Use of Th9 cells and IL-9 for the treatment of melanoma

09629910 · 2017-04-25

Assignee

Inventors

Cpc classification

International classification

Abstract

Described herein are methods for the treatment of cancer (e.g. melanoma, lung cancer, or other cancers). The methods involve administrating to a subject in need thereof an agonist of the IL-9 receptor (e.g. IL-9), e.g. an agent that binds and activates the IL-9 receptor, or an agent that increases IL-9 expression in the subject (e.g. administration of TH9 cells that express IL-9, or administration of an inhibitor of ROR).

Claims

1. A method for treating melanoma in a subject comprising administering to a subject in need thereof a therapeutically effective amount of an agonist of an interleukin-9 receptor (IL-9R), wherein the agonist of IL9-R comprises a population of Th9 cells or an IL-9 polypeptide, wherein the IL-9 polypeptide is selected from the group consisting of: SEQ ID NO: 2, amino acids 19-144 of SEQ ID NO: 2, SEQ ID NO: 15 and SEQ ID NO: 16.

2. The method of claim 1, wherein the agonist further comprises a pharmaceutically acceptable carrier.

3. The method of claim 1, wherein the subject is human.

4. The method of claim 1, wherein the agonist is administered by a route selected from the group consisting of: intratumor, adoptive cell transfer, and parenteral administration.

Description

BRIEF DESCRIPTION OF FIGURES

(1) FIGS. 1A-1D depict the results of experiments in which B16F10 melanoma cells were injected subcutaneously into ROR/ ch and ROR+/+ ch mice. Tumor growth (FIG. 1A) and mice survival (FIG. 1B) was monitored over time. FIG. 1C demonstrates that tumor infiltrating lymphocytes (TILs) were recovered and counted as described in methods. FIG. 1D demonstrates that tumor draining LNs were isolated and restimulated with PMA plus ionomycin for 6 h in presence of golgistop. Expression of IL-17A, IFN-, and TNF- by CD4+ and CD8+T cells was analyzed by flow cytometry. Data is represented as MeanSEM in a, b (n=8 mice per group (p<0.005: ***), in c (TILs from 4 mice were pooled and analyzed) and in d (n=8 mice per group, p<0.005: ***, p<0.025: **). Two-three additional independent experiments provided similar results.

(2) FIG. 2 demonstrates that sorted naive Th cells (CD4+CD25-CD62Lhigh) from ROR+/+ and ROR/ mice were differentiated under Th17 polarizing conditions. After 4 days, cells were harvested for transcriptional profiling experiments. Gene expression analysis was performed and expression of a set of genes is depicted as fold change (ROR/ vs. ROR+/+). Two additional microarray analyses provided similar results.

(3) FIGS. 3A-3D depict the effect on melanoma immunity when IL-9 is inhibited. FIG. 3A demonstrates that B16F10 melanoma cells were injected subcutaneously into ROR/ ch, and control mice (ROR+/+ch). Anti-IL-9 neutralizing antibody was administered (i.p.) to ROR/ ch mice. FIG. 3B depicts the results when sorted naive Th cells (CD4+CD25-CD62Lhigh) from IL-23R+/+ and IL-23R/ mice were differentiated under Th17 polarizing conditions. After 4 days, cells were harvested and restimulated with plate bound anti-CD3/CD28 for 48 h. IL-9 and IL-17A were estimated by ELISA in cell free supernatants. FIG. 3C depicts the results when B16F10 melanoma cells were injected subcutaneously into IL-23R/ and their controls. Anti-IL-9 neutralizing antibody was administered (i.p.) to both IL-23R+/+ and IL-23R/ mice. Melanoma growth was monitored over time. FIG. 3D depicts the results when tumor draining lymph node cells (LNCs) from IL-23R+/+ (WT) and IL-23R/ mice were isolated and stimulated with plate bound anti-CD3 (2 g/ml)/anti-CD28 mAbs (1 g/ml). After 48 h, culture supernatant was collected and IL-9 and IL-17 were estimated by ELISA. Data is represented as MeanSEM and statistically significant differences were observed compared to controls (p<0.005: ***, p<0.025: **, p<0.05: *). Two additional independent experiments produced similar results.

(4) FIGS. 4A-4C depict experiments where differentiated OT2-Th cells from OT2 mice were generated and transferred (iv) into WT mice (WT-C57BL/6: (FIG. 4A) or Rag1/ C57BL/6 mice (FIG. 4B-4C). On the same day, B16F10-ova cells were injected subcutaneously. Melanoma growth was monitored over time (FIGS. 4A-4C). Neutralizing anti-IL-9 mAb or isotype was given (IP) to OT2-Th9 treated mice (FIG. 4B). Data is represented as MeanSEM (FIGS. 4A-4C) and statistically significant differences were observed compared to no-T cells group (FIG. 4A), and as depicted (FIGS. 4B-4C) (p<0.005: ***, p<0.025: **, p<0.05: *).

(5) FIGS. 5A-5F depict the results of experiments where various cancer cell types were injected into mice. In FIGS. 5A, 5B, 5D, and 5E B16F10 melanoma cells were injected subcutaneously into IL-9R/ and controls (IL-9R/+) mice (FIG. 5A), normal WT mice (FIG. 5B) and Rag1/ mice (FIG. 5D) and Kit W-sh (mast cell deficient) mice (FIG. 5E). In FIGS. 5C and 5F, Lewis lung carcinoma cells were injected subcutaneously into normal WT mice (FIG. 5C) and Kit W-sh (mast cell deficient) mice (FIG. 5F). Where indicated, rIL-9 was administered (i.p.). Control mice received PBS. Tumor growth was monitored over time. Data is represented as MeanSEM (n=4 mice per group, 2-4 additional independent experiment produced similar results, and statistically significant differences were observed compared to controls (p<0.025: **, p<0.05: *, ns: not significant).

(6) FIGS. 6A-6C depict the results of experiments to detect T cells in human samples. In FIGS. 6A-6B, memory T cells (CD4+CD45RO+) from peripheral blood after stimulation with anti-CD3/CD28 mAbs plus TGF- and skin-resident T cells isolated by skin-explant culture of healthy donors were stained for IL-9, IFN, IL-17 and IL-4 and analyzed by flow cytometry. In FIG. 6C, memory T cells (CD4+CD45RO+) from peripheral blood of healthy donors, skin T cells from healthy donors and tumor-infiltrating lymphocytes of metastatic melanoma were extracted and stimulated for 2 days with anti-CD3/CD2/CD28 beads in the presence of IL-2 plus TGF-. IL-9 production was measured in cell free supernatants by luminex assay. Data is represented as MeanSEM (skin: n=8, PBMCs: n=3, MM: n=8).

(7) FIG. 7 demonstrates comparable numbers of CD4+ and CD8+T cells in the spleen of ROR/ ch and ROR+/+ch mice. Rag1/ mice were reconstituted with bone marrow of ROR+/+ or ROR/ mice. After 8 weeks, numbers of CD4+ and CD8+T cells were analyzed by flow cytometry in the spleen of ROR/ chimeric mice (ROR/ ch) and ROR+/+ch mice.

(8) FIGS. 8A-8C depict the comprehensive cytokine profile of ROR/ T cells. Sorted CD4+CD25-CD62Lhigh+ cells from spleen of WT and ROR/ mice were polarized under Th17 or Th9 conditions. After 4 days of differentiation, cells were harvested for mRNA analysis (FIG. 8A) or intracellular staining of cytokines (FIG. 8B). FIG. 8C depicts FACS analysis of these cells.

(9) FIGS. 9A-9H depict IL9 expression in ROR/ Th2 and Th9 cells. Sorted CD4+T cells (FIGS. 9A and 9B), sorted CD4+CD25-CD62Llow cells (memory CD4+T cells, FIGS. 9C-9E), and sorted CD4+CD25-CD62Lhigh+ cells (nave CD4+T cells, FIG. 9F) from spleen of WT and ROR/ mice were stimulated with plate bound anti-CD3 (2 g/ml) and anti-CD28 Abs (1 g/ml). After 2 and 4 days, cells were analyzed for IL9 mRNA expression by real-time RT-PCR (FIGS. 9A, 9C) and supernatant was estimated for IL9 secretion by CBA (FIGS. 9B, 9E and 9F). In FIG. 9D, memory CD4+T cells were re-stimulated with PMA plus ionomycin in presence of golgi-stop for 6 h. IL9 was stained and analyzed by flow cytometry. A representative data set is depicted. Two to three additional experiments provided similar results. In FIGS. 9G-9H, sorted naive CD4+T cells from WT and ROR/ mice were differentiated under Th2 and Th9 polarizing condition. After 2 and 4 days, supernatant was collected and IL9 was quantified by CBA (FIGS. 9G and 9H).

(10) FIGS. 10A-10E depict antitumor effects of IL-9 in vaccinated mice, IL-9R expression on tumor cells and effect of rIL9 on tumor cell growth. In FIG. 10A, B16F10 melanoma cells were injected subcutaneously into vaccinated normal WT mice. Mice were treated with IL-9 or PBS. Tumor growth was monitored over time. (FIGS. 10B-10C) IL-9R expression was quantified using Taqman real-time RT PCR. Data is represented as MeanSEM. In FIG. 10D, rIL-9 was added at different concentrations into the B16F10 tumor cell culture and tumor cell growth was measured at indicated time points as described in methods. In FIG. 10E, TILs were isolated from tumor growing in WT mice. IL-9 was stained and quantified by flow cytometry.

(11) FIGS. 11A-11B depict cytokine expression of differentiated Th cells. FIG. 11A depicts the results of an experiment in which sorted CD4+CD25-CD62Lhigh (naive CD4+T cells) from OT2 mice were polarized towards Th0, Th1, Th2, Th9 and Th17 as described in method section. Intracellular cytokine expression was analyzed by flow cytometry before adoptive transfer into mice. In FIG. 11B, IL-9, IFNg, GranzymeB and IL-10 was quantified at mRNA level in differentiated Th9 cells using quantitative RT-PCR (qPCR).

(12) FIGS. 12A-12C depict the results of experiments to determine the ability of various cells to induce apoptosis in melanoma cells. FIG. 12A depicts the results of an experiment in which OT2-Th0, OT2-Th9 c, or OT2-Th17 cells were incubated with B16F10-ova cells for 24 h. B16F10-ova cell lysis was quantified by 7AAD staining FIG. 12B depicts the results of an experiment in which OT2-Th9 cells were pre-incubated (30 min) with granzyme-B inhibitor or control (DMSO) before co-culture with B16F10 ova cells. After 24 h, B16F10-ova cell lysis was quantified by 7AAD staining. Data is represented as percentage inhibition. Th9 cell cytotoxicity was considered as 100%. FIG. 12C depicts the results of an experiment in which CFSE labeled B16F10-ova cells (5 M) and EL-4 cells (0.5 M) were incubated with different effector/target ratio (E/T ratio: as indicated) with or without OT2-Th0, and OT2-Th9 cells for 36 h. Tumor cell lysis was measure as described in methods.

DETAILED DESCRIPTION

(13) Described herein are methods for treating cancer in a subject that has, or at risk of having, cancer. The methods comprise administration to a subject a therapeutically effective amount of an agent that is an agonist of the IL-9 receptor (IL-9R).

(14) As used herein, the term IL-9 receptor or IL-9R refers to the transmembrane protein that is the cell surface receptor for interleukin 9 (IL-9). The IL9-R is a two subunit receptor. The first subunit is the common gamma chain or IL2RG (e.g. NCBI Gene ID: 3561; SEQ ID NO: 6 (Homo Sapiens)), which is a shared component of the receptor complexes for at least IL-2, IL-4, IL-7, IL-13, and IL-15. The human IL2RG polypeptide is e.g. encoded by the cDNA of SEQ ID NO: 5. The second subunit of the IL-9 receptor is e.g. the IL-9R protein (NCBI Gene ID: 3581; SEQ ID NO: 4 (Homo Sapiens)) which provides specificity for IL-9. The extracellular domains of human and murine IL-9R have 67% homology, while the cytoplasmic regions are less conserved. The IL9-R is 522 amino acids. The IL-9R polypeptide is e.g. encoded by the cDNA of SEQ ID NO: 3 (Homo Sapiens). IL-9R mediated signal transduction is initiated when the IL-9 polypeptide is recognized by the IL-9 receptor expressed on the surface of a target cell. Embodiments of the invention encompass homologs and variants of the IL-9 receptor described herein.

(15) IL9-R Agonists

(16) As used herein, the term agonist refers to any agent that activates or increases activity mediated by the IL-9 receptor (IL-9R). Thus, the term IL-9R agonist includes any agent that activates the IL-9R or increases IL-9R activity in comparison to IL-9R activity in the absence of the agonist. An IL-9R agonist may be an agent that binds to the IL-9R thereby inducing signal transduction mediated by the receptor (e.g. the cytokine interleukin 9 (IL-9), or an agent that mimics IL-9), also known as a direct agonist. Alternatively, the IL-9R agonist may be an agent that increases IL-9 expression in a subject, also known as an indirect agonist (e.g. Th9 cells administered by adoptive transfer express IL-9, or administration of transforming growth factor beta (TGF) and interleukin-4 (IL-4)). In certain embodiments, the IL-9R agonist is an agent that induces the activity of a downstream signaling molecule that is activated by the IL-9R.

(17) As used herein, the terms activity mediated by the IL-9 receptor and IL-9R activity refers to IL-9 receptor (IL-9R) mediated signal transduction. An agent that activates the IL-9R is an agent that stimulates IL-9 receptor (IL-9R) mediated signal transduction. Signal transduction mediated by the IL-9R is known to involve, for example, tyrosine phosphorylation of STAT3 which is unique to the IL-9 pathway, and expression of IL-9 specific marker genes including but not limited to TH2AF1 (SEQ ID NOs: 7-8 and described in US Patent Publication US 2008/009%981, which is incorporated by reference herein in its entirety) and ICACC (also CLCA2, SEQ ID NOs: 9-10; described in U.S. Pat. No. 6,716,603, which is incorporated by reference herein in its entirety). Means for assaying IL-9R activity are well known to those of skill in the art. For example, an increase in expression of TH2AF1 or ICACC, at either the mRNA or protein level can indicate activation of IL-9 signaling in a cell. Reporter gene constructs can be useful in such assays. For example, the promoter of TH2AF1 can be coupled to the protein coding sequence of a detectable reporter gene (e.g. GFP) and the expression of the reporter gene detected by, e.g. a fluorescence detector. IL-9 receptor signal transduction activates STAT 1, STAT3 and STAT5 transcription factors. Guidance for assays for IL-9R activity may also found in Goswami and Kaplan (2011), A brief history of IL-9 Journal of Immunology vol. 186 no. 6 3283-3288.

