sequencing (mDIP-seq), bisulphite sequencing (BS-seq), High-throughput sequencing of RNA isolated by crosslinking IP (HITS-CLIP), formaldehyde-assisted isolation of regulatory elements followed by sequencing (FAIRE-seq), and micrococcal nuclease digestion followed by sequencing (MNase-seq). Control agents provided herein comprise the formula:
XB or BX,

(70) where X is a molecule (e.g., polypeptide, such as A described above, or a polynucleotide), and B (also referred to as barcode) is an oligonucleotide (e.g., DNA or RNA) comprising, for example, 10 nucleotides, wherein the sequence of nucleotides of B uniquely identifies X. In some configurations, a linker L is used to conjugate B and X. Examples of control agents include, but are not limited to, barcoded DNA-peptide conjugates, barcoded RNA-peptide conjugates, barcoded methylated DNA oligos, and assembled nucleosomes conjugated to barcoded DNA.

(71) Polypeptide-Oligonucleotide Conjugates as Validation Tools for Screening ChIP-Capable Antibodies:

(72) For ChIP assays, it is advantageous to fully characterize the antibodies used in the assay. Antibodies used in ChIP assays typically recognize histones, histone modifications or chromatin-associated factors. One common method of characterizing antibody specificity (epitope recognition) employs assays involving peptide competition (using target and non-target antigens as competitors) in both ELISA and Western blot. Western blotting can also be used to demonstrate that the correct target has been successfully immuno-precipitated. Calf thymus histone preparations are often used as a positive control histone sample for validating antibody specificity in Western blot. Immunofluorescence can be used to validate that antigen recognition occurs in a cellular context, and can also be combined with competition assays.

(73) However, even full characterization will not necessarily provide sufficient information about the antibody's suitability for, and specificity in ChIP, as the effects of cross-linking can significantly alter (native) epitopes and/or may lead to the loss of specific epitopes. Further, the binding affinity of certain may decrease dramatically under more stringent buffer conditions (that are commonly used in ChIP assays, e.g. high salt and/or detergent conditions) that increase antibody specificity.

(74) Specific antibodies for ChIP should be affinity-purified, e.g. when the antibody is a monoclonal antibody (raised against a specific epitope). Many laboratories use sera (e.g. polyclonal antibody population that recognize different epitopes) as their antibody source and inherent background problems are overcome by using highly stringent buffers.

(75) A stringent test for the suitability of an antibody for ChIP is to perform parallel ChIP assays in wild-type and mutant or modified and unmodified backgrounds to demonstrate that the observed enrichment is due solely to the target antigen. Such tests are difficult to perform with the controls that are currently available.

(76) The polypeptide-oligonucleotide conjugates of the general formula A-L-N that may comprise A comprising X.sub.nY[M]X.sub.n and N comprising x.sub.nP1-UP2x.sub.n or x.sub.nUx.sub.n as described herein may be used to provide specific epitopes to screen novel and/or untested antibodies for their suitability in ChIP assays. For example, a pool (library) of the polypeptide-oligonucleotide conjugates provided herein specific for different histone modifications may be used in a mock-ChIP assay, under conditions similar or identical to those actually used in a ChIP assay using genomic material, to screen and/or validate antibodies for their specificity and/or affinity to specific histone modifications. Such a pool may comprise polypeptide-oligonucleotide conjugates of the general formula A-L-N comprising A segments that comprise antigens representing mono-methylated H3K4, mono-methylated H3K9, mono-methylated H3K27, mono-methylated H3K79, di-methylated H3K79, tri-methylated H3K4, acetylated H3K9, acetylated H3K14, tri-methylated H3K9 and tri-methylated H3K27. An antibody may be screened for suitability in a ChIP assay using such pool (library) by contacting the antibody with the polypeptide-oligonucleotide conjugate pool under conditions similar or identical to those actually used in a ChIP assay using genomic material. If the antibody is for example specific for mono-methylated H3K9, a subsequent sequence analysis and quantification of the precipitated fraction (e.g. by qPCR) would produce a statistically significant overrepresentation of the unique nucleotide sequence (of N) that is linked via the linker L to the A segment comprising the antigen representing mono-methylated H3K9. All other unique sequences linked to the A segments comprising the antigens representing the other histone modifications would be underrepresented in a statistically significant manner. Antibodies with low affinity and/or low specificity may produce signals that are not statistically significant, e.g. over background or over the signal derived from the other polypeptide-oligonucleotide conjugates representing the non-desired antigens.

(77) Provided herein are thus screening methods using the polypeptide-oligonucleotide conjugates described herein to screen antibodies for their suitability in ChIP assays, wherein antibodies that produce a significant overrepresentation of a signal specific to a single amino acid modification or specific to a combination of histone modifications in conditions similar or identical to those actually used in a ChIP assay using genomic material are considered suitable for use in ChIP assays.

(78) It would be appreciated by one of ordinary skill that the use of the polypeptide-oligonucleotide conjugates described herein to screen antibodies is not limited to ChIP assays and histone modifications. The polypeptide-oligonucleotide conjugates described herein may be used to screen antibodies for suitability in immunoprecipitation assays of any non-histone polypeptide, for example using A segments comprising antigens representing specific post-translational modification (e.g. phosphorylation, acetylation, ubiquitination, etc.) of the non-histone polypeptide of interest or antigens representing one or more specific point mutation(s) within the amino acid sequence of the non-histone polypeptide of interest and/or the appropriate antigen representing the non-modified and non-mutated forms.