(18) As used herein, the term IL-9R selective agonist refers to an IL-9R agonist that activates the IL-9R to a significantly greater degree than it stimulates any other receptor, e.g. cytokine receptor. In one embodiment, the agent acts as an agonist of the IL-9R and for no other cytokine receptor. In one embodiment, the IL-9R agonist acts primarily as an agonist of IL9-R, but also induces minor levels of activity mediated by another cytokine receptor.

(19) Any agent that acts as an agonist of the IL-9R can be used in the methods described herein, e.g. administered to a subject for the treatment of cancer.

(20) As used herein, the terms compound or agent are used interchangeably and refer any organic or inorganic molecule, including modified and unmodified nucleic acids such as antisense nucleic acids, RNAi, such as siRNA or shRNA, peptides, small molecules peptidomimetics, receptors, ligands, and antibodies. The agents include, but are not limited to, chemical compounds and mixtures of chemical compounds, e.g., small organic or inorganic molecules; saccharines; oligosaccharides; polysaccharides; biological macromolecules, e.g., peptides, proteins, and peptide analogs and derivatives; peptidomimetics; nucleic acids; nucleic acid analogs and derivatives; extracts made from biological materials such as bacteria, plants, fungi, or animal cells or tissues; naturally occurring or synthetic compositions; peptides; aptamers; and antibodies, or fragments thereof. The agent may activate the IL-9 receptor directly (e.g. the cytokine IL-9), or may activate the IL-9 receptor indirectly, e.g. by inhibition of ROR gamma activity, by modulating a downstream signaling molecule of the IL-9R, or by increasing expression of IL-9 in a subject.

(21) An agonist agent can be a nucleic acid RNA or DNA, and can be either single or double stranded. Example nucleic acid agents include, but are not limited to, a nucleic acid encoding a protein inhibitor (e.g. transcriptional inhibitors), oligonucleotides, nucleic acid analogues (e.g. peptide-nucleic acid (PNA), pseudo-complementary PNA (pc-PNA), locked nucleic acid (LNA) etc.), antisense molecules, ribozymes, small inhibitory or activating nucleic acid sequences (e.g. RNAi, shRNAi, siRNA, micro RNAi (mRNAi), antisense oligonucleotides etc.).

(22) An agonist protein and/or peptide agent can be any protein that increases IL-9R activity as compared to IL-9R activity in the absence of the agonist, and may be for example a protein or peptide that modulates gene expression or a protein/peptide that modulates protein activity. Non-limiting examples include mutated proteins; therapeutic proteins and truncated proteins, e.g. wherein the protein is normally absent or expressed at lower levels in the target cell. Proteins can also be selected from genetically engineered proteins, peptides, synthetic peptides, recombinant proteins, chimeric proteins, or antibodies.

(23) Any agonist of IL-9R can be used in methods described herein. The agonists may be direct or indirect agonists.

(24) In one embodiment, the agent is a direct agonist of IL-9R, i.e. the agonist binds to the IL-9R and activates the receptor. For example, in one embodiment, the agonist comprises the cytokine interleukin-9 (IL-9), or fragment thereof, such as natural or recombinant interleukin 9 (rIL-9). Example direct agonist, include but are not limited to: IL-9; the IL-9 peptide KP-20 (SEQ ID NO:15) or KP-89 (SEQ ID NO: 16) (described in International Patent Publication WO/1998/027997; which is incorporated herein by reference in its entirety).

(25) As used herein, IL-9 refers to a 4-helix bundle cytokine that is produced by T-cells, specifically by CD4+ helper cells (e.g. activated Th2 cells, or Th9 cells). Alternative names for IL-9 include, but are not limited to, P40, HP40, T-cell growth factor p40, interleukin-9, or P40 cytokine IL-9 acts as a regulator of a variety of hematopoietic cells and is known to stimulate cell proliferation and prevent apoptosis. IL-9 functions through the interleukin-9 receptor (IL-9R), which activates different signal transducer and activator (STAT) proteins. Both human (e.g. Gene ID: 3578; SEQ ID NO: 2, Gene bank Accession NP_000581.1) and murine IL-9 protein sequences contain 144 residues with a signal peptide of 18 amino acids. The IL-9 protein is encoded e.g. by the cDNA of SEQ ID NO: 1, Gene bank Accession NM_000590.1. IL-9 is expressed by activated T cells and mast cells and can function as a T cell growth factor. Further, IL-9 mediates the growth of erythroid progenitors, B cells, mast cells, eosinophils, and fetal thymocytes, and acts synergistically with interleukin-3 (IL-3) to induce mast cell activation and proliferation. IL-9 further promotes the production of mucin by lung epithelium. In addition, IL-9 potentiates the IL-4 induced production of IgE, IgG, and IgM by normal human B lymphocytes, and the IL4 induced release of IgE and IgG by murine B lymphocytes. Embodiments of the invention encompass use of homologs and variants of the IL-9 cytokine described herein.

(26) In some embodiments, IL-9R activity may be increased in a subject by administering an IL-9 polypeptide agonist to the subject. An IL-9 polypeptide administered to a subject according to the methods described herein can be human IL-9 or a homologue, variant, conservative substitution, or functional fragment thereof. By way of non-limiting example, the IL-9 amino acid sequences are known for at least mouse, rat, and chimpanzee. One of ordinary skill in the art is familiar with how to align homologous peptide sequences to determine which amino acid residues are particularly conserved. IL-9 variants can include the mature version of IL-9 lacking the signal peptide, i.e. an IL-9 variant can be amino acids 19-144 of SEQ ID NO: 2.

(27) In some embodiments, the IL-9 polypeptide may be recombinant, i.e. expressed in an organism which does not naturally produce IL-9, or variant of IL-9. Means for making recombinant IL-9 (rIL-9) are well known to those of skill in the art, e.g. as described in U.S. Pat. No. 5,581,753, herein incorporated by reference in its entirety, e.g. U.S. Pat. No. 5,581,753 describes DNA encoding the human cytokine interleukin-9 as well as means for expressing and purifying recombinant IL-9. Alternatively, recombinant IL-9 can be obtained from commercial sources (e.g. recombinant human or mouse IL-9 may be obtained from PRO SPEC protein specialists of Ness-Ziona, Israel; or Cell Sciences of Canton, Mass.). In one embodiment, the IL-9 is isolated from culture conditioned medium of mitogen- or antigen-stimulated T-helper cells. In cultures of primary lymphocytes, IL-9 is produced predominantly by cells expressing CD4. The synthesis of IL-9 can be induced by Phorbol esters and Calcium ionophore.

(28) In some embodiments, IL-9R activity may be increased in a subject by administering an agonist cDNA or nucleic acid analog that encodes a IL-9 polypeptide (e.g. a nucleic acid of SEQ ID NO: 1). The nucleic acid encoding an IL-9 polypeptide may comprise a vector. In some embodiments, the nucleic acid encoding an IL-9 polypeptide further comprises an expression vector. The term vector, as used herein, refers to a nucleic acid construct designed for delivery to a host cell or for transfer between different host cells. As used herein, a vector can be viral or non-viral. The term vector encompasses any genetic element that is capable of replication when associated with the proper control elements and that can transfer gene sequences to cells. A vector can include, but is not limited to, a cloning vector, an expression vector, a plasmid, phage, transposon, cosmid, chromosome, virus, virion, etc. As used herein, the term expression vector refers to a vector that directs expression of an RNA or polypeptide from sequences linked to transcriptional regulatory sequences on the vector. The sequences expressed will often, but not necessarily, be heterologous to the cell. An expression vector may comprise additional elements, for example, the expression vector may have two replication systems, thus allowing it to be maintained in two organisms, for example in human cells for expression and in a prokaryotic host for cloning and amplification.

(29) In some embodiments, the agonist of IL-9R comprises an antibody. The antibody agonist may be a direct or indirect agonist. As used herein the term antibody refers to immunoglobulin molecules and immunologically active determinants of immunoglobulin molecules, e.g., molecules that contain an antigen binding site which binds, e.g. specifically binds, (immunoreacts with) a protein to be activated or inhibited in order to increase the activity of the IL-9R, (e.g. immunoreacts with the IL-9R). The term antibody encompasses whole antibodies, e.g., of any isotype (IgG, IgA, IgM, IgE, etc), and includes fragments thereof which are also reactive with IL-9R protein. Antibodies can be fragmented using conventional techniques, e.g. proteolytically-cleaved or recombinantly-prepared portions of an antibody molecule that are capable of reacting with the particular protein of interest. Non limiting examples of such proteolytic and/or recombinant fragments include Fab, F(ab)2, Fab, Fv, dAbs, diabodies, and single chain antibodies (scFv) containing a VL and VH domain joined by a peptide linker. The scFv's may be covalently or non-covalently linked to form antibodies having two or more binding sites, e.g. divalent, trivalent, tetravalent etc. The antibodies may be polyclonal or monoclonal, or other purified preparations of antibodies and recombinant antibodies, e.g. humanized antibodies, bispecific antibodies, and chimeric molecules having at least one antigen binding determinant derived from an antibody molecule.

(30) In an alternative embodiment, the agonist comprises an agent that is an indirect agonist of the IL-9 receptor, i.e. the agent does not directly bind to the IL-9R and increases the activity of the receptor indirectly (e.g. by modulating downstream IL-9R signal transduction molecules, by increasing expression of IL-9 in the subject, or by inhibiting antagonists of IL-9R signal transduction).

(31) In some embodiments, the indirect agonist increases the amount of IL-9 in the subject, which in turn activates the IL-9R. We have discovered a role for Th17 transcription factor retinoid related orphan receptor-gamma (ROR-) in the increase in production of IL-9 (See Examples). Thus, in one embodiment the agonist used herein comprises an agent that comprises an inhibitor of ROR. As used herein Th17 transcription factor retinoid related orphan receptor-gamma (ROR-), or ROR refers to a DNA-binding transcription factor that is a member of the NR1 subfamily of nuclear receptors. The transcription factor plays an important regulatory role in thymopoiesis, e.g. by reducing apoptosis of thymocytes and promoting thymocyte differentiation into pro-inflammatory T helper 17 (Th17) cells. The RORt isoform of ROR is specific for T cells and promotes development of TH17 cells. The ROR isoform (SEQ ID NO: 12) is e.g. encoded by the cDNA of SEQ ID NO: 11 while the RORt isoform (SEQ ID NO: 14) is e.g. encoded by the cDNA of SEQ ID NO: 13. Embodiments of the invention encompass use of homologs and variants of ROR described herein.

(32) As used herein, the phrase inhibitor of ROR refers to an agent that inhibits the biological activity of ROR, an antagonist. The biological activity of ROR may be inhibited using an agent that inhibits the transcription regulatory activity of ROR, or an agent that down regulates expression or availability of ROR in a cell or organism (e.g. siRNA, shRNA). ROR biological activity may be assessed using in vitro assays well known to those of skill in the art. In one embodiment, inhibition of ROR activity is monitored by assaying for inhibition of IL-17 and/or IL-22 production in Th17 cells as an indicator of inhibition of ROR activity (e.g. by ELISA assay). In alternative embodiments, ROR activity assayed using cell lines with ROR reporter constructs that are commercially available, for example Cat Nos. K1883 and K1882 from Invitrogen (Grand Island, N.Y.) (e.g. See and Xu et al. (2011), J. Biol. Chem. 286(26):22707-22710).

(33) Any inhibitor of ROR may be used in the methods and compositions described herein. For example, various inhibitors of ROR are described in Solt et al. (2011) Nature, 472: 491-496, and Xu et al. (2011), J. Biol. Chem. 286(26):22707-22710, which are herein incorporated by reference in their entirety.

(34) Example ROR inhibitors include, but are not limited to: antisense RNAs specific for ROR and/or RORt; digoxin; Ursolic acid; SR1001 (Structure 1 below)(see Solt et al. Nature 2011 472:491-6); and TO901317 (Structure 2 below).

(35) ##STR00001##

(36) In some embodiments, the indirect agonist that increases expression of IL-9 comprises HTLV-1 Tax a 351 amino acid protein produced by Human T-lymphotropic virus 1 (HTLV-1) (SEQ ID NO: 17) (or comprises a nucleic acid that encodes the protein). HTLV-1 Tax-1 is known to induce expression of IL-9, as described in Chen et al. Blood 2008 111:5163-5172, which is incorporated herein by reference in its entirety.

(37) In an alternative embodiment, the indirect agonist that increases expression of IL-9 in the subject is cellular agent that expresses IL-9, e.g. Th9 cells, or cells genetically engineered to express IL-9.

(38) In some embodiments, IL-9R activity may be increased in a subject by administering cells which produce IL-9, e.g. Th9 cells, to the subject. As used herein, Th9 cells are CD4+ T cells which express IL-9 but not IFN-, IL-4, IL-5, IL-13 or IL-17. In humans, Th9 cells also do not express IL-10. The differentiation of T cells into Th9 cells can be accomplished in vitro by contacting nave CD4+ T cells with the combination of TGF- and IL-4 and activating the cells, or by contacting Th2 T-helper cells with TGF-. In some embodiments, IL-9 signaling can be increased in a subject by adoptive cell transfer of Th9 cells.

(39) In certain embodiments, a subject in need thereof is administered autologous tumor specific IL-9 producing T-cells (such as, Th9 cells); e.g. cancer specific IL-9 producing cells that are isolated from the subject and expanded in vitro, prior to administration back to patient. In certain embodiments, the autologous cancer specific T cells are isolated from the subject and transformed into IL-9 producing cells, e.g. by overexpression of IL-9, by differentiation using a cytokine cocktails that produce IL-9 producing cells, or by differentiation using other polarizing/differentiation agents.

(40) As used herein, adoptive cell transfer is the process of passively transferring cells, particularly immune-derived cells, into a new host with the goal of transferring the immunologic functionality and characteristics into the new host. In some embodiments, IL-9 producing cells are used in adoptive cell transfer according to the methods described herein. In some embodiments, cells comprising a nucleic acid encoding an IL-9 polypeptide are used in adoptive cell transfer according to the methods described herein. In some embodiments, Th9 cells are used in adoptive cell transfer according to the methods described herein.

(41) In some embodiments, the cells administered to the subject are autologous cells. For example, a blood sample can be obtained from a subject and Th2 T-helper cells isolated from the sample. The Th2 T-helper cells can be contacted with TGF- to convert them to Th9 cells and then administered to the same subject. In one embodiment the Th9 cells are further treated with IL-25 prior to administration to the subject (Angkasekwinai et al. (2010) Regulation of IL-9 expression by interleukin 25 (IL-25) signaling, Nature Immunology 3: 250-257). Methods of isolating Th2 T-helper cells are known to those of skill in the art and include FACS sorting of CD4+ cells. Th2 cells can be differentiated from other CD4+ cells by the expression of CCR4 and Crth2 and the lack of CSCR3, CCR6, CXCR5, or CD25 expression on the cell surface.

(42) In some embodiments, the indirect agonist that increases expression of IL-9 in the subject may be a cytokine or growth factor known to enhance expression of IL-9. In one embodiment, a combination of agonist agents is administered to a subject, e.g. a combination of transforming growth factor beta (TGF) and interleukin-4 (IL-4). In one embodiment, the agonist agent is IL-25 (Angkasekwinai et al. (2010) Regulation of IL-9 expression by interleukin 25 (IL-25) signaling, Nature Immunology 3: 250-257, herein incorporated by reference in its entirety).

(43) In addition, agonists for use in the methods described herein may be identified using screening assays. Candidate agonists of the IL-9R can be screened for the ability to activate IL-9R signaling by contacting a cell expressing the IL-9 receptor with the test agent and detecting modulation of IL-9 signaling activity. For example, an increase in expression of TH2AF1 or ICACC, at either the mRNA or protein level can indicate activation of IL-9R signaling in the cell. Reporter gene constructs can be useful in such assays. For example, the promoter of TH2AF1 can be coupled to the protein coding sequence of a detectable reporter gene (e.g. GFP) and the expression of the reporter gene detected by, e.g. a fluorescence detector.

(44) Candidate agents may also be screened for the ability to inhibit ROR by contacting a cell expressing the ROR with the test agent and detecting the modulation of the expression of genes which are transcriptionally regulated by ROR. Cell lines with ROR reporter constructs are commercially available, for example Cat Nos. K1883 and K1882 from Invitrogen (Grand Island, N.Y.).

(45) As used herein, the terms test compound or test agent are used interchangeably and refers to compounds and/or compositions that are to be screened for their ability to inhibit the number of neural crest progenitors. The test agents can include a wide variety of different compounds, including chemical compounds and mixtures of chemical compounds, e.g., small organic or inorganic molecules; saccharines; oligosaccharides; polysaccharides; biological macromolecules, e.g., peptides, proteins, and peptide analogs and derivatives; peptidomimetics; nucleic acids; antibodies, nucleic acid analogs and derivatives; an extract made from biological materials such as bacteria, plants, fungi, or animal cells; animal tissues; naturally occurring or synthetic compositions; and any combinations thereof. In some embodiments, the test agent is a small molecule.

(46) As used herein, the term small molecule refers to in organic or organic compounds. However, small molecules typically are characterized in that they contain several carbon-carbon bonds, and have a molecular weight of less than 5000 Daltons (5 kD), preferably less than 3 kD, still more preferably less than 2 kD, and most preferably less than 1 kD. In some cases it is preferred that a small molecule has a molecular weight equal to or less than 700 Daltons.

(47) The number of possible test agents runs into millions. Methods for developing small molecule, polymeric and genome based libraries are described, for example, in Ding, et al. J. Am. Chem. Soc. 124: 1594-1596 (2002) and Lynn, et al., J. Am. Chem. Soc. 123: 8155-8156 (2001). Commercially available compound libraries can be obtained from, e.g., ArQule, Pharmacopia, graffinity, Panvera, Vitas-M Lab, Biomol International and Oxford. These libraries can be screened using the screening devices and methods described herein. Chemical compound libraries such as those from NIH Roadmap, Molecular Libraries Screening Centers Network (MLSCN) can also be used. Compound libraries are well known and readily available in the art. A chemical library or compound library is a collection of stored chemicals usually used ultimately in high-throughput screening or industrial manufacture. The chemical library can consist in simple terms of a series of stored chemicals. Each chemical has associated information stored in some kind of database with information such as the chemical structure, purity, quantity, and physiochemical characteristics of the compound.

(48) In the methods of the invention, the test agents are typically provided free in solution, however the agent may be in complex with solid forms.

(49) In some embodiments, the test agent increases activation of the IL-9 receptor by at least 5%, 10%, 20%, 30%, 40%, 50%, 50%, 70%, 80%, 90%, 1-fold, 1.1-fold, 1.5-fold, 2-fold, 3-fold, 4-fold, 5-fold, 10-fold, 50-fold, 100-fold or more higher relative to an untreated control, e.g. as measured by increase in expression of TH2AF1 or ICACC, at either the mRNA or protein level.

(50) In some embodiments, the test agent inhibits ROR by at least 5%, 10%, 20%, 30%, 40%, 50%, 50%, 70%, 80%, 90%, 1-fold, 1.1-fold, 1.5-fold, 2-fold, 3-fold, 4-fold, 5-fold, 10-fold, 50-fold, 100-fold or more higher relative to an untreated control, e.g. as measured with ROR reporter constructs are commercially available, for example Cat Nos. K1883 and K1882 from Invitrogen (Grand Island, N.Y.).

(51) Methods of Treatment

(52) Provided herein are methods for treating or preventing cancer in a subject. The methods comprise administering to a subject in need thereof a therapeutically effective amount of an agent that is an agonist of the interleukin-9 receptor (IL-9R).

(53) As used herein, treatment, treating, prevention or amelioration of cancer refers to inhibition of growth of a tumor, inhibiting metastasis of cancer, delaying or preventing the onset of cancer, or reversing, alleviating, ameliorating, inhibiting, slowing down, or stopping the progression of cancer. The term treatment or treating, as used herein, does not encompass 100% cure of cancer. However, in one embodiment, the therapeutic methods described herein may result in 100% reversal of disease.

(54) As used herein, the term subject or patient or refers to any mammal. The patient is preferably a human, but can also be a mammal in need of veterinary treatment.

(55) The methods described herein are useful for the treatment of any type of cancer in a subject. As used herein, the term cancer includes any type of cancer. A cancer in a subject refers to the presence of cells possessing characteristics typical of cancer-causing cells, such as uncontrolled proliferation, immortality, metastatic potential, rapid growth and proliferation rate, and certain characteristic morphological features. Often, cancer cells will be in the form of a tumor, but such cells may exist alone within a subject, or may be a non-tumorigenic cancer cell, such as a leukemia cell. In some circumstances, cancer cells will be in the form of a tumor; such cells may exist locally within an subject, or circulate in the blood stream as independent cells, for example, leukemic cells. In one embodiment, the cancer may be tumorogenic cancer, i.e. a cancer associated with a tumor, or a skin lesion such as in melanoma.

(56) Examples of cancer include, but are not limited to, breast cancer, melanoma, adrenal gland cancer, biliary tract cancer, bladder cancer, brain or central nervous system cancer, bronchus cancer, blastoma, carcinoma, a chondrosarcoma, cancer of the oral cavity or pharynx, cervical cancer, colon cancer, colorectal cancer, esophageal cancer, gastrointestinal cancer, glioblastoma, hepatic carcinoma, hepatoma, kidney cancer, leukemia, liver cancer, lung cancer, lymphoma, non-small cell lung cancer, osteosarcoma, ovarian cancer, pancreas cancer, peripheral nervous system cancer, prostate cancer, sarcoma, salivary gland cancer, small bowel or appendix cancer, small-cell lung cancer, squamous cell cancer, stomach cancer, testis cancer, thyroid cancer, urinary bladder cancer, uterine or endometrial cancer, and vulval cancer.

(57) In certain embodiments, prior to treatment, the patients are selected for having a particular cancer, or for being at risk of a particular cancer. The presence of cancer can be determined by means well known to clinicians. Initial assessment of cancer is based on symptoms presented by the patient. In addition, there are follow-up diagnostic procedures, including, but not limited to PET scans, CAT scans, biopsies, and bio-marker assessments.

(58) Symptoms of cancer will vary dependent upon the type of cancer that is present. However, symptomatic signs of cancer, may include fatigue, weight loss or gain, or pale skin color.

(59) In one embodiment of the methods described herein, at least one symptom of cancer is alleviated by at least 5%, at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90%. In such an embodiment, the clinical signs and/or the symptoms associated with the cancer are lessened as a result of the administration of the agonist/s. The signs or symptoms to be monitored are characteristic of a particular cancer and are known to the skilled clinician, as well as the methods for monitoring the signs and conditions.

(60) In one embodiment of the methods described herein, the cancer is a tumor and the size is reduced by at least 5%, at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90%.

(61) In one embodiment of the methods described herein, the cancer is a lesion (e.g. melanoma lesion or lung cancer lesion) and the size is reduced by at least 5%, at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90%.

(62) In one embodiment of the methods describe herein, cancer cell proliferation, or cancer growth, is inhibited by at least 5%, at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90%. The skilled clinician may monitor the size or rate of growth of a tumor using a diagnostic imaging method typically used for the particular tumor (e.g., using ultrasound or magnetic resonance image (MRI) to monitor a tumor).

(63) In some embodiments, the methods described herein may be used to treat melanoma. The term melanoma as used herein includes all types of melanoma, including, for example, melanoma skin cancer, ocular melanoma, and mucosal melanoma. Melanoma is caused by changes melanocytes that produce melanin. There are four major types of melanoma: 1) superficial spreading melanoma, which is usually flat and irregular in shape and color, with different shades of black and brown and is most common in Caucasians, 2) nodular melanoma, which usually starts as a raised area that is dark blackish-blue or bluish-red, but can be colorless, 3) Lentigo maligna melanoma, which usually occurs in the elderly and is most common in sun-damaged skin on the face, neck, and arms. The abnormal skin areas are usually large, flat, and tan with areas of brown, 4) Acral lentiginous melanoma, which is the least common form and usually occurs on the palms, soles, or under the nails and is more common in African Americans. Melanomas may also appear in the mouth, iris of the eye, or retina at the back of the eye and can be found during dental or eye examinations. Although very rare, melanoma can also develop in the vagina, esophagus, anus, urinary tract, and small intestine.

(64) The presence of melanoma can be determined by means well known to those of skill in the art, e.g. tissue biopsies and in situ assays in which malignant melanoma (malignant melanocytes scattered in all epidermal layers) show atrophic epidermis, prominent dermal solar elastosis and almost always lymphocytic infiltration. Invasion of the dermis by melanocytes may occur in lentigo maligna melanoma. In addition, melanoma may be detected by methods that include, but are not limited, immunohistochemistry using the melanoma specific antibody HMB-45, or RT-PCR with different melanoma associated antigens (MAA) including, but not limited to tyrosinase, MART-1/Melan A, Pmel-17, TRP-1, and TRP-2 (see, e.g., Hatta N., et al., J Clin Pathol. 1998 August; 51(8):597-601). Biomarkers for melanoma are also known and can be used for example to assess subjects at risk of melanoma. Non-limiting example biomarkers for melanoma are described in PCT Publications WO 2008/141275, WO 2009/073513, or in U.S. Pat. No. 7,442,507, which are herein incorporated by reference in their entirety.

(65) Symptoms of melanoma include, but are not limited to, a mole, sore, lump, or growth on the skin that may bleed, or exhibit change in skin coloring. Often patients are told of an ABCDE system the can help them remember possible symptoms of melanoma to watch out for: Asymmetry: a mole where one half of the abnormal area is different from the other half; Borders, the edges of the growth are irregular; Color, the color changes from one area to another, with shades of tan, brown, or black, and sometimes white, red, or blue, e.g. a mixture of colors may appear within one sore; Diameter, the spot is usually (but not always) larger than 6 mm in diameter, about the size of a pencil eraser; and Evolution, the mole keeps changing appearance.

(66) In one embodiment of the methods described herein, at least one symptom of melanoma is alleviated by at least 5%, at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90%. In such an embodiment, the clinical signs and/or the symptoms associated with the melanoma are lessened as a result of the administration of the inhibitor/s. The signs or symptoms to be monitored are characteristic of a particular melanoma and are known to the skilled clinician, as well as the methods for monitoring the signs and conditions.

(67) In another embodiment, the practice of the method in conjunction with other therapies is contemplated such as conventional chemotherapy, radiation therapy or surgery directed against solid tumors and for control of establishment of metastases. The administration of angiogenesis-inhibiting amounts of combination therapy may be conducted before, during or after chemotherapy, radiation therapy or surgery.

(68) Pharmaceutical Compositions and Administration

(69) Embodiments of the method described herein comprises administering to a subject an agonist of the IL-6 receptor for the treatment of cancer (e.g. melanoma and other cancers). The administration of the agonist may be for either prophylactic or therapeutic purpose. When provided prophylactically, therapy is provided in advance of any symptom. The prophylactic administration of the therapy serves to prevent formation of cancer. Prophylactic administration may be given to a patient with, for example, a family history of cancer, or a patient that has had a cancer removed surgically. Alternatively, administration of the combination therapy may be given to a patient with rising cancer marker protein levels. Multiple biomarkers for particular cancers are known in the art, for example cancer biomarkers are reviewed in Henry N L, Hayes D F (2012) Cancer biomarkers. Mol. Oncol. available online February 6, in press. Example melanoma markers described in PCT Publications WO 2008/141275, WO 2009/073513, or in U.S. Pat. No. 7,442,507.

(70) When provided therapeutically, the administration of the composition comprising the agonist agent may be provided at (or after) the onset of a symptom of cancer, or upon indication of tumor.

(71) For any combination therapy used herein, e.g. multiple agonist such as IL-4 and TGF, the agonists can be present in the same or different pharmaceutical composition. When administrated at different times, the can be administered within 5 minutes, 10 minutes, 20 minutes, 60 minutes, 2 hours, 3 hours, 4, hours, 8 hours, 12 hours, 24 hours of administration of the other. When the agonist are administered in different pharmaceutical compositions, routes of administration can be different.