(79) Use of Polypeptide-Oligonucleotide Conjugates to Normalize ChIP and Other Assay Data and to Quantify Experimental Parameters of ChIP Assays:

(80) Variations in the starting material (quantity and/or quality) in ChIP assays are possible. ChIP data may therefore be normalized for the amount of starting material, e.g. to avoid errors introduced due to uneven sample quantities. To normalize the data obtained, the final amplification value may be divided by the amplification value of input material. For example, one may take a sample of the lysed starting material for PCR of control regions in parallel with the eluted material from the ChIP assay. It is possible that certain regions of the genome are precipitated more effectively or amplify better than others. Further, there is the possibility of nucleosome rearrangement during fragmentation (e.g. enzymatic fragmentation). PCR primers may therefore be generated specific for several regions in the starting material, as well as for the purified/immuno-precipitated material, as controls. Normalization is also difficult in microarray and sequencing assays. Such assays could also be improved by providing internal standards, such as the agents provided herein.

(81) The polypeptide-oligonucleotide conjugates of the general formula A-L-N that may comprise A comprising X.sub.nY[M]X.sub.n and N comprising x.sub.nP1-UP2x.sub.n or x.sub.nUx.sub.n as described herein may be used to provide quantifiable controls and/or internal standards. The polypeptide-oligonucleotide conjugates described herein may be provided as a pool in which the concentration of each individual polypeptide-oligonucleotide conjugate is accurately known or individually at a known concentration. For example, a pool of or an individual polypeptide-oligonucleotide conjugate(s) of known concentration may be used as an input control, as a process control without genomic sample material and/or may be spiked into the samples of fragmented genomic material. The starting concentration of the polypeptide-oligonucleotide conjugate(s) in each case is known or can be calculated. The polypeptide-oligonucleotide conjugates that may comprise A comprising X.sub.nY[M]X.sub.n and N comprising x.sub.nP1-UP2x.sub.n provide a signal amplification of the unique nucleic acid sequence U that is independent of variations in chromatin, since U may be designed in such way that it is of one particular length (e.g. 10, 20, 30, 40, 50, or more nucleotides) that is the same for each unique sequence U and P1 and P2 may be the same sequence(s) for each polypeptide-oligonucleotide conjugate. In certain embodiments, N does not comprise an amplification sequence (e.g. P1 and P2) and comprises a unique sequence x.sub.nUx.sub.n. The magnitude of the signal obtained (e.g. from qPCR, hybridization, sequencing or other quantification method) for the immuno-precipitated polypeptide-oligonucleotide conjugates may then depend only on the conditions used for the ChIP assay and on the specificity and/or affinity of the antibody for the antigen (X.sub.nY[M]X.sub.n) represented by the A segment. To normalize the signal obtained for the immuno-precipitated polypeptide-oligonucleotide conjugates, the final amplification value may be divided by the amplification value of input polypeptide-oligonucleotide conjugates. Provided herein are thus methods for quantifying one or more experimental parameters of ChIP assays using the polypeptide-oligonucleotide conjugates described herein. Such experimental parameters include but are not limited to, sample loss, immunoprecipitation efficiency, quality of the starting/input material (e.g. fragmented genomic material), relative fold enrichment of the antigen-specific signal for the immuno-precipitated sample. Provided herein are also methods of normalizing the signal obtained for the immuno-precipitated genomic material using the polypeptide-oligonucleotide conjugates described herein.

(82) Kits Comprising Polypeptide-Oligonucleotide Conjugates for ChIP Assays:

(83) Provided herein are kits for chromatin immunoprecipitation (ChIP) assays. In certain embodiments, such kits comprise the polypeptide-oligonucleotide conjugates of the formula A-L-N, as described herein, and one or more other chemical reagents necessary to perform a ChIP assay and/or chemical reagents necessary to perform subsequent analysis, e.g. PCR, hybridization, or sequencing. Such kits may contain one or more enzymes necessary to perform the ChIP assay, for example, RNaseA and Proteinase K; one or more solutions and buffers, such as, formaldehyde, glycine, PBS, cell lysis buffer, Triton X-100, protease inhibitor cocktails, wash buffers elution buffers; antibodies (specific and control); and hardware, such as magnetic beads and multi-well plates. Such kits may contain one or more enzymes necessary to perform chromatin fragment modification (e.g. addition of adapters) and subsequent Real Time PCR or sequencing, for example, Klenow DNA polymerase, DNA polymerase, T4 ligase, T4 polynucleotide kinase, T4 DNA polymerase, Klenow fragment 3 to 5 exo minus; one or more solutions and buffers, such as, enzyme reaction buffers, dATP, dNTPs, ultrapure water, TE; PCR or sequencing specific adapters, PCR or sequencing primers; and hardware, such as e.g. DNA purification columns and multi-well plates. In certain embodiments, kits may be provided comprising one or more polypeptide-oligonucleotide conjugates of the formula A-L-N, as described herein, specific for one or more particular ChIP targets, e.g. histone modifications, unmodified histones, or chromatin-associated factors (transcription factors, histone acetylases, histone deacetylases, methylases, demethylases, repressor/activator co-factors, polymerases, DNA repair enzymes, etc.). In certain embodiments, a pool of 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100 or more different polypeptide-oligonucleotide conjugates of the formula A-L-N may be provided. For example, a pool may comprise one or more polypeptide-oligonucleotide conjugates
X.sub.naY.sub.1,2,3, . . . z[M.sub.1,2,3, . . . z]X.sub.na-L-x.sub.nnP1-U.sub.1,2,3, . . . z-P2x.sub.nn,

(84) wherein X is an amino acid; na is a number of amino acids; Y.sub.1, Y.sub.2, Y.sub.3 . . . z are z number of different modified amino acids; M.sub.1, M.sub.2, M.sub.3 . . . z are z number of different modifications; L is a linker; x is any nucleotide, nn is a number of nucleotides, P1 and P2 are primer sequences, and U.sub.1, U.sub.2, U.sub.3 . . . z are z number of unique nucleotide sequences of, wherein z is the number of different polypeptide-oligonucleotide conjugates in the pool, e.g. 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100 or more. In certain embodiments, the primer sequences P1 and P2 are independently 10-35, 10-40, 10-45, 10-50, 10-55, 10-60, 10-65, 10-70, 10-75, 10-100, 10-250, 10-500, or 10-1000 nucleotides long. na in certain embodiments, is 0-15, 0-25, 0-50, 0-100, 0-150, 0-250, 0-500, 0-1000, 0-2500, 0-5000, 0-10,000, 0-25,000, or 0-50,000 amino acids. nn in certain embodiments, is 0-15, 0-25, 0-50, 0-100, 0-150, 0-250, 0-500, 0-1000, 0-2500, 0-5000, 0-10,000, 0-25,000, 0-50,000, 0-100,000 nucleotides. In certain embodiments, U has a size from 10-25, 10-50, 10-100, 10-250, 10-500, 10-1000, 10-2500, 10-5000, or 10-10,000 nucleotides. In certain embodiments, N does not comprise an amplification sequence (e.g. P1 and P2) and comprises a unique sequence x.sub.nUx.sub.n.