(72) The effective dosage range for the administration of the agonists depends upon the form of the agonist and its potency. It is an amount large enough to produce the desired effect in which symptoms of cancer are ameliorated (e.g. inhibition of tumor growth). The phrase therapeutically-effective amount as used herein means that amount of agonist agent or composition comprising the agonist/s which is effective for producing the desired therapeutic effect, in at least a sub-population of cells, in a subject at a reasonable benefit/risk ratio applicable to any medical treatment. For example, an amount of an agent administered to a subject that is sufficient to produce a statistically significant, measurable change in at least one symptom of cancer. Determination of a therapeutically effective amount is well within the capability of those skilled in the art. Generally, a therapeutically effective amount can vary with the subject's history, age, condition, sex, as well as the severity and type of the medical condition in the subject, and administration of other pharmaceutically active agents. There are preclinical melanoma models that are well known to those of skill in the art which can be used to determine therapeutically effective amounts of the agents and to optimize administration regimes. See for example Yang et al. (2010) RG7204 (PLX4032), A selective BRAFV600E inhibitor, displays potent antitumor activity in preclinical melanoma models, Cancer Research, 70:5518-5527, which is herein incorporated by reference its entirety.

(73) In one embodiment, a therapeutically effective amount of agonist, inhibits tumor volume in a preclinical model by at least 5%, at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90% and reduces at least one symptom of melanoma by at least 5%, at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90%. For example, tumor volumes in xenograft mice can be calculated using the following ellipsoid formula: [D(d2)]/2, in which D represents the large diameter of the tumor, and d represents the small diameter. Tumor volumes of treated groups are presented as percentages of tumor volumes of the control groups (% T/C) using the following formula: 100[(TT.sub.0)/(CC.sub.0)], in which T represents mean tumor volume of a treated group on a specific day during the experiment, T.sub.0 represents mean tumor volume of the same treated group on the first day of treatment, C represents mean tumor volume of a control group on the specific day during the experiment, and C.sub.0 represents mean tumor volume of the same treated group on the first day of treatment. Percent tumor growth inhibition can be calculated as 100% T/C, with >100% tumor growth inhibition representing regression. Survival can be calculated using a predefined cutoff volume of 2,000 mm.sup.3 as a surrogate for mortality (See e.g. Yang et al. (2010), Supra).

(74) In one embodiment a therapeutically effective amount of agonist of the IL-9R increases the activity of the IL-9R by at least 5%, at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90% and reduces at least one symptom of cancer by at least 5%, at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90%.

(75) In one embodiment a therapeutically effective amount of the agonist of the IL9-R inhibits cellular proliferation in a preclinical model by at least 5%, at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90% and reduces at least one symptom of cancer by at least 5%, at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90%. Inhibition of cellular proliferation may be evaluated by 3-(4,5-dimethylthiazole-2-yl)-2,5-diphenyl-2H-tetrazolium bromide (MTT; Sigma) assay. For example cells can be plated in 96-well microtiter plates at a density of 1,000 to 5,000 cells per well in a volume of 180 pt. Twenty-four hours after cell plating, 20 L of an appropriate agent dilution can be added to plates in duplicate. The plates may then be assayed for proliferation 6 days after the cells were plated according to the procedure originally described by Mosmann, Rapid colomeric assay for cellular growth and survival: application to proliferation and cytotoxicity assays. J. Immunol. Methods 1883:65:55-63). Percent inhibition can then be calculated and the IC50 determined from the regression of a plot of the logarithm of the concentration versus percent inhibition by XLfit (version 4.2; IDBS) using a Dose-Response One-Site Model (#205) (see e.g. Yang et al. Supra)

(76) The therapeutically effective dose can be estimated initially from a suitable cell culture or transcription assays (e.g. cancer cell growth assays, or e.g. transcription assays for inhibition of RORgamma activity, or assays to monitor activation of the IL-9R), then a dose of each agent and treatment regime may be formulated in animal models to achieve a circulating plasma concentration range that includes the IC50 as determined in cell culture.

(77) For administration to a subject, the agents can be provided in pharmaceutically acceptable compositions. These pharmaceutically acceptable compositions comprise a therapeutically-effective amount of one or more agonists of IL-9R, formulated together with one or more pharmaceutically acceptable carriers (additives) and/or diluents. The pharmaceutical compositions can be specially formulated for administration in solid or liquid form, including those adapted for the following: (1) oral administration, for example, drenches (aqueous or non-aqueous solutions or suspensions), lozenges, dragees, capsules, pills, tablets (e.g., those targeted for buccal, sublingual, and systemic absorption), boluses, powders, granules, pastes for application to the tongue; (2) parenteral administration, for example, by subcutaneous, intramuscular, intravenous or epidural injection as, for example, a sterile solution or suspension, or sustained-release formulation; (3) topical application, for example, as a cream, ointment, or a controlled-release patch or spray applied to the skin; (4) intravaginally or intrarectally, for example, as a pessary, cream or foam; (5) sublingually; (6) ocularly; (7) transdermally; (8) transmucosally (e.g. as a nasal spray or suppository); or (9) nasally. Additionally, agents can be implanted into a patient or injected using a drug delivery system. See, for example, Urquhart, et al., Ann. Rev. Pharmacol. Toxicol. 24: 199-236 (1984); Lewis, ed. Controlled Release of Pesticides and Pharmaceuticals (Plenum Press, New York, 1981); U.S. Pat. No. 3,773,919; and U.S. Pat. No. 35 3,270,960. Guidance for formulations can be found in e.g. Remington: The Science and Practice of Pharmacy by Alfonso R. Gelmaro (Ed.) 20.sup.th edition: Dec. 15, 2000, Lippincott, Williams $ Wilkins, ISBN: 0683306472, and are briefly described below.

(78) As used here, the term pharmaceutically acceptable refers to those compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.

(79) As used here, the term pharmaceutically-acceptable carrier means a pharmaceutically-acceptable material, composition or vehicle, such as a liquid or solid filler, diluent, excipient, manufacturing aid (e.g., lubricant, talc magnesium, calcium or zinc stearate, or steric acid), or solvent encapsulating material, involved in carrying or transporting the subject agent from one organ, or portion of the body, to another organ, or portion of the body. Each carrier must be acceptable in the sense of being compatible with the other ingredients of the formulation and not injurious to the patient. Some examples of materials which can serve as pharmaceutically-acceptable carriers include: (1) sugars, such as lactose, glucose and sucrose; (2) starches, such as corn starch and potato starch; (3) cellulose, and its derivatives, such as sodium carboxymethyl cellulose, methylcellulose, ethyl cellulose, microcrystalline cellulose and cellulose acetate; (4) powdered tragacanth; (5) malt; (6) gelatin; (7) lubricating agents, such as magnesium stearate, sodium lauryl sulfate and talc; (8) excipients, such as cocoa butter and suppository waxes; (9) oils, such as peanut oil, cottonseed oil, safflower oil, sesame oil, olive oil, corn oil and soybean oil; (10) glycols, such as propylene glycol; (11) polyols, such as glycerin, sorbitol, mannitol and polyethylene glycol (PEG); (12) esters, such as ethyl oleate and ethyl laurate; (13) agar; (14) buffering agents, such as magnesium hydroxide and aluminum hydroxide; (15) alginic acid; (16) pyrogen-free water; (17) isotonic saline; (18) Ringer's solution; (19) ethyl alcohol; (20) pH buffered solutions; (21) polyesters, polycarbonates and/or polyanhydrides; (22) bulking agents, such as polypeptides and amino acids (23) serum component, such as serum albumin, HDL and LDL; (22) C.sub.2-C.sub.12 alcohols, such as ethanol; and (23) other non-toxic compatible substances employed in pharmaceutical formulations. Wetting agents, coloring agents, release agents, coating agents, sweetening agents, flavoring agents, perfuming agents, preservative and antioxidants can also be present in the formulation. The amount of agent which can be combined with a carrier material to produce a single dosage form will generally be that amount of the agent which produces a therapeutic effect. Generally out of one hundred percent, this amount will range from about 0.1% to 99% of agent, preferably from about 5% to about 70%, most preferably from 10% to about 30%.

(80) Formulations suitable for parenteral administration conveniently include sterile aqueous preparation of the active agent which is preferably isotonic with the blood of the recipient. Thus, such formulations may conveniently contain distilled water, 5% dextrose in distilled water or saline. Useful formulations also include concentrated solutions or solids containing the agent which upon dilution with an appropriate solvent give a solution suitable for parental administration above.

(81) For enteral administration, an agent can be incorporated into an inert carrier in discrete units such as capsules, cachets, tablets or lozenges, each containing a predetermined amount of the active agent; as a powder or granules; or a suspension or solution in an aqueous liquid or non-aqueous liquid, e.g., a syrup, an elixir, an emulsion or a draught. Suitable carriers may be starches or sugars and include lubricants, flavorings, binders, and other materials of the same nature.

(82) A tablet may be made by compression or molding, optionally with one or more accessory ingredients. Compressed tablets may be prepared by compressing in a suitable machine the active agent in a free-flowing form, e.g., a powder or granules, optionally mixed with accessory ingredients, e.g., binders, lubricants, inert diluents, surface active or dispersing agents. Molded tablets may be made by molding in a suitable machine, a mixture of the powdered active agent with any suitable carrier.

(83) A syrup or suspension may be made by adding the active agent to a concentrated, aqueous solution of a sugar, e.g., sucrose, to which may also be added any accessory ingredients. Such accessory ingredients may include flavoring, an agent to retard crystallization of the sugar or an agent to increase the solubility of any other ingredient, e.g., as a polyhydric alcohol, for example, glycerol or sorbitol.

(84) Formulations for rectal administration may be presented as a suppository with a conventional carrier, e.g., cocoa butter or Witepsol S55 (trademark of Dynamite Nobel Chemical, Germany), for a suppository base.

(85) Formulations for oral administration may be presented with an enhancer. Orally-acceptable absorption enhancers include surfactants such as sodium lauryl sulfate, palmitoyl carnitine, Laureth-9, phosphatidylcholine, cyclodextrin and derivatives thereof; bile salts such as sodium deoxycholate, sodium taurocholate, sodium glycochlate, and sodium fusidate; chelating agents including EDTA, citric acid and salicylates; and fatty acids (e.g., oleic acid, lauric acid, acylcarnitines, mono- and diglycerides). Other oral absorption enhancers include benzalkonium chloride, benzethonium chloride, CHAPS (3-(3-cholamidopropyl)-dimethylammonio-1-propanesulfonate), Big-CHAPS (N,N-bis(3-D-gluconamidopropyl)-cholamide), chlorobutanol, octoxynol-9, benzyl alcohol, phenols, cresols, and alkyl alcohols. In one embodiment, the oral absorption enhancer may be sodium lauryl sulfate.

(86) As used herein, the term administer or administering refers to the placement of a composition into a subject by a method or route which results in at least partial localization of the composition at a desired site such that desired effect is produced. A agent or composition described herein can be administered by any appropriate route known in the art including, but not limited to, oral or parenteral routes, including intravenous, intramuscular, subcutaneous, transdermal, airway (aerosol), pulmonary, nasal, rectal, and topical (including buccal and sublingual) administration.

(87) Exemplary modes of administration include, but are not limited to, injection, infusion, instillation, inhalation, or ingestion. Injection includes, without limitation, intravenous, intramuscular, intraarterial, intrathecal, intraventricular, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, sub capsular, subarachnoid, intraspinal, intracerebro spinal, and intrasternal injection and infusion.

(88) In some embodiments, cells that express IL-9 are administered to a subject by adoptive cell transfer. Methods for administering cells are well known to those of skill in the art e.g. as provided in WO 2004/048557; WO 2008/033403; U.S. 2008/0279813 WO2008/033403; U.S. Pat. No. 7,572,631; and WO 2009/131712, which are herein incorporated by reference in their entirety. The amount of IL-9 producing cells (e.g. Th9 cells or T.sup.reg. cells, among others) which will be effective in the treatment and/or suppression of cancer may be determined by standard clinical techniques. The dosage will depend on the type of cancer to be treated, the severity and course of the cancer, previous therapy the recipient has undertaken, the recipient's clinical history, and the discretion of the attending physician. The IL-9 producing cell population may be administered in various treatment regimes, e.g., a single or a few doses over one to several days to ameliorate symptoms or periodic doses over an extended time to inhibit cancer progression or to prevent cancer recurrence. The precise dose to be employed in the formulation will also depend on the route of administration, and the seriousness of the disease or disorder, and should be decided according to the judgment of the practitioner and each patient's circumstances. Effective doses may be extrapolated from dose-response curves derived from in vitro or animal model test systems. Exemplary, non-limiting doses that could be used in the treatment of human subjects range from at least 3.810.sup.4, at least 3.810.sup.5, at least 3.810.sup.6, at least 3.810.sup.7, at least 3.810.sup.8, at least 3.810.sup.9, or at least 3.810.sup.10 IL-9 producing cells/m2. In certain embodiments, the dose used in the treatment of human subjects ranges from about 3.810.sup.9 to about 3.810.sup.10 IL-9 producing cells/m2. Cells may be administered systemically, or locally at the site of the cancer.

(89) In some embodiments, the agonists of the IL-9R are nucleic acids, e.g. e.g. including, but not limited to, DNA, antisense, ribozyme or RNAi (e.g. siRNA, shRNA). Methods of delivering RNAi interfering (RNAi) agents, other nucleic acid agents (e.g. nucleic acids that encode IL-9, or other agonist nucleic acids or peptides), or vectors containing agonist nucleic acids, to the target cells (e.g., cancer or tumor cells) can include, for example directly contacting the cell with a composition comprising a modulatory nucleic acid, or local or systemic injection of a composition containing the agonist nucleic acid. In one embodiment, nucleic acid agents (e.g. RNAi, siRNA, or other nucleic acid, expression vectors that encode agonists (including viral vectors) are injected directly into a tumor or lymph system. In some embodiments agonist nucleic may be delivered by systemic administration, wherein the nucleic acid is complexed with, or alternatively contained within a carrier. Example carriers for modulatory nucleic acid agents include, but are not limited to, peptide carriers, viral vectors, gene therapy reagents, and/or liposome carrier complexes and the like.

(90) Alternatively, the agent may be administered in liposomes or microspheres (or microparticles). Methods for preparing liposomes and microspheres for administration to a patient are well known to those of skill in the art. U.S. Pat. No. 4,789,734, the contents of which are hereby incorporated by reference, describes methods for encapsulating biological materials in liposomes. A review of known methods is provided by G. Gregoriadis, Chapter 14, Liposomes, Drug Carriers in Biology and Medicine, pp. 287-341 (Academic Press, 1979) also U.S. Pat. Nos. 4,906,474, 4,925,673 and 3,625,214, and Jein, TIPS 19:155-157 (1998), the contents of which are hereby incorporated by reference.

(91) In some embodiments, the agents described herein for treatment of cancer may be administered to a subject in combination with additional pharmaceutically active agents. Exemplary pharmaceutically active compounds/agents include, but are not limited to, those found in Harrison's Principles of Internal Medicine, 13.sup.th Edition, Eds. T. R. Harrison et al. McGraw-Hill N.Y., NY; Physicians Desk Reference, 50.sup.th Edition, 1997, Oradell N.J., Medical Economics Co.; Pharmacological Basis of Therapeutics, 8.sup.th Edition, Goodman and Gilman, 1990; United States Pharmacopeia, The National Formulary, USP XII NF XVII, 1990; current edition of Goodman and Oilman's The Pharmacological Basis of Therapeutics; and current edition of The Merck Index, the complete contents of all of which are incorporated herein by reference.

(92) Toxicity and therapeutic efficacy can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., for determining the LD50 (the dose lethal to 50% of the population) and the ED50 (the dose therapeutically effective in 50% of the population). The dose ratio between toxic and therapeutic effects is the therapeutic index and it can be expressed as the ratio LD50/ED50. Compositions that exhibit large therapeutic indices, are preferred.

(93) The data obtained from the cell culture assays and animal studies can be used in formulating a range of dosage for use in humans. The dosage of such agents lies within a range of circulating concentrations that include the ED50 with little or no toxicity. The dosage may vary within this range depending upon the dosage form employed and the route of administration utilized.

(94) The therapeutically effective dose can be estimated initially from cell culture assays. A dose may be formulated in animal models to achieve a circulating plasma concentration range that includes the IC50 (i.e., the concentration of the therapeutic which achieves a half-maximal inhibition of symptoms) as determined in cell culture. Levels in plasma may be measured, for example, by high performance liquid chromatography. The effects of any particular dosage can be monitored by a suitable bioassay.

(95) The dosage may be determined by a physician and adjusted, as necessary, to suit observed effects of the treatment. Generally, the compositions are administered so that the agent is given at a dose from 1 g/kg to 150 mg/kg, 1 g/kg to 100 mg/kg, 1 g/kg to 50 mg/kg, 1 g/kg to 20 mg/kg, 1 g/kg to 10 mg/kg, 1 g/kg to 1 mg/kg, 100 g/kg to 100 mg/kg, 100 g/kg to 50 mg/kg, 100 g/kg to 20 mg/kg, 100 g/kg to 10 mg/kg, 100 g/kg to 1 mg/kg, 1 mg/kg to 100 mg/kg, 1 mg/kg to 50 mg/kg, 1 mg/kg to 20 mg/kg, 1 mg/kg to 10 mg/kg, 10 mg/kg to 100 mg/kg, 10 mg/kg to 50 mg/kg, or 10 mg/kg to 20 mg/kg. It is to be understood that ranges given here include all intermediate ranges, for example, the range 1 mg/kg to 10 mg/kg includes 1 mg/kg to 2 mg/kg, 1 mg/kg to 3 mg/kg, 1 mg/kg to 4 mg/kg, 1 mg/kg to 5 mg/kg, 1 mg/kg to 6 mg/kg, 1 mg/kg to 7 mg/kg, 1 mg/kg to 8 mg/kg, 1 mg/kg to 9 mg/kg, 2 mg/kg to 10 mg/kg, 3 mg/kg to 10 mg/kg, 4 mg/kg to 10 mg/kg, 5 mg/kg to 10 mg/kg, 6 mg/kg to 10 mg/kg, 7 mg/kg to 10 mg/kg, 8 mg/kg to 10 mg/kg, 9 mg/kg to 10 mg/kg etc. . . . It is to be further understood that the ranges intermediate to the given above are also within the scope for use in methods and pharmaceutical compositions described herein, for example, in the range 1 mg/kg to 10 mg/kg, dose ranges such as 2 mg/kg to 8 mg/kg, 3 mg/kg to 7 mg/kg, 4 mg/kg to 6 mg/kg etc.

(96) With respect to duration and frequency of treatment, it is typical for skilled clinicians to monitor subjects in order to determine when the treatment is providing therapeutic benefit, and to determine whether to increase or decrease dosage, increase or decrease administration frequency, discontinue treatment, resume treatment or make other alteration to treatment regimen. The dosing schedule can vary from once a week to daily depending on a number of clinical factors, such as the subject's sensitivity.

(97) The desired dose can be administered at one time or divided into subdoses, e.g., 2-4 subdoses and administered over a period of time, e.g., at appropriate intervals through the day or other appropriate schedule. Such sub-doses can be administered as unit dosage forms. In some embodiments, administration is chronic, e.g., one or more doses daily over a period of weeks or months. Examples of dosing schedules are administration daily, twice daily, three times daily or four or more times daily over a period of 1 week, 2 weeks, 3 weeks, 4 weeks, 1 month, 2 months, 3 months, 4 months, 5 months, or 6 months or more. The pharmaceutical compositions can be administered during infancy (between 0 to about 1 year of life), childhood (the period of life between infancy and puberty) and during puberty (between about 8 years of life to 18 years of life). The pharmaceutical compositions can also be administered to treat adults (greater than about 18 years of life). A dose administered at least once, may be provided as a bolus, a continuous administration or sustained release. Multiple administration over a period of weeks or months may be preferable. It may also be preferable to administer the dose at least once/week and even more frequent administrations (e.g. daily). Subsequent doses may be administered as indicated.

(98) In one embodiment, the agonist may be administered to a subject using an administration regime that results in a steady state concentration of 70 g/mL, or 60 g/mL, or 50 g/mL, 40 g/mL, 30 mcg/ml, or 20 g/mL (Rozman, B. (2002) Clinical pharmacokinetics of leflunomide, Clin. Pharmacokinetic, 41:421-430). In one embodiment, the steady state concentration is 60 g/mL or less, 50 g/mL or less, 40 g/mL or less, 30 g/ml or less, or 20 g/mL or less.

(99) In one embodiment, the agonist may be administered at a high concentration (e.g. 100 to 1000 mg) daily for 3 days, followed by lower daily doses of 20 to 100 mg/ml. for a steady state concentration. In one embodiment, agonist may be administered at a dosage of 960 mg twice a day, at a dosage less than 900 mg twice a day, less than 850 mg twice a day, less than 800 mg twice a day, or less than 700 mg twice per day.

(100) The efficacy of a given treatment regime for cancer can be determined by the skilled clinician, for example by assessing physical indicators of cancer, such as e.g., tumor size or lesion size, metastasis, tumor growth rate, etc. However, a treatment is considered effective treatment, as the term is used herein, if any one or all of the signs or symptoms of the cancer are altered in a beneficial manner, e.g. improved or ameliorated by at least 10% following treatment with an agent that is an agonist of the IL-9R. Efficacy can also be measured by a failure of an individual to worsen as assessed by stabilization of tumor growth, hospitalization or need for medical interventions (i.e., progression of the melanoma is halted or at least slowed). Methods of measuring these indicators are known to those of skill in the art and/or described herein. Treatment includes in an individual includes: (1) inhibiting the disease, e.g., arresting, or slowing tumor or lesion growth; or (2) relieving the disease, e.g., causing regression of symptoms, reducing tumor or lesion size; and (3) preventing or reducing the likelihood of the development of cancer, or preventing metastasis of the cancer.

(101) Also provided are methods for the prognosis of cancer (e.g. melanoma or other cancers) in a subject. The methods comprise determining the level of IL-9 producing T cells in a tumor, wherein the presence of reduced levels of IL-9 producing T-cells (e.g. Th9 cells) within the tumor as compared to the level of IL-9 producing T-cells (e.g. Th9 cells) in normal skin or normal blood is indicative of increased metastatic potential and a poor prognosis. The level of IL-9 producing T cells may be determined by means well known to those of skilled in the art, e.g. as described in Example 1 herein. In one specific embodiment, the cancer is melanoma, however any cancer may be prognosed using the methods described herein.

(102) In certain embodiments, the reduced level of IL-9 producing T-cells indicates a treatment protocol for the that comprises administrating to the subject in need thereof an agonist of the IL-9 receptor, e.g. an agent that binds and activates the IL-9 receptor such as IL-9 or other agonist; or an agent that increases IL-9 expression in the subject (e.g. administration of IL-9 producing T cells, such as tumor specific TH9 cells that express IL-9, or administration of an inhibitor of ROR).

(103) Methods for directing treatment in a subject are also provided. In one embodiment, the method comprises determining the level of ROR expression in T cells present within a tumor, wherein an an increased expression of ROR in T cells of the tumor as compared to T cells in normal human blood or skin, indicates that the cancer may be treated with an inhibitor of ROR. The level of ROR may be determined by means well known to those of skilled in the art, e.g. as described herein and as described in Example 1; kits are available for ROR detection.

DEFINITIONS

(104) As used herein the term comprising or comprises is used in reference to compositions, methods, and respective component(s) thereof, that are essential to the invention, yet open to the inclusion of unspecified elements, whether essential or not.

(105) As used herein the term consisting essentially of refers to those elements required for a given embodiment. The term permits the presence of additional elements that do not materially affect the basic and novel or functional characteristic(s) of that embodiment of the invention.

(106) The term consisting of refers to compositions, methods, and respective components thereof as described herein, which are exclusive of any element not recited in that description of the embodiment.

(107) Other than in the operating examples, or where otherwise indicated, all numbers expressing quantities of ingredients or reaction conditions used herein should be understood as modified in all instances by the term about. The term about when used in connection with percentages may mean1%.

(108) The singular terms a, an, and the include plural referents unless context clearly indicates otherwise. Similarly, the word or is intended to include and unless the context clearly indicates otherwise. It is further to be understood that all base sizes or amino acid sizes, and all molecular weight or molecular mass values, given for nucleic acids or polypeptides are approximate, and are provided for description.

(109) The abbreviation, e.g. is derived from the Latin exempli gratia, and is used herein to indicate a non-limiting example. Thus, the abbreviation e.g. is synonymous with the term for example.

(110) The terms polypeptide, peptide and protein refer to a polymer of amino acid residues. The terms apply to amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non-naturally occurring amino acids.

(111) As used herein, variant polypeptides may comprise conservatively substituted sequences, meaning that one or more amino acid residues (such as a native IL-9 polypeptide, or other polypeptide, or cytokine etc.) is replaced by different residues, and that the conservatively substituted polypeptide retains a desired biological activity, that is essentially equivalent to that of the native polypeptide. Examples of conservative substitutions include substitution of amino acids that do not alter the secondary and/or tertiary structure of the polypeptide. Other examples involve substitution of amino acids that have not been evolutionarily conserved. One or more polypeptide sequences from non-human species can be aligned with, for example, human using methods well known to one of ordinary skill in the art to determine which residues are conserved and which tolerate more variability. Advantageously, in some embodiments, these conserved amino acids are not altered when generating conservatively substituted sequences.

(112) Any given amino acid may be replaced by a residue having similar physiochemical characteristics, e.g., substituting one aliphatic residue for another (such as Ile, Val, Leu, or Ala for one another), or substitution of one polar residue for another (such as between Lys and Arg; Glu and Asp; or Gln and Asn). Other such conservative substitutions, e.g., substitutions of entire regions having similar hydrophobicity characteristics, are well known. For example, IL-9 polypeptides comprising conservative amino acid substitutions can be tested in any one of the assays described herein to confirm that a desired apoptotic activity of a native IL-9 is retained.

(113) Amino acids may be grouped according to similarities in the properties of their side chains (in A. L. Lehninger, in Biochemistry, second ed., pp. 73-75, Worth Publishers, New York (1975)): (1) non-polar: Ala (A), Val (V), Leu (L), Ile (I), Pro (P), Phe (F), Trp (W), Met (M); (2) uncharged polar: Gly (G), Ser (S), Thr (T), Cys (C), Tyr (Y), Asn (N), Gln (O); (3) acidic: Asp (D), Glu (E); (4) basic: Lys (K), Arg (R), His (H). Alternatively, naturally occurring residues may be divided into groups based on common side-chain properties: (1) hydrophobic: Norleucine, Met, Ala, Val, Leu, Ile; (2) neutral hydrophilic: Cys, Ser, Thr, Asn, Gln; (3) acidic: Asp, Glu; (4) basic: His, Lys, Arg; (5) residues that influence chain orientation: Gly, Pro; (6) aromatic: Trp, Tyr, Phe. Non-conservative substitutions will entail exchanging a member of one of these classes for another class. Conservative substitutions may include, for example: Ala into Gly or into Ser; Arg into Lys; Asn into Gln or into His; Asp into Glu; Cys into Ser; Gln into Asn; Glu into Asp; Gly into Ala or into Pro; His into Asn or into Gln; Ile into Leu or into Val; Leu into Ile or into Val; Lys into Arg, into Gln or into Glu; Met into Leu, into Tyr or into Ile; Phe into Met, into Leu or into Tyr; Ser into Thr; Thr into Ser; Trp into Tyr; Tyr into Trp; and/or Phe into Val, into Ile or into Leu. Any cysteine residue not involved in maintaining the proper conformation of the polypeptide also can be substituted, generally with serine, to improve the oxidative stability of the molecule and prevent aberrant crosslinking Conversely, cysteine bond(s) can be added to the polypeptide to improve its stability or facilitate oligomerization.