(85) The pools of polypeptide-oligonucleotide conjugates may represent 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100 or more different histone modifications, including but not limited to

(86) 1) modifications for Histone H1, such as H1 (phospho S1+T3), H1 (phospho S35), H1 (acetyl K63);

(87) 2) modifications for Histone H2A, such as H2A (asymmetric di methyl R3), H2A (symmetric di methyl R3), H2A (acetyl K5), H2A (mono methyl R17), H2A (symmetric di methyl R77), H2A (Hydroxy P26), H2A (mono methyl K125), H2A (tri methyl K125), H2A (mono methyl K127), H2A (tri methyl K127), H2A (phospho S129);

(88) 3) modifications for Histone H2B, such as H2B (acetyl K5), H2B (di methyl K5), H2B (Hydroxy P10), H2B (di methyl K43);

(89) 4) modifications for Histone H3, such as H3 (mono methyl R2), H3 (citrulline 2+8+17), H3 (mono methyl K4), H3 (di methyl K4), H3 (tri methyl K4), H3 (di+tri methyl K4), H3 (acetyl K9), H3 (acetyl K9, phospho S10), H3 (mono methyl K9), H3 (di methyl K9), H3 (tri methyl K9), H3 (phospho S10), H3 (asymmetric di methyl R17), H3 (acetyl K18), H3 (acetyl K27), H3 (di methyl K27), H3 (tri methyl K27), H3 (mono methyl K27, tri methyl K27+K4), H3 (mono methyl K36), H3 (tri methyl K36), H3 (Hydroxy P38), H3 (mono methyl K79), H3 (di methyl K79), H3 (tri methyl K79), H3 (mono+di+tri methyl K79), H3 (Hydroxy P121), H3 (tri methyl K122); and

(90) 5) modifications for Histone H4, such as H4 (symmetric di methyl R3), H4 (acetyl K8), H4 (acetyl K12), H4 (mono methyl K20), H4 (tri methyl K20), H4 (phospho T30), H4 (Hydroxy P32), H4 (tri methyl K59), H4 (phospho T80), H4 (acetyl K91), H4 (phospho T96).

(91) It should be appreciated that kits comprising polypeptide-oligonucleotide conjugates comprising A segments that comprise antigens of non-histone polypeptides, as described herein, may also be provided. Such kits may comprise pools of polypeptide-oligonucleotide conjugates comprising A segments that comprise antigens of, for example, p53-specific post-translational modifications, e.g. phosphorylated Ser 6, Ser 9, Ser 15, Thr 18, Ser 20, Ser 33, Ser 37, Ser 46, Thr 55, Thr 155, Ser 315, and/or Ser 392.

(92) Pools of polypeptide-oligonucleotide conjugates may be provided individually that is without any other reagent, e.g. as an accessory for ChIP assays, or may be provided together with agents necessary to perform ChIP assays (e.g. antibodies, cross-linking, binding, washing, elution buffers, etc.) and/or subsequent with agents necessary to perform subsequent assays of nucleic acid analyses (e.g. PCR amplification, sequencing, hybridization, etc.) as depicted in FIG. 4. The polypeptide-oligonucleotide conjugates may be provided lyophilized or in suspension (e.g. in a suitable buffer). If the polypeptide-oligonucleotide conjugates are provided in lyophilized form, a suitable suspension buffer may also be provided with the kit.

(93) The polypeptide-oligonucleotide conjugates may be used in any ChIP assay. ChIP assays may be used to analyze the spatial and temporal dynamics and interactions of chromatin and its associated factors, which can be, for example, detected at a single promoter or over the entire human genome. ChIP assays are based on the selective enrichment of a chromatin fraction containing a specific antigen. Antibodies that recognize a protein (e.g. a chromatin-associated factor such as a transcription factor) or protein modification (e.g. a histone tail modification) of interest can be used to determine the relative abundance of that antigen at one or more locations (loci) in the genome. It is more common to analyze euchromatin, which is though to contain active genes and to maintain an open and extended chromatin. Heterochromatin, which is thought to contain many inactive genes and repetitive DNA sequences and is thought to be in a condensed state is generally more difficult to analyze by ChIP.

(94) Generally, ChIP assays can be used to determine whether a given protein binds to a specific location on the chromatin in vivo or if a specific histone modification is present at a specific location on the chromatin at the time of analysis. ChIP may be used to selectively enrich for DNA sequences bound by a particular protein (e.g. transcription factor or histone) in living cells by cross-linking DNA-protein complexes and using an antibody that is specific against a protein of interest. Specific ChIP protocols are well known in the art. The ChIP procedure may consists of the following steps: (a) (optionally) cross-linking of chromatin in vivo (to immobilize the antigen of interest to its chromatin binding site) (b) isolation of total chromatin (c) fragmentation of the chromatin isolated in (b) (d) immunoprecipitation of the chromatin fragments obtained in (c) (e) analysis of the immunoprecipitated fraction obtained in (d) to determine the amount of a target DNA sequence relative to its abundance in the input chromatin.