(114) As used herein, the term nucleic acid or nucleic acid sequence refers to any molecule, preferably a polymeric molecule, incorporating units of ribonucleic acid, deoxyribonucleic acid or an analog thereof. The nucleic acid can be either single-stranded or double-stranded. A single-stranded nucleic acid can be one strand nucleic acid of a denatured double-stranded DNA. Alternatively, it can be a single-stranded nucleic acid not derived from any double-stranded DNA. In one aspect, the template nucleic acid is DNA. In another aspect, the template is RNA. Suitable nucleic acid molecules are DNA, including genomic DNA, ribosomal DNA and cDNA. Other suitable nucleic acid molecules are RNA, including mRNA, rRNA and tRNA. The nucleic acid molecule can be naturally occurring, as in genomic DNA, or it may be synthetic, i.e., prepared based up human action, or may be a combination of the two. The nucleic acid molecule can also have certain modification such as 2-deoxy, 2-deoxy-2-fluoro, 2-O-methyl, 2-O-methoxyethyl (2-O-MOE), 2-O-aminopropyl (2-O-AP), 2-O-dimethylaminoethyl (2-O-DMAOE), 2-O-dimethylaminopropyl (2-O-DMAP), 2-O-dimethylaminoethyloxyethyl (2-O-DMAEOE), or 2-ON-methylacetamido (2-O-NMA), cholesterol addition, and phosphorothioate backbone as described in US Patent Application 20070213292; and certain ribonucleoside that are is linked between the 2-oxygen and the 4-carbon atoms with a methylene unit as described in U.S. Pat. No. 6,268,490, wherein both patent and patent application are incorporated hereby reference in their entirety.

(115) The terms decrease, reduced, reduction, decrease or inhibit are all used herein generally to mean a decrease by a statistically significant amount. However, for avoidance of doubt, reduced, reduction or decrease or inhibit means a decrease by at least 10% as compared to a reference level, for example a decrease by at least about 20%, or at least about 30%, or at least about 40%, or at least about 50%, or at least about 60%, or at least about 70%, or at least about 80%, or at least about 90%. In one embodiment, there is a 100% decrease (e.g. absent level as compared to a reference sample).

(116) The terms increased, increase or enhance or activate are all used herein to generally mean an increase by a statically significant amount; for the avoidance of any doubt, the terms increased, increase or enhance or activate means an increase of at least 10% as compared to a reference level, for example an increase of at least about 20%, or at least about 30%, or at least about 40%, or at least about 50%, or at least about 60%, or at least about 70%, or at least about 80%, or at least about 90% or up to and including a 100% increase or any increase between 10-100% as compared to a reference level, or at least about a 2-fold, or at least about a 3-fold, or at least about a 4-fold, or at least about a 5-fold or at least about a 10-fold increase, or any increase between 2-fold and 10-fold or greater as compared to a reference level.

(117) The term statistically significant or significantly refers to statistical significance and generally means a two standard deviation (2SD) below normal, or lower, concentration of the marker. The term refers to statistical evidence that there is a difference. It is defined as the probability of making a decision to reject the null hypothesis when the null hypothesis is actually true. The decision is often made using the p-value.

(118) As used herein, the term IC50 refers to the concentration of an agent that produces 50% of the maximal inhibition of activity or expression measurable using the same assay in the absence of the inhibitor. The IC50 can be as measured in vitro or in vivo. The IC50 can be determined by measuring activity using a conventional in vitro assay (e.g. protein activity assay, or gene expression assay e.g. ROR activity, or inhibition of proliferation, migration, or tumor/lesion size).

(119) As used herein, the term co-stimulatory molecule-activating agents refers to any compound well-known to one of skill in the art that immunospecifically binds to or associates with a co-stimulatory molecule expressed by an immune cell (preferably, an activated immune cell) and induces the activation of a signal transduction pathway associated with the co-stimulatory molecule. For example, a compound that immunospecifically binds to or associates with a co-stimulatory molecule selectively expressed by an activated immune cell (e.g., an activated T-cell) and induces the activation of a signal transduction pathway associated with the co-stimulatory molecule. Co-stimulatory molecule-activating agents include, but are not limited to, proteinaneous agents (e.g., cytokines, peptide mimetics, and antibodies), small molecules, organic compounds, inorganic compounds, and nucleic acid molecules comprising nucleotide sequences encoding proteins, polypeptides, or peptides (e.g., cytokines, peptide mimetics, and antibodies) that immunospecifically bind to or associate with a co-stimulatory molecule expressed by an activated immune cell and induce the activation of a signal transduction pathway associated with the co-stimulatory molecule. For example, ligands that immunospecifcally bind to a co-stimulatory molecule selectively expressed by activated T-Cells increase the expression and/or release of cytokines by immune cells in an in vitro or in vivo assay. Co-stimulatory molecules include, for example: 1) B7/CD28 family molecules such as B7-1/CD80 CD28, B7-2/CD86 CTLA-4, B7-H1/PD-L1 Gi24/Dies1/VISTA, B7-H2 ICOS, B7-H3 PD-1, B7-H4 PD-L2/B7-DC, B7-H6 PDCD6 and BTLA; TNF superfamily molecules, 4-1BB/TNFRSF9/CD137 CD40 Ligand/TNFSF5, 4-1BB Ligand/TNFSF9 GITR/TNFRSF18, BAFF/BLyS/TNFSF13B GITR Ligand/TNFSF18, BAFF R/TNFRSF13C HVEM/TNFRSF14, CD27/TNFRSF7 LIGHT/TNFSF14, CD27 Ligand/TNFSF7 OX40/TNFRSF4, CD30/TNFRSF8 OX40 Ligand/TNFSF4, CD30 Ligand/TNFSF8 TACI/TNFRSF13B, CD40/TNFRSF5; SLAM family 2B4/CD244/SLAMF4 CD84/SLAMF5, BLAME/SLAMF8 CD229/SLAMF3, CD2 CRACC/SLAMF7, CD2F-10/SLAMF9 NTB-A/SLAMF6, CD48/SLAMF2 SLAM/CD150, CD58/LFA-3; and other co-stimulatory molecules CD2 Ikaros, CD53 Integrin alpha 4/CD49d, CD82/Kai-1 Integrin alpha 4 beta 1, CD90/Thy1 Integrin alpha 4 beta 7/LPAM-1, CD96 LAG-3, CD160 LMIR1/CD300A, CRTAM TCL1A, DAP12 TCL1B, Dectin-1/CLEC7A TIM-1/KIM-1/HAVCR, DPPIV/CD26 TIM-4, EphB6 TSLP, HLA Class I TSLP R, HLA-DR.

(120) It should be understood that the methods and compositions described herewith are not limited to the particular methodology, protocols, and reagents, etc., described herein and as such may vary. The terminology used herein is for the purpose of describing particular embodiments only, and is not intended to limit the scope of the present invention, which is defined by the claims.

(121) As used herein and in the claims, the singular forms include the plural reference and vice versa unless the context clearly indicates otherwise. Other than in the operating examples, or where otherwise indicated, all numbers expressing quantities of ingredients or reaction conditions used herein should be understood as modified in all instances by the term about.

(122) All patents and other publications identified are expressly incorporated herein by reference for the purpose of describing and disclosing, for example, the methodologies described in such publications that might be used in connection with the present invention. These publications are provided solely for their disclosure prior to the filing date of the present application. Nothing in this regard should be construed as an admission that the inventors are not entitled to antedate such disclosure by virtue of prior invention or for any other reason. All statements as to the date or representation as to the contents of these documents is based on the information available to the applicants and does not constitute any admission as to the correctness of the dates or contents of these documents.

(123) Unless defined otherwise, all technical and scientific terms used herein have the same meaning as those commonly understood to one of ordinary skill in the art to which this invention pertains.

(124) Certain embodiments of the invention may be as defined in any one of the following numbered paragraphs, i.e. paragraphs 1-32.

(125) Paragraph 1. A method for treating cancer in a subject comprising administering to a subject in need thereof a therapeutically effective amount of an agonist of an interleukin-9 receptor (IL-9R).

(126) Paragraph 2. The method of paragraph 1, wherein the agonist of the IL-9 receptor (IL-9) is selected from the group consisting of: a small molecule, a nucleic acid RNA, a nucleic acid DNA, a protein, a peptide, a cell, and an antibody.

(127) Paragraph 3. The method of any of paragraphs 1-2, wherein the agonist comprises an agent that binds the IL-9 receptor.

(128) Paragraph 4. The method of paragraph 3, wherein the agent that binds the IL-9 receptor comprises the cytokine interleukin 9 (IL-9), or fragment thereof.

(129) Paragraph 5. The method of paragraph 4, wherein the cytokine interleukin 9 (IL-9) comprises human recombinant interleukin-9 (rIL-9).

(130) Paragraph 6. The method of any of paragraphs 1-3, wherein the agonist is a monoclonal antibody.

(131) Paragraph 7. The method of any of paragraphs 1-2, wherein the agonist comprises an agent that increases expression of IL-9 in the subject as compared to IL-9 expression in the absence of the agonist.

(132) Paragraph 8. The method of paragraph 7, wherein the agonist comprises a population of cells that express IL-9.

(133) Paragraph 9. The method of paragraph 8, wherein the population of cells comprises Th9 cells.

(134) Paragraph 10. The method of paragraph 7, wherein the agonist comprises an inhibitor of ROR.

(135) Paragraph 11. The method of paragraph 10, wherein the inhibitor of ROR comprises siRNA.

(136) Paragraph 12. The method of paragraph 10, wherein the inhibitor of ROR is selected from the group consisting of: ursolic acid, digoxin, SR1001, and TO901317.

(137) Paragraph 13. The method of any of paragraphs 1-12, wherein the agonist further comprises a pharmaceutically acceptable carrier.

(138) Paragraph 14. The method of any of paragraphs 1-13, wherein the subject is human.

(139) Paragraph 15. The method of any of the paragraphs of 1-14, wherein the cancer is selected from the group consisting of gastrointestinal cancer, prostate cancer, ovarian cancer, breast cancer, head and neck cancer, lung cancer, non-small cell lung cancer, cancer of the nervous system, kidney cancer, retinal cancer, melanoma skin cancer, stomach cancer, liver cancer, pancreatic cancer, genital-urinary cancer, prostate cancer, colorectal cancer, and bladder cancer

(140) Paragraph 16. The method of any of paragraphs 1-15, wherein the agonist is administered by a route selected from the group consisting of: intravenous, intramuscular, subcutaneous, intradermal, topical, intraperitoneal, intrathecal, intrapleural, intrauterine, rectal, vaginal, intrasynovial, intraocular/periocular, intratumor, adoptive cell transfer, and parenteral administration.

(141) Paragraph 17. Use of an effective amount of an agonist of an interleukin-9 receptor (IL-9R) for the treatment of cancer.

(142) Paragraph 18. The use of paragraph 17, wherein the agonist of the IL-9 receptor (IL-9) is selected from the group consisting of: a small molecule, a nucleic acid RNA, a nucleic acid DNA, a protein, a peptide, a cell, and an antibody.

(143) Paragraph 19. The use of any of paragraphs 17-18, wherein the agonist comprises an agent that binds the IL-9 receptor.

(144) Paragraph 20. The use of paragraph 19, wherein the agent that binds the IL-9 receptor comprises the cytokine interleukin 9 (IL-9), or fragment thereof.

(145) Paragraph 21. The use of paragraph 20, wherein the cytokine interleukin 9 (IL-9) comprises human recombinant interleukin-9 (rIL-9).

(146) Paragraph 22. The use of any of paragraphs 17-19, wherein the agonist is a monoclonal antibody.

(147) Paragraph 23. The use of any of paragraphs 17-18, wherein the agonist comprises an agent that increases expression of IL-9 in the subject as compared to IL-9 expression in the absence of the agonist.

(148) Paragraph 24. The use of paragraph 23, wherein the agonist comprises a population of cells that express IL-9.

(149) Paragraph 25. The use of paragraph 24, wherein the population of cells comprises Th9 cells.

(150) Paragraph 26. The use of paragraph 23, wherein the agonist comprises an inhibitor of ROR.

(151) Paragraph 27. The use of paragraph 26, wherein the inhibitor of ROR comprises siRNA.

(152) Paragraph 28. The use of paragraph 26, wherein the inhibitor of ROR is selected from the group consisting of: ursolic acid, digoxin, SR1001, and TO901317.

(153) Paragraph 29. The use of any of paragraphs 17-28, wherein the agonist further comprises a pharmaceutically acceptable carrier.

(154) Paragraph 30. The use of any of paragraphs 17-29, wherein the subject is human.

(155) Paragraph 31. The use of any of the paragraphs of 17-30, wherein the cancer is selected from the group consisting of gastrointestinal cancer, prostate cancer, ovarian cancer, breast cancer, head and neck cancer, lung cancer, non-small cell lung cancer, cancer of the nervous system, kidney cancer, retinal cancer, melanoma skin cancer, stomach cancer, liver cancer, pancreatic cancer, genital-urinary cancer, prostate cancer, colorectal cancer, and bladder cancer

(156) Paragraph 32. The use of any of paragraphs 17-31, wherein the agonist is administered by a route selected from the group consisting of: intravenous, intramuscular, subcutaneous, intradermal, topical, intraperitoneal, intrathecal, intrapleural, intrauterine, rectal, vaginal, intrasynovial, intraocular/periocular, intratumor, adoptive cell transfer, and parenteral administration.

(157) Paragraph 33, the method or use of any of paragraphs 1-32, wherein the subject is not administered one or more co-stimulatory molecule activating agents.

(158) Paragraph 34, a method for the prognosis of cancer (e.g. melanoma or other cancers) in a subject comprising assaying a tumor for the presence of IL-9 producing T cells, wherein the presence of reduced levels of IL-9 producing T-cells (e.g. Th9 cells) within the tumor as compared to the level of IL-9 producing T-cells (e.g. Th9 cells) in normal skin is indicative of increased metastatic potential and a poor prognosis.

(159) Paragraph 35, the method of paragraph 34 wherein the reduced level of IL-9 producing T-cells indicates a treatment protocol for the subject comprising administrating to the subject in need thereof an agonist of the IL-9 receptor (e.g. IL-9), e.g. an agent that binds and activates the IL-9 receptor, or an agent that increases IL-9 expression in the subject (e.g. administration of IL-9 producing T cells, such as tumor specific TH9 cells that express IL-9, or administration of an inhibitor of ROR).

(160) Paragraph 36, a method for directing treatment in a subject comprising determining the level of ROR expression in T cells present within a tumor, wherein an increased expression of ROR in T cells of the tumor as compared to T cells in normal human blood or skin, indicates that the cancer may be treated with an inhibitor of ROR.