(95) The quantitative analysis is typically carried out using PCR, sequencing or hybridization-based techniques. Such procedures are well now in the art and, for example, Allis & Wu ((Eds). (2004) Chromatin and chromatin remodelling enzymes, Methods in Enzymology v376, Elsevier Academic Press, 2004) provide a review of the procedures and methodologies of ChIP.

(96) The polypeptide-oligonucleotide conjugates described herein may comprise an N segment comprising x.sub.nP1-UP2x.sub.n. It may therefore be particularly useful to modify the immuno-precipitated genomic fraction obtained through the ChIP assay in such way as to link nucleotides of the sequence of P1 and P2 to the obtained nucleic acid fragments. This may allow amplification and/or quantification using the same primers for the control (e.g. the polypeptide-oligonucleotide conjugates described herein) and the immuno-precipitated genomic material. Use of the same primers may reduce or eliminate unwanted variations in signal obtained in the amplification and/or quantification assays. In certain embodiments, N does not comprise an amplification sequence (e.g. P1 and P2) and comprises a unique sequence x.sub.nUx.sub.n.

(97) Generally, to analyze the immunoprecipitated fraction of fragmented chromatin (genomic DNA), the DNA fragments may be eluted and purified (e.g. by phenol/chloroform extraction-ethanol precipitation or affinity purification using silica beads, such as QIAgen (Germantown, Md.) DNA purification kits: e.g. QIAquick column) and may be further modified to allow amplification and/or sequencing (e.g. from the same primers P1 and P2 provided in the polypeptide-oligonucleotide conjugates described herein). Common modification steps include:

(98) (a) performing end repair: to convert the overhangs resulting from fragmentation into blunt ends, using e.g. T4 DNA polymerase and E. coli DNA polymerase I Klenow fragment. The 3 to 5 exonuclease activity of these enzymes removes 3 overhangs and the polymerase activity fills in the 5 overhangs,

(99) (b) addition of A bases to the 3 end of the DNA fragments: to add an A base to the 3 end of the blunt phosphorylated DNA fragments, using the polymerase activity of e.g. Klenow fragment (3 to 5 exo minus). This may be performed to prepare the DNA fragments for ligation to adapters that have a single T base overhang at their 3 end,

(100) (c) ligation of adapters to DNA fragments, e.g. using DNA ligase

(101) (d) purification of ligation products: to remove any unligated adapters or any adapters that may have ligated to one another, using e.g. gel purification,

(102) (e) enrichment of the adapter-modified DNA fragments by PCR: to selectively enrich DNA fragments that have adapter molecules on both ends and to amplify the amount of DNA,

(103) (f) validation and analysis of the obtained library.

(104) For validation and analysis chromatin immunoprecipitation-massively parallel DNA sequencing (ChIP-Seq) may be used. It can be used to precisely map global DNA binding sites for any protein of interest, e.g. transcription factor, restriction enzyme, or other chromatin associated proteins, on a genome scale. ChIP-DNA fragments are sequenced simultaneously using a genome sequencer. A single sequencing run can scan for genome-wide associations with high resolution. Massively parallel sequence analyses may be used in conjunction with whole-genome sequence databases to analyze the interaction pattern of a protein of interest (e.g. transcription factors, polymerases or transcriptional machinery) with DNA (Johnson et al. (2007) Science 316:1497-1502), or to analyze the pattern of an epigenetic chromatin modification of interest (e.g. histone modifications or DNA modifications). Massively parallel sequencing is known in the art and many sequencing methods may be used. Some technologies may use cluster amplification of adapter-ligated ChIP DNA fragments on a solid flow cell substrate. The resulting high density array of template clusters on the flow cell surface may then be submitted to sequencing-by-synthesis in parallel using for example fluorescently labeled reversible terminator nucleotides. Templates are sequenced base-by-base during each read. The resulting data may be analyzed using data collection and analysis software that aligns sample sequences to a known genomic sequence.

(105) Chromatin immunoprecipitation may also be combined with microarray ChIP-on-chip, which requires a hybridization array. ChIP-on-chip may require large sets of tiling arrays (of overlapping probes designed to densely represent a genomic region of interest). Tiling arrays that may be used with the polypeptide-oligonucleotide conjugates described herein may comprise oligonucleotides comprising a sequence to which N is at least in part complementary. These complementary sequences may be of a length sufficient to allow specific hybridization between parts or all of the nucleotide sequence provided by N and the oligonucleotide on the tiling array. In certain embodiments, wherein N comprises x.sub.nUx.sub.n, all or parts of the unique sequence U is complementary to the oligonucleotide on the tiling array. The polypeptide-oligonucleotide conjugates described herein may then be quantified using such tiling arrays. Upon acquisition of data (readout), for example by sequencing or hybridization, the relative representation of the different polypeptide-oligonucleotide conjugates described herein may be evaluated by comparing their representation a) within a given sample and/or b) with a control sample(s). Enrichment ratios may then be calculated for each polypeptide-oligonucleotide conjugate. These ratios may then be used to estimate or calculate the degree to which the corresponding antigen (represented by the polypeptide-oligonucleotide conjugate) was enriched by the immunoprecipitation assay and thereby evaluating the efficacy of the experiment in quantitative terms, such as, for example, sensitivity and/or specificity.

(106) Additional Embodiments

(107) Also contemplated herein are other control agents for other immunoprecipitation (IP) assays, as set forth below. An internal standard for a particular IP assay may have the formula:
XB or BX,

(108) where X is a molecule (e.g., polypeptide, such as A described above, or a polynucleotide), and B (also referred to as barcode) is an oligonucleotide (e.g., DNA or RNA) comprising, for example, 10 nucleotides, wherein the sequence of nucleotides of B uniquely identifies X. In some configurations, a linker L is used to conjugate B and X.

(109) RNA Immunoprecipitation (RIP)-RNA-Sequencing (RNA-seq) (RIP-seq)

(110) In some embodiments, the internal controls described herein may be used in RIP-seq assays. RIP is similar to ChIP described above, except rather than targeting DNA binding proteins as in ChIP, RIP targets RNA binding proteins. In some embodiments, live cells may be lysed and the immunoprecipitation can be performed with an antibody that targets a protein of interest. By isolating the protein, the RNA will also be isolated as it is bound to the protein. In some embodiments, the purified RNA-protein complexes can be separated by performing an RNA extraction and the identity of the RNA can be determined by cDNA sequencing (RNA-seq) or RT-PCR. In certain embodiments, some variants of RIP, such as PAR-CLIP include cross-linking steps, which then may require less careful lysis conditions. Internal controls for use with an RIP-seq assay include barcoded RNA-peptide conjugates, for example, having the configuration XB, where X is an RNA-binding protein, and B is an oligonucleotide of cDNA that uniquely identifies X.

(111) Methylated-DNA Immunoprecipitation (meDIP or mDIP)-Sequencing

(112) In some embodiments, the internal controls described herein may be used in mDIP-sequencing. mDIP is a large-scale (chromosome- or genome-wide) technique that can be used to enrich for methylated DNA sequences. In certain embodiments, the method comprises isolating methylated DNA fragments via an antibody raised against 5-methylcytosine (5mC). In some embodiments, a purified fraction of methylated DNA can be input to high-throughput DNA detection methods such as high-resolution DNA microarrays (MeDIP-chip) or next-generation sequencing (MeDIP-seq). Internal controls for use with an MeDIP-seq assay include barcoded methylated DNA oligonucleotides, for example, having the configuration XB, where X is a methylated DNA oligonucleotide, and B is an oligonucleotide of DNA that uniquely identifies X.

(113) MethylC-Sequencing or Bisulphite (BS)-Sequencing

(114) In some embodiments, the internal controls described herein may be used in BS-sequencing (BS-seq). Bisulfite sequencing is the use of bisulfite treatment of DNA to determine its pattern of methylation. Treatment of DNA with bisulfite converts cytosine residues to uracil, but leaves 5-methylcytosine residues unaffected. Thus, bisulfite treatment introduces specific changes in the DNA sequence that depend on the methylation status of individual cytosine residues, yielding single-nucleotide resolution information about the methylation status of a segment of DNA. In some embodiments, BS-seq applies routine or shotgun sequencing methods on bisulfite-treated genomic DNA to determine methylation status at CpG dinucleotides. Internal controls for use with a BS-seq assay include barcoded methylated DNA oligonucleotides, for example, having the configuration XB, where X is a methylated DNA oligonucleotide, and B is an oligonucleotide of DNA that uniquely identifies X.

(115) High-Throughput Sequencing of RNA Isolated by Crosslinking Immunoprecipitation (HITS-CLIP)

(116) In some embodiments, the internal controls described herein may be used in HITS-CLIP (also known as CLIP-seq) assays. HITS-CLIP is a genome-wide means of mapping protein-RNA binding sites. HITS-CLIP is similar to ChIP-seq, except that proteins bound to RNA (e.g., splicing factors) are immune-precipitated and the RNA fragments are sequenced. Internal controls for use with a HITS-CLIP-seq assay include barcoded RNA-peptide conjugates, for example, having the configuration XB, where X is an RNA-binding protein, and B is an oligonucleotide of cDNA that uniquely identifies X.

(117) Formaldehyde-Assisted Isolation of Regulatory Elements (FAIRE)-Sequencing

(118) In some embodiments, the internal controls described herein may be used in FAIRE-sequencing. DNA segments that actively regulate transcription in vivo are typically characterized by eviction of nucleosomes from chromatin and are experimentally identified by their hypersensitivity to nucleases. FAIRE refers to a method of isolating nucleosome-depleted DNA from chromatin. In some embodiments, the method comprises crosslinking chromatin with formaldehyde in vivo (in cells), shearing the cells by sonication, extracting the chromatin/DNA by phenol-chloroform extracted. The DNA recovered in the aqueous phase, in some embodiments, is subjected to high-throughput sequencing (FAIRE-seq). Internal controls for use with an FAIRE-seq assay include barcoded DNA oligonucleotides, for example, having the configuration XB, where X is a DNA oligonucleotide, and B is an oligonucleotide of DNA that uniquely identifies X.

(119) Micrococcal Nuclease Digestion (MNase)-Sequencing

(120) In some embodiments, the internal controls described herein may be used in MNase-sequencing. MNase is a method that A method that distinguishes nucleosome positioning based on the ability of nucleosomes to protect associated DNA from digestion by micrococcal nuclease. In some embodiments, protected fragments may be sequenced to produce genome-wide maps of nucleosome localization. Internal controls for use with an MNase-seq assay include in vitro assembled nucleosomes conjugated to barcoded DNA oligonucleotides, for example, having the configuration XB, where X is an assembled nucleosome, and B is an oligonucleotide of DNA that uniquely identifies X.

(121) Other aspects and embodiments of the invention are further described in international application number PCT/US2011/054072, filed Sep. 29, 2011, which claims the benefit under 35 U.S.C. 119(e) of U.S. provisional application Ser. No. 61/387,689, filed Sep. 29, 2010, each of which is incorporated by reference herein in its entirety. The following numbered paragraphs also provide various other aspects and embodiments contemplated by the invention:

(122) 1. A chromatin immunoprecipitation method for parallel processing of multiple samples, the method comprising: (a) cross-linking a chromatin-associated factor to chromatin; (b) shearing the cross-linked chromatin of (a) to provide nucleic acid fragments; (c) contacting the chromatin-associated factor cross-linked to the nucleic acid fragments of (b) with a first affinity molecule; (d) releasing the nucleic acid from the chromatin-associated factor and from the first affinity molecule; (e) contacting the released nucleic acid fragments in (d) with a second affinity molecule; (f) releasing the nucleic acid fragments from the second affinity molecule, and (g) optionally isolating the nucleic acid fragments, and (h) optionally analyzing the distribution and enrichment of the isolated nucleic acid fragments, wherein the first affinity molecule and/or second affinity molecule optionally is coupled to a substrate suitable for parallel processing of multiple samples.