(161) All references described herein, in the Examples and throughout the Specification, are incorporated herein by reference in their entirety.

EXAMPLES

Robust Tumor Immunity to Melanoma Mediated by Interleukin 9

(162) The Examples described herein describe a novel and previously unappreciated role for IL-9 in tumor immunity and indicate novel therapeutic strategies. Recent studies have indicated that immunologic targeting of melanoma is a promising strategy.sup.1; however, how best to achieve this goal is incompletely understood. There is general agreement that T cell mediated assault on melanoma is required for an optimal long term result. An important role for CD4+T cells in tumor immunity is emerging from several recent studies.sup.2-5. In combination with radiation therapy and CTLA-4 blockade, adoptive transfer of nave tumor specific CD4+T cells has been shown to eradicate large established melanomas.sup.4,5. Moreover, anti-melanoma effects of CD4+ T cells have been demonstrated in a melanoma lung metastasis model.sup.6.

(163) The role of Th17 cells in tumor immunity is controversial, with apparently contradictory results having been published. IL-17A has been reported to favor development of several cancers by promoting angiogenesis and tumor cell survival.sup.7-9. In contrast, other investigators have found that IL-17A can inhibit development of hematopoietic cancers by promoting CD8+T cell activation.sup.10-12. Treatment of immunocompetent tumor-bearing mice with Th17 cells reduced tumor colonies in the lung, and this anti-tumor activity of Th17 cells was mediated through activation of CD8+T cells.sup.13. In another study.sup.14, antigen specific Th17 cells mediated regression of subcutaneous tumors in a lymphopenic host, and the anti-tumor effect was IFN dependent. The apparently contradictory reported effects of IL-17A in tumor immunity may depend on different experimental models and approaches.sup.13 7,9 12, such as the immune status of the host, endogenous or ectopic expression of IL-17, method of tumor induction, and the biological nature of the tumor.

(164) Because of the controversy discussed above, another approach to studying Th17 cells in tumor immunity was pursued, using mice whose T cells were deficient in the transcription factor retinoid-related orphan receptor-gamma (ROR/ mice). RORt, a protein isoform of ROR, is a lineage specific transcription factor critical for the development of Th17 cells.sup.15,16 17 whose deficiency abrogates the development of IL-17A secreting Th17 cells. Increased expression of ROR is reported in several inflammatory diseases including multiple sclerosis/experimental autoimmune encephalitis (EAE).sup.15, while its absence is implicated in attenuation of Ovalbumin induced allergic airway inflammation.sup.18. The role of ROR in tumor immunity has never been directly assessed. Using ROR/ mice and IL-23R/ mice, we observed significant growth inhibition of B16F10 melanoma, with evidence for increased anti-melanoma immune responses (tumor lymphocyte infiltration and increased cytokine expression). In parallel, transcriptional profiling experiments revealed the expected severely impaired IL-23R and IL-17A expression in ROR/ CD4+T cells differentiated under Th17 polarizing conditions. Unexpected, however, was a dramatic increase in the expression of IL-9 in these CD4+T cells.

(165) The possibility that IL-9 overexpression might be related to the increased melanoma immunity seen in ROR/ chimeric mice was therefore tested. Strikingly, depletion of IL-9 by neutralizing mAb in IL-23R/ and ROR/ chimeric mice was associated with enhanced melanoma growth. Mice deficient in IL-9 signaling pathways (IL-9R/ mice), and normal mice treated with blocking IL-9 antibody had similarly enhanced growth. Administration of Th9 cells strongly inhibited melanoma growth, and this could be blocked by antibodies to IL-9. Treatment with exogenous rIL-9 suppressed melanoma, as well as lung carcinoma growth, in normal hosts as well as in hosts deficient in T and B cells. However, IL-9 did not block tumor growth in mast cell deficient hosts. Finally, IL-9 producing T cells (Th9 cells) were found in healthy human skin and blood, which show a phenotype directly comparable to murine Th9 cells. IL-9 producing T cells are reduced or absent in lesions of human metastatic melanoma. In conclusion, described herein is the identification of previously unreported roles of IL-9 and Th9 cells in melanoma immunity. The initial observation that abrogation of pathways important for Th17 cell development appears to enhance melanoma immunity, may be mediated in large part through the generation of a robust IL-9 mediated anti-melanoma response.

Example 1

Deficiency of ROR is Associated with Inhibited Melanoma Growth and Increased Tumor Lymphocytic Infiltration

(166) To examine the role of ROR in tumor immunity, a B16F10 murine melanoma model was used. ROR/ mice do not develop secondary lymph nodes and have fewer CD4+ and CD8+T cells as compared to ROR+/+ mice.sup.19. Therefore, ROR/ chimeric (ROR/ch) and ROR+/+ ch mice were generated by administering bone marrow cells from ROR/ or ROR+/+ mice into sublethally irradiated Rag1/ C57BL/6 mice.sup.15,17. After full reconstitution of T cells and restoration of the intact immune system (8-10 weeks), mice were used for tumor growth experiments (FIG. 7).

(167) B16 melanoma cells were injected subcutaneously into ROR+/+ ch and ROR/ ch mice, and tumor growth was monitored over time. ROR/ ch mice were resistant to melanoma growth, and survival of the ROR/ ch mice was significantly increased compared to control mice (FIGS. 1A-1B). The infiltration of lymphocytes in tumors removed from these mice was examined. Melanomas from ROR/ ch mice contained 3-fold higher numbers of CD4+T cells and CD8+T cells as compared to ROR+/+ ch controls (FIG. 1C). T cells from draining lymph nodes of ROR/ch melanoma bearing mice secreted negligible IL-17A, and increased amounts of IFN as well as TNF (FIG. 1D). There was no difference in the number of melanoma-infiltrating CD4+CD25+FoxP3+T cells (T-regulatory cells) in ROR+/+ch (7.2%0.4) and ROR/ch (5.90.7).

Example 2

Increased IL-9 Expression in ROR Deficient T Cells

(168) To further explore the mechanism of melanoma growth inhibition in ROR/ ch mice, transcriptional profiling analysis was performed using CD4+T cells from ROR/ and ROR+/+ mice differentiated under Th17 polarizing conditions. As expected, expression of IL-17A, IL-17F and IL-23R in ROR/ CD4+T cells was much lower compared to ROR+/+ CD4+T cells (FIG. 2). However, expression of IL-9 in ROR/ CD4+T cells was dramatically increased as compared to ROR+/+CD4+T cells (FIGS. 2 and 8A-8C). Granzyme B and C expression were also significantly enhanced. Increased IL-9 mRNA expression and increased frequency of IL-9 secreting cells by ROR/CD4+T cells was observed (FIGS. 8A-8C). Because of the striking upregulation of IL-9 under these conditions, subsequent experiments were focused on the potential role of IL-9 in tumor immunity.

(169) To be certain that the T cells from ROR/ ch mice did not have an intrinsic property that predisposed them to IL-9 production; naive and memory CD4+T cells from these mice were examined. CD4+T cells, CD4+CD25-CD62L low (memory T cells) and CD4+CD25-CD62L high (nave CD4+T cells) from ROR+/+ and ROR/ mice were culture sorted and stimulated with plate bound anti-CD3/CD28 mAbs. There was increased expression of IL-9 in ROR/ CD4+T cells (FIGS. 9A-9B) and memory CD4+T cells (FIGS. 9C-9E). However, negligible IL-9 expression was observed in nave CD4+T cells, and importantly there was no difference in IL-9 expression between ROR+/+ and ROR/ nave CD4+T cells (FIG. 9F). Th2 and Th9 cells also secrete IL-9.sup.20,21; there was increased IL-9 expression in ROR/ Th2 cells; however, ROR/ CD4+ T cells under Th9 condition showed increased IL-9 production compared to ROR+/+Th9 cells (FIGS. 9G-9H).

(170) To explore if the enhanced anti-melanoma response in ROR/ ch mice could be attributed to IL-9, melanoma cells were injected subcutaneously into ROR/ ch mice. Tumor growth in these mice lagged significantly behind that of ROR+/+ch mice. In an attempt to reverse this, mice were treated with neutralizing mAb to IL-9. As shown in FIG. 3A, the severely impaired melanoma growth in ROR/ ch mice was significantly, but not completely, reversed by neutralization of IL-9. These results indicate that this melanoma growth inhibition was partially dependent on IL-9.

Example 3

The Role of IL-9 in Melanoma Immunity in IL-23R/ Mice

(171) The most strongly downregulated gene in the transcriptional profiling experiments on ROR/ CD4 T cells was IL-23R. In addition, expression of IL-23R is necessary for the long-term maintenance of Th17 cells. Melanoma immunity was therefore explored in mice deficient in IL-23R/ as well. Sorted, naive CD4+T cells were differentiated from IL-23R+/+ and IL-23R/ mice under Th17 polarizing conditions and demonstrated attenuated development of IL-17A secreting Th17 cells in IL-23R/ CD4+T cells (FIG. 9B). Interestingly, there was increased expression of IL-9 compared to IL-23R+/+CD4+T cells (FIG. 9B). Next, melanoma cells were injected subcutaneously into IL-23R+/+ and IL-23R/ mice and additional groups of mice were subsequently treated with anti-IL-9 mAb. Melanoma growth was severely impaired in IL-23R/ mice. It was next asked, in this completely independent model, what role IL-9 played in this inhibition of tumor growth. Again, neutralization of IL-9 also led to impaired melanoma immunity in IL-23R/ and IL-23R+/+ (WT) mice (FIG. 9C), suggesting that the production of IL-9 by TIL's observed previously (FIG. 10E) was at least partially effective in tumor growth suppression. Moreover, T cells from tumor draining lymph nodes of IL-23R+/+ (WT) and IL-23R/ mice secreted IL-9 (FIG. 3D) and there was increased IL-9 secretion by IL-23R/ T cells compared to IL-23R+/+ (WT).

Example 4

Th9 Cells Inhibit Melanoma Growth

(172) Since IL-9 is mainly produced by CD4+T cells, the role of effector subsets of CD4+T cells in melanoma immunity was examined. Th1, Th2, Th9 and Th17 cells were generated from naive CD4+T cells of OT2 mice. CD4+T cells from OT-2 mice express transgenic TCR that recognizes an Ova-peptide expressed on B16F10-ova melanoma cells. Before adoptive transfer into mice, in vitro cytokine polarized CD4+T cells were analyzed for their cytokine expression. As expected, OT2-Th1 cells produced IFN-, OT2-Th2 cells produced IL-4, OT2-Th9 cells produced abundant IL-9, and OT2-Th17 cells produced principally IL-17A (FIG. 11A). Differentiated OT2-Th1, OT2-Th2, OT2-Th9 or OT2-Th17 cells were transferred into syngeneic immunocompetent hosts (WT-C57BL/6). On the same day, B16F10-ova melanoma cells were injected subcutaneously. Mice treated with OT2-Th9 cells showed the most resistance to melanoma growth, and mice treated with OT2-Th17 or OT2-Th2 cells, but not OT2-Th1 cells, showed slower melanoma growth compared to the control group (FIG. 4A).

(173) To determine if Th9 cells could inhibit the melanoma development independent of endogenous T cells, OT2-Th0 and OT2-Th9 cells generated from OT2 mice were transferred into immunocompromised hosts (Rag1/ C57BL/6 mice). Here, OT2-Th9 cells inhibited B16F10-ova induced melanoma growth (FIG. 4B), and survival of OT2-Th9-treated mice was significantly increased compared with control group (FIG. 4C). This data suggest that Th9 cells are capable of inhibiting melanoma development, even in the absence of CD8+T cells. To investigate if IL-9 secreted by OT2-Th9 cells is responsible for the observed anti-melanoma responses, blocking IL-9 was used by neutralizing mAb in OT2-Th9 treated mice (FIG. 4B). IL-9 blockade accelerated melanoma growth in OT2-Th9 treated mice, suggesting at least partial dependence of this effect directly on IL-9.

(174) To determine whether Th9 cells could directly kill melanoma cells, CFSE labeled B16F10-ova cells were co-cultured with OT2-Th9 cells for 24 h. At that point, B16F10-ova cells were recovered and stained with 7-AAD, a sensitive indicator of apoptotic cell death. Strikingly, OT2-Th9 cells alone were capable of inducing apoptosis in melanoma cells, whereas OT2-Th0 and OT2-Th17 cells were much less effective in this regard (FIG. 12A). Next, the mechanism of Th9 cell direct cytotoxicity was assessed. A limited profile of effector molecules in Th9 cells was performed (FIG. 11B). Increased expression of granzyme-B in Th9 cells was observed. Therefore, OT2-Th9 cells were pre-incubated with a granzyme B inhibitor before co-culture with tumor cells to assess the effect on their cytotoxic activity.

(175) Inhibition of granzyme B significantly attenuated the OT2-Th9 cell cytotoxic activity (FIG. 12B). To further explore the direct cytotoxic effects of Th9 cells, another cytotoxic assay.sup.4 was used. OT2-Th9 cells were incubated with CFSE labeled (5 M) B16Ova cells and CFSE labeled (0.5 M) EL-4 cells for 36 h. There were dose dependent effects of Th9 cells on tumor cell lysis (FIG. 12C). More importantly, OT2-Th9 cells killed B16ova cell but not a tumor cell line that did not express Ova, suggesting that Th cell mediated cytotoxic effects are tumor specific (FIG. 12C).

Example 5

Abrogation of IL-9/IL-9R Signaling Promotes Melanoma Development, and Treatment with rIL-9 Inhibits Melanoma Development

(176) The results above strongly implicated IL-9 in tumor immunity. To analyze the role of IL-9 in tumor growth more directly, melanoma cells were injected into IL-9R/ mice, and tumor growth was monitored. Melanoma growth was significantly accelerated in IL-9R/ mice compared to IL-9R+/ mice (FIG. 5A). It was next asked if administration of rIL-9 could protect mice against melanoma growth and progression. Remarkably, treatment of melanoma bearing mice with recombinant IL-9 (rIL-9) both impaired melanoma growth (FIG. 5B) and increased the survival of mice (data not shown). To examine if rIL-9 could potentiate the anti-melanoma response in mice already vaccinated against melanoma, mice were treated with 1 million irradiated melanoma cells (as vaccine) and 7 days later, melanoma cells were injected. Mice were treated with rIL-9 or with PBS alone. Again, rIL-9 treated mice showed significantly slower melanoma growth (FIG. 4A). To investigate the role of IL-9 in tumors other than melanoma, Lewis lung carcinoma (LLC-1) cells were used. LLC-1 tumor development was significantly suppressed in rIL-9 treated mice compared with a control group (FIG. 5C), consistent with the extensive observations with B16 melanoma tumors described above herein.