(123) 2. The method of paragraph 1, wherein contacting the nucleic acid fragments in (e) is carried out using an affinity interaction between the nucleic acid fragment and the second affinity molecule.

(124) 3. The method of paragraph 2, wherein the nucleic acid is suitably modified for this interaction.

(125) 4. The method of paragraph 3, wherein the modification is addition of poly-A tails or biotinylation.

(126) 5. The method of any one of paragraphs 1 to 4, wherein the second affinity molecule is a poly-T oligonucleotide, avidin or streptavidin.

(127) 6. The method of any one of paragraphs 1 to 5, wherein the second affinity molecule is silica.

(128) 7. The method of any one of paragraphs 1 to 6, wherein the substrate is a surface of a bead or a well.

(129) 8. The method of paragraph 7, wherein the bead is a magnetic bead.

(130) 9. The method of any one of paragraphs 1 to 8, wherein steps (e) and (f) are not carried out using a purification column or using phenol/chloroform extraction and ethanol precipitation.

(131) 10. The method of paragraph 6, wherein steps (e) and (f) are not carried out using a purification column comprising silica.

(132) 11. The method of any one of paragraphs 1 to 10, wherein the format is a 6-well plate, a 12-well plate, a 24-well plate, a 96-well plate, a 384-well plate or a 1536-well plate.

(133) 12. The method of any one of paragraphs 1 to 11, wherein the first affinity molecule in step (c) is an antibody that specifically binds a chromatin-associated factor cross-linked to the nucleic acid fragment.

(134) 13. The method of paragraph 12, wherein the antibody is coupled to a substrate.

(135) 14. The method of paragraph 13, wherein the substrate is a surface of a bead or a well.

(136) 15. The method of paragraph 13 or paragraph 14, wherein the substrate comprises protein A or protein G.

(137) 16. The method of any one of paragraphs 13 to 15, wherein the chromatin-associated factor binds to the antibody before the antibody is coupled to the substrate.

(138) 17. The method of any one of paragraphs 1 to 16, wherein the chromatin-associated factor comprises an affinity tag.

(139) 18. The method of paragraph 17, wherein the affinity tag is FLAG-tag, myc-tag, biotin or DHFR.

(140) 19. The method of paragraph 17 or paragraph 18, wherein the affinity molecule is an antibody that specifically binds the affinity tag, avidin or streptavidin.

(141) 20. The method of paragraph 19, wherein the antibody is an anti-FLAG antibody, or an anti-myc antibody.

(142) 21. The method of any one of paragraphs 1 to 20, wherein shearing in step (b) is carried out by sonication or micrococcal nuclease digestion.

(143) 22. The method of any one of paragraphs 1 to 21, the method further comprising a step of analyzing the isolated nucleic acid fragments.

(144) 23. The method of paragraph 22, wherein analyzing the isolated nucleic acid fragments comprises determining the nucleotide sequence.

(145) 24. The method of paragraph 23, wherein the nucleotide sequence is determined using sequencing or hybridization techniques with or without amplification.

(146) 25. The method of paragraph 24, wherein the techniques are ChIP-Seq, real-time PCR, DNA microarray, or NANOSTRING array.

(147) 26. A chromatin immunoprecipitation kit for parallel processing of multiple samples in a multi-well format, the kit comprising:

(148) a) a multi-well plate comprising wells coated on an inside surface of the wells with a first affinity molecule that binds to a chromatin-associated factor, or is coated with a molecule that binds to the first affinity molecule, to form a first affinity surface, and

(149) b) a multi-well plate coated with a second affinity molecule that has binds nucleic acids, or is coated with a molecule that binds to the second affinity molecule, to form a second affinity surface,

(150) optionally further comprising a protein inhibitor, a cross-linking solution, a cell lysis buffer, a wash buffer, an elution buffer, and/or user instructions.

(151) 27. The chromatin immunoprecipitation kit of paragraph 26, wherein the kit comprises a single multi-well plate that comprises different wells for first and second affinity surfaces.

(152) 28. The chromatin immunoprecipitation kit of paragraph 26, wherein the kit comprises a single multi-well plate that comprises wells that have both first and second affinity surfaces.

(153) 29. A chromatin immunoprecipitation kit for parallel processing of multiple samples, the kit comprising:

(154) a) a first bead coated with a first affinity molecule that binds to a chromatin-associated factor, or coated with a molecule that binds to the first affinity molecule, to form a first affinity surface, and

(155) b) a second bead coated with a second affinity molecule that binds nucleic acids, or coated with a molecule that binds to the second affinity molecule, to form a second affinity surface,

(156) optionally further comprising a multi-well plate, a protein inhibitor, a cross-linking solution, a cell lysis buffer, a wash buffer, an elution buffer, and/or user instructions.

(157) 30. The kit of paragraph 26 or paragraph 29, wherein the second affinity molecule comprises silica.

(158) 31. The kit of paragraph 26 or paragraph 29, wherein the second affinity molecule comprises a poly-T oligonucleotide, a poly-A oligonucleotide, avidin, streptavidin or biotin.

(159) 32. The kit of paragraph 26, wherein the multi-well plate is a 6-well plate, a 12-well plate, a 24-well plate, a 96-well plate, a 384-well plate or a 1536-well plate.

(160) 33. The kit of paragraphs 26 or 29, wherein the molecule that binds to the first affinity molecule comprises protein A or protein G.

(161) 34. The kit of paragraphs 26 or 29, wherein the first affinity molecule comprises an antibody that specifically binds to a chromatin-associated factor, an antibody that specifically binds to an affinity tag, avidin, streptavidin or biotin.

(162) 35. The kit of paragraph 34, wherein the affinity tag is FLAG-tag, myc-tag, biotin, or DHFR.

(163) 36. The kit of paragraph 34, wherein the wherein the antibody is an anti-FLAG antibody, an anti-myc antibody, or an anti-DHFR antibody.

(164) 37. The kit of paragraph 29, wherein the bead is a magnetic bead.

(165) 38. A method of preparing an indexed sequence library comprising: (a) purifying or obtaining purified ChIP DNA processed using any one of the preceding methods; (b) adding unique sequence identifiers to the purified ChIP DNA; and (c) selecting the ChIP DNA in (b) based on size.

(166) 39. The method of paragraph 38, further comprising assessing the ChIP DNA in (c) for enriched molecular binding sites.

(167) 40. The method of paragraph 38 or paragraph 39, further comprising sequencing the ChIP DNA.

(168) 41. The method of any one of paragraphs 1-25 or 38-40, wherein the method is performed using a multi-well format or a microfluidic chamber/channel.

(169) 42. The method of any one of paragraphs 1-25 or 38-40, wherein the library is constructed on magnetic particles.

EXAMPLES

(170) The present invention will be more specifically illustrated by the following examples. However, it should be understood that the present invention is not limited by these examples in any manner. Other examples in accordance with certain aspects and embodiments of the invention are described in international application number PCT/US2011/054072, filed Sep. 29, 2011, which claims the benefit under 35 U.S.C. 119(e) of U.S. provisional application Ser. No. 61/387,689, filed Sep. 29, 2010, each of which is incorporated by reference herein in its entirety.

Example 1

(171) A series of different tissues or cells are subjected to genome-wide mapping of various histone modifications, one of which is histone tri-methylated H3 lysine 4 (H3K4me3). Pre-determined amounts of polypeptide-oligonucleotide conjugates representing either a H3K4me3 histone or an un-methylated histone are spiked into each tissue/cell sample prior to immunoprecipitation. The samples are then be subjected to parallel processing and immunoprecipitation. High-throughput sequencing is used to identify the specific genomic sequences enriched and to determine the degree of enrichment across the tissue/cell samples analyzed. The relative ratios of the polypeptide-oligonucleotide conjugates determined in the sequencing step are used to determine the efficiency of H3K4me3 enrichment in each of the parallel assays. This information is used to normalize the signal data across the multiple samples (to account for inherent variation in the immunoprecipitation step), thereby enabling direct comparisons of enrichment values.

Example 2

(172) Four 125 bp DNA strands comprising unique sequences (U) were generated: two complimentary pairs in which the upper strand in each pair was conjugated to either the peptide recognized by an antibody specific for H3K4me3 (Millipore, catalogue Number: 07-473, rabbit, polyclonal) or the same peptide without the methylation modificationas a specificity control, that should not be recognized.

(173) TABLE-US-00008 IS(1) (SEQIDNO:73) ARTK(me3)QTAR (SEQIDNO:74) -GGC-TGCAGGGACGAGTAGCACATATCGACCAGGAACGAGTAGCACTAG ACCCACCGGGAGGAGTAGAAGTAGTTCAGGGTGCGGTAGACCCGGATATG AATGGAGACCCACTACCTCGCGACCGAGGA,(C6-SH modificationaddedto60thbase); (2) (SEQIDNO:71) ARTKQTAR (SEQIDNO:72) -GGC-CTGGCATGCAAGGGGCGGAGGGTGAACGACTAGCACATATCGACC AGGAACGAGTAGCACTAGACCCACCGGGAGGAGTAGAAGTAGTTCAGGGT GCGGTGAAACAGGATGTGAACCGCGATCCT,(C6-SH modificationaddedto60thbase); (3)Nopeptide- (SEQIDNO:76) AGGATCGCGGTTCACATCCTGTTTCACCGCACCCTGAACTACTTCTACTC CTCCCGGTGGGTCTAGTGCTACTCGTTCCTGGTCGATATGTGCTAGTCGT TCACCCTCCGCCCCTTGCATGCCAG; and (4)Nopeptide- (SEQIDNO:75) TCCTCGGTCGCGAGGTAGTGGGTCTCCATTCATATCCGGGTCTACCGCAC CCTGAACTACTTCTACTCCTCCCGGTGGGTCTAGTGCTACTCGTTCCTGG TCGATATGTGCTACTCGTCCCTGCA.

(174) In order to evaluate the efficiency of the internal standard (IS), two ChIP experiments were carried out with either the H3K4me3 (Millipore, catalogue Number: 07-473, rabbit, polyclonal) antibody that should recognize IS (1) or with a non-relevant control antibody that should recognize H3K36me3 (Abcam, catalogue Number: ab9050, rabbit, polyclonal), but none of the IS in this experiment. 310.sup.6 mouse ES cells cross-linked with 1% formaldehyde were lysed and then sonicated using Branson sonifier. The samples were then separated into two ChIP experiments-one for each antibody. The two polypeptide-oligonucleotide conjugates were annealed each with the complementary strand and both were spiked to each ChIP. The samples were incubated overnight with the specific antibodies, and the bound fraction was pulled down (immuno-precipitated) and washed according to published protocols, e.g. (Ku M et al. (2008) Genomewide. Analysis of PRC1 and PRC2 Occupancy Identifies Two Classes of Bivalent Domains. PLoS Genet 4(10): e1000242). DNA was purified using QIAGEN MINIELUTE KIT (QIAgen). The specific immunoprecipitation was evaluated using qPCR. Using the primers specific for the H3K4me3-IS: Up primerTCCTCGGTCGCGAGGTAGT (SEQ ID NO: 77); Down primerGTAGTTCAGGGTGCGGTAGACCCGG (SEQ ID NO: 78), the ratio of H3K4me3-IS immunopercipitated in the ChIP with H3K4me3 antibody was as high as 75-fold over the ChIP performed with the non-relevant antibody specific for H3K36me3. Using the primers that amplify the Control-IS: Up primerAGGATCGCGGTTCACATCCTGTT (SEQ ID NO: 79); Down primerCTGGCATGCAAGGGGCGGA (SEQ ID NO: 80) the ratio between the ChIP performed with the H3K4me3-specific over the ratio in the ChIP performed with the control antibody (H3K36me3) was about 1-showing no specific immunopercipitation. Furthermore, in order to compare between enrichments in two reactions of a given peptide, the ratio of H3K4me3/Control qPCR results from the ChIP performed with H3K4me3 was divided by the results of ChIP performed with the control antibodyH3K36me3. This ratio takes into account the primer efficiency. The resulting enrichment was up to 86-fold of specific immunoprecipitation of the H3K4me3-IS (Table 1).