Example 6

Mast Cells, but not Adaptive Immune Cells, are Required for the Anti-Tumor Effect of IL-9

(177) Subsequently, the mechanism of IL-9 mediated tumor immunity, specifically as it relates to T cells, was investigated. Melanoma cells were injected into Rag1/ C57BL/6 mice, which lack T and B cells. These mice were treated with either rIL-9 or PBS (control). In this setting, rIL-9 treatment still significantly slowed melanoma growth (FIG. 5D), suggesting that the target of the IL-9 effect was not a T cell or B cell. IL-9 is also known to promote mast cell development and function, so mast cell deficient mice (Kit W-sh/HNihrJaeBsmJ) were injected with B16 melanoma and lewis lung carcinoma cells (LLC-1), respectively, treated mice systemically with rIL-9 in the same fashion, and measured tumor growth (melanoma: FIG. 5E, LLC-1: FIG. 5F). Strikingly, under these conditions, there was no significant difference in tumor development in IL-9 treated mast cell deficient mice, as compared to control. These highly reproducible data suggest that tumor growth inhibition mediated by IL-9 depends upon the presence of mast cells, but not on the presence of T cells or B cells. Moreover, the anti-tumor effect of IL-9 was seen on two different tumor cell lines of completely different development cellular origin: LLC-1 and B16 melanoma.

Example 7

Presence of IL-9 Producing T Cells (Th9 Cells) in Human Skin and Peripheral Blood

(178) The existence of human Th9 cells is controversial; for this work to be relevant to melanoma patients, these cells were identified in human tissues. Specifically, it was asked if IL-9 producing Th9 cells can be identified in humans, and if so, do they possess a phenotype comparable to mouse Th9 cells. Mouse Th9 cells are defined as a distinct population of CD4+T cells that produce IL-9 but not IFN (Th1), IL-4 (Th2) or IL-17 (Th17). It was possible to demonstrate that human memory T cells isolated from peripheral blood contained a distinct population of IL-9 producing T cells that does not produce IFN, IL-4 and IL-17. T cells with an identical phenotype, and in greater abundance, were also found skin-resident T cells isolated from healthy skin (FIGS. 6A-6B). Finally, the presence of IL-9 producing T cells in T cells extracted from patients with Stage IV unresectable metastatic melanoma was examined (metastasis to lung (n=4), skin (n=2), adrenal gland (n=1), bone (n=1)). Detectable IL-9 producing T cells were observed in 6 out of 8 biopsies; however, this IL-9 production was significantly lower in T cells from metastatic melanoma compared with T cells extracted from healthy donors (FIG. 6c).

(179) Described herein are five findings: 1) Mice deficient in pathways related to Th17 development (ROR/ and IL-23R/) show significant resistance to melanoma growth in a fashion that is largely IL-9 dependent; 2) Th9 cells inhibit tumor growth in an IL-9 dependent fashion; 3) mice deficient in IL-9 signaling, either by germline inactivation of the receptor gene or by antibody blockade, exhibit enhanced melanoma growth; 4) treatment of tumor bearing mice with exogenous rIL-9 inhibits tumor growth in normal mice, and this effect is dependent on the presence of mast cells but not T and B cells; and 5) memory Th9 T cells can be identified in normal human blood and skin, and are present at reduced levels in metastatic melanoma lesions.

(180) At the outset of the study, the goal was to assess the role of Th17 cells in melanoma immunity; thus, ROR/ ch mice and IL-23R/ mice, which can not generate or maintain Th17 cells, respectively, were used. Melanomas implanted in ROR/ mice and IL-23R/ showed impaired growth and increased tumor infiltration by T cells, suggesting an important role for the Th17 pathway in tumor immunity. However, the role of other pathways remained an open question.

(181) To explore the expression of unknown factors with anti-tumor properties, gene expression analysis was performed with CD4+T cells of ROR/ and ROR+/+ controls differentiated under Th17 polarizing conditions. This analysis revealed a striking increase in IL-9 expression in ROR/ Th cells. These data indicate that absence of ROR promotes IL-9 expression. Little is known about the regulation of IL-9. Recent studies have suggested that IL-25 and IL-21 enhance IL-9 expression in mice and humans, respectively.sup.22 23. The precise mechanism by which the absence of ROR promotes IL-9 expression in T cells is not known, although analysis of the IL-9 promoter does not reveal an ROR binding site (data not shown). However, the data presented herein demonstrates severely impaired IL-23R expression on ROR/ CD4+T cells. In concert, increased IL-9 expression was observed in IL-23R/ CD4+T cells. Therefore, attenuated signaling via IL-23R expression in ROR/ CD4+T cells might be one of the factors responsible for increased in IL-9 expression. To evaluate if increased IL-9 expression is critical for the observed anti-melanoma responses in ROR/ ch mice and IL-23R/ mice, IL-9 was blocked by treating mice systemically with a neutralizing anti-IL-9 antibody. Depletion of IL-9 in both ROR/ch mice and IL-23R/ and normal WT mice clearly accelerated melanoma growth.

(182) Since IL-9 is primarily a product of CD4+T cells, the role of IL-9 producing Th cells (Th9 cells) in tumor immunity was explored. Mice treated with Th9 cells showed profound resistance to melanoma development. This is believed to be the first report demonstrating anti-tumor effect of Th9 cells. Previous studies have reported that adoptive transfer of Th9 cells can induce colitis and peripheral neuritis in lymphopoenic host.sup.24, indicating significant immune effector function mediated by these cells. Similar to previous reports.sup.6,13,25, Th2 and Th17 cells, but not Th0 and Th1 cells inhibited melanoma growth in the experiments described herein. However the anti-melanoma properties of Th9 cells were far superior to Th17 cells, in both immunocompetent and immunocompromised hosts.

(183) In vitro, Th9 cells showed modest but measurable direct cytotoxic activity on melanoma cells, a novel and striking observation. Increased expression of Granzyme B and C was also observed in Th9 cells, a possible mechanism of Th9 cell direct cytotoxicity, and a Granzyme B inhibitor was shown to partially block Th9 mediated melanoma cytotoxicity. Therefore, it appears that Th9 cells possess robust anti-melanoma activity mediated in large part by direct release of IL-9. However, in this setting, blockade of IL-9 in Th9 treated mice accelerated tumor growth, suggesting that Th9 cell anti-melanoma activity is significantly IL-9 dependent.

(184) To determine independently whether IL-9 has anti-melanoma activities, melanoma growth was studied in IL-9R/ mice. Melanoma growth was reproducibly accelerated in IL-9R/ mice. These data indicate that IL-9 appears to be an independent factor that influences tumor growth. The data also indicate that treatment with exogenous IL-9 reproducibly suppresses the growth of B16 melanoma in the same tumor model. To rule out the possibility that this process was unique to a single tumor type, it was asked whether the growth of a lung carcinoma cell line could be similarly inhibited. Reproducibly, LLC-1 growth was significantly inhibited by IL-9. To rule out the unlikely possibility that this was a direct effect of IL-9 on the tumor cells, IL-9R expression on tumor cells was investigated and the direct effects of IL-9 on tumor cell growth was examined (FIGS. 10B-10D). EL-4 T lymphoma cells were used as a control. Melanoma cells and lung carcinoma show negligible IL-9R expression and IL-9 does not affect the growth of these cells in vitro, suggesting that IL-9 mediated anti-tumor effects on melanoma cells and on lung carcinoma cells are indirect. However, increased IL-9R expression on EL-4 cells was observed (FIG. 4C). It was asked if the growth of this tumor could be inhibited by IL-9, and neither inhibition nor acceleration of EL-4 tumor growth was observed (data not included). This suggests that the presence of IL-9R on EL-4 cells, and previously reported growth and survival promoting properties of IL-9 T cells, may be accountable for negligible anti-tumor effect of IL-9 in this tumor model.sup.26. Therefore, these data indicate that the anti-tumor effects of IL-9 are indirect, and also indicates that potential tumor targets of rIL-9 therapy should be selected with care: specifically, lymphomas and other cells known to express receptors for this cytokine may not be appropriate candidates for treatment.

(185) To explore the adaptive immune-mediated anti-tumor effects of IL-9, it was asked if the tumor inhibitor effect of IL-9 would be preserved in mice deficient in T and B cells. Strikingly, no difference was found in the degree of tumor inhibition mediated by exogenous IL-9 between normal and Rag-1/ mice. This suggests that if anything, the effect of IL-9 on the adaptive immune system is not sufficient to mediate the beneficial effects of IL-9 in tumor growth inhibition. Furthermore, it appears that the anti-melanoma properties of IL-9 are neither mediated via direct effect on T or B cell activation nor via direct effects on tumor cells.

(186) Because the effect of exogenous IL-9 appears to be independent of T and B cells, and because the anti-tumor effects of Th9 cells can be largely abrogated by neutralizing antibodies to IL-9, other immune cells that might be targets for IL-9 were sought. IL-9 is a potent activator of mast cells, a cell type that has recently been implicated in anti-tumor activity.sup.27. Therefore, mast cell deficient mice were used to study the IL-9 mediated anti-tumor effect. Strikingly, rIL-9 treatment was observed to have no inhibitory effect on tumor growth in mast cell deficient hosts, suggesting that mast cells play an important role in the anti-tumor activity mediated by IL-9. Future studies are needed to delineate how IL-9 modulates the mast cell anti-tumor activity (survival, and/or function).

(187) Finally, there has been some controversy about whether Th9 cells were a purely murine phenomenon, and therefore not relevant to human disease. Human skin and blood were examined for the presence of memory T cells that could produce IL-9. IL-9 producing T cells were readily found in populations of human skin resident memory T cells and in the memory T cell population of PBMCs. Importantly, these IL-9 producing human T-cells appear to be authentic analogs of murine Th9 cells, as they do not produce other Th cell lineage cytokines such as IFN- (Th1), IL-4 (Th2), and IL-17 (Th17). Production of IL-9 by T cells in tumor draining lymph nodes in the B16 melanoma model was demonstrated, and therefore it was asked whether Th9 cells could be found in human metastatic melanoma samples. In 6 of 8 samples, the presence of memory Th9 TIL's could be detected, but at a much lower abundance than memory Th9 cells in either normal skin or blood. The finding of low levels of Th9 T cells in human metastatic melanoma is interesting. These results suggest that Th9 cells are part of the normal human immune response to melanoma, and thus augmenting their activity, or providing additional IL-9, should be therapeutically advantageous in this setting.

(188) The role of IL-9 in tumor immunity has not been previously explored. Interestingly, however, single nucleotide polymorphisms in IL-9 gene were found to be associated with increased risk of cutaneous malignant melanoma (CMM).sup.28. Therefore, IL-9 was suggested as one of the highly significant modifier genes for CMM using pathway permutation analysis. A very recent paper by Smith et al.sup.29 reported that blockade of endogenous IL-9 alone does not enhance the survival of tumor bearing mice; however, in combination with CpG therapy anti-IL-9 increases the survival of Balb-neu T mice. These investigators speculate that blockade of IL-9 signaling inhibits Treg function and thus promotes vaccine induced effector T-cell mediated anti-tumor responses. As described herein, however, blockade of endogenous IL-9 invariably accelerated tumor development in the B16 melanoma model, and the absence of IL-9 signalling (i.e., IL-9R/ mice) also enhanced melanoma growth. The discrepancy between the results described herein and that of Smith et al is difficult to reconcile; however, there are clear differences between the experimental design described herein and that of Smith et al.sup.29. First, the tumor models used were distinct. In addition, the experiments described herein did not use vaccine or adjuvant in combination with endogenous IL-9 blockade or with exogenous IL-9 treatment to boost adaptive immune response. In summary, all of the experiments described herein, using a large number of different variables, were consistent with a distinct anti-tumor effect of IL-9. The data presented herein also show that this anti-tumor effect was largely mediated by mast cells, which have not been reported to be targets of Treg inhibition.

(189) In conclusion, described herein is an unexpected role of IL-9 and Th9 cells in anti-tumor immune responses. Strategies that favor generation of IL-9 mediated immune responses, while blocking IL-17 mediated responses, may have an important clinical role in the treatment of melanoma. Other c chain cytokines, such as IL-2, IL-15, and IL-21.sup.30-32, have been used in the treatment of human melanoma, and the data presented herein indicate that IL-9 and Th9 cells have an important role in treatment of this challenging malignancy.

Methods

(190) Mice.

(191) WT C57BL/6, Rag1/ C57BL/6 and IFN/ mice were obtained from Jackson Laboratories. IL-9R/, IL23R/ and ROR/ and their control mice (ROR+/+, IL9R/+) were provided by Jean-Christophe Renauld.sup.33 (Ludwig Institute, Belgium), V K Kuchroo.sup.34 (BWH) and A M Jetten.sup.18 (NIH), respectively. Mice were housed in conventional, pathogen-free facilities at the animal facility of Harvard Medical School.

(192) In Vitro T Cell Differentiation.

(193) CD4+CD25-CD62Lhigh cells from ROR/ mice or ROR+/+ controls were sorted by CD4+CD62L+ isolation kit II from Miltenyi Biotech (USA) according to manufacturer's protocol. Purity of CD4+CD25-CD62Lhigh was >95%.

(194) Sorted CD4+CD25-CD62Lhigh cells were differentiated into Th1 (IL-12:10 ng/ml), Th2 (IL-4: 10 ng/ml), Th9 (TGF- plus IL-4: 1 ng/ml and 10 ng/ml), and Th17 (TGF- plus IL-6: 1 ng/ml and 10 ng/ml) in presence with plate bound anti-CD3 (1 g/ml) and irradiated splenocytes (1:5 ratio). After 48 h cells were fed with IL-2 (10 ng/ml) containing fresh media and split into two parts, if needed. On day 5, cells were harvested and processed for cytokine analysis at RNA or protein level by real-time RT-PCR, flow cytometry and ELISA.

(195) For adoptive transfer experiments, CD4+Th cells differentiation