(175) TABLE-US-00009 TABLE 1 (K4/K36){circumflex over ()}K4- Pos Cp K4/K36 ChIP/(K4/K36){circumflex over ()}K36-ChIP H3_qPCR K4 A1 20.44 20.4 1.160704 A2 20.41 K36 A3 20.27 20.6 A4 21.01 H3K4me3_qPCR K4 C1 14.71 15.0 30.90996 26.63035951 C2 15.2 K36 C3 19.87 19.9 C4 19.94 H3_qPCR_long K4 E1 20.44 20.5 0.861546 E2 20.5 K36 E3 20.6 20.3 E4 19.91 H3K4me3_qPCR_long K4 G1 15.19 15.4 37.79177 43.86504976 G2 15.59 K36 G3 20.37 20.6 G4 20.89 H3_qPCR_short K4 I1 19.51 19.7 0.870551 I2 19.85 K36 I3 19.06 19.5 I4 19.9 H3K4me3_qPCR_short K4 K1 14.18 14.5 45.88657 52.70982511 K2 14.88 K36 K3 19.85 20.1 K4 20.25 H3K4me3_qPCR_Vshort K4 M1 14.03 14.2 75.58353 86.82267696 M2 14.41 K36 M3 20.07 20.5 M4 20.85

Example 3

(176) Internal Standards (IS) Protocol

(177) Each internal standards is provided as a 50 l aliquot of 20 ng IS. The IS is diluted accordingly (10.sup.4), and 10-100 femtograms (fg) of IS are added after the sonication procedure. 100 fg allows enrichment with a H3K4me3 antibody at cycle 26 of qPCR, while 10 fg yields enrichment at cycle 30.

(178) Primers (mixes of either of the two up primers with each of the four down primers, resulting in 8 options). Run qPCR at 65 C. annealing temperature:

(179) TABLE-US-00010 H3K4me3_qPCR_up_long (SEQIDNO:81) TCCTCGGTCGCGAGGTAGT H3K4me3_qPCR_up (SEQIDNO:82) CGCGAGGTAGTGGGTCTC H3K4me3_qPCR_down_long (SEQIDNO:83) TGCAGGGACGAGTAGCA H3K4me3_qPCR_down (SEQIDNO:84) ATCGACCAGGAACGAGTAGC H3K4me3_qPCR_down_short (SEQIDNO:85) CCACCGGGAGGAGTAGAAG H3K4me3_qPCR_down_60bp (SEQIDNO:33) GTAGTTCAGGGTGCGGTAGACCCGG

EQUIVALENTS AND SCOPE

(180) Those skilled in the art will recognize or be able to ascertain using no more than routine experimentation many equivalents to the specific embodiments described herein. The scope of the present invention is not intended to be limited to the above Description, but rather is as set forth in the appended claims.

(181) In the claims articles such as a, an, and the may mean one or more than one unless indicated to the contrary or otherwise evident from the context. Claims or descriptions that include or between one or more members of a group are considered satisfied if one, more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process unless indicated to the contrary or otherwise evident from the context. The invention includes embodiments in which exactly one member of the group is present in, employed in, or otherwise relevant to a given product or process. The invention includes embodiments in which more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process. Furthermore, it is to be understood that the invention encompasses all variations, combinations, and permutations in which one or more limitations, elements, clauses, descriptive terms, etc., from one or more of the listed claims is introduced into another claim. For example, any claim that is dependent on another claim can be modified to include one or more limitations found in any other claim that is dependent on the same base claim. Furthermore, where the claims recite a composition, it is to be understood that methods of using the composition for any of the purposes disclosed herein are included, and methods of making the composition according to any of the methods of making disclosed herein or other methods known in the art are included, unless otherwise indicated or unless it would be evident to one of ordinary skill in the art that a contradiction or inconsistency would arise.

(182) Where elements are presented as lists, e.g., in Markush group format, it is to be understood that each subgroup of the elements is also disclosed, and any element(s) can be removed from the group. It should it be understood that, in general, where the invention, or aspects of the invention, is/are referred to as comprising particular elements, features, etc., certain embodiments of the invention or aspects of the invention consist, or consist essentially of, such elements, features, etc. For purposes of simplicity those embodiments have not been specifically set forth in haec verba herein. It is also noted that the term comprising is intended to be open and permits the inclusion of additional elements or steps.

(183) Where ranges are given, endpoints are included. Furthermore, it is to be understood that unless otherwise indicated or otherwise evident from the context and understanding of one of ordinary skill in the art, values that are expressed as ranges can assume any specific value or sub-range within the stated ranges in different embodiments of the invention, to the tenth of the unit of the lower limit of the range, unless the context clearly dictates otherwise.

(184) In addition, it is to be understood that any particular embodiment of the present invention that falls within the prior art may be explicitly excluded from any one or more of the claims. Since such embodiments are deemed to be known to one of ordinary skill in the art, they may be excluded even if the exclusion is not set forth explicitly herein. Any particular embodiment of the compositions of the invention can be excluded from any one or more claims, for any reason, whether or not related to the existence of prior art.

OTHER EMBODIMENTS

(185) The foregoing has been a description of certain non-limiting preferred embodiments of the invention. Those of ordinary skill in the art will appreciate that various changes and modifications to this description may be made without departing from the spirit or scope of the present invention, as defined in the following claims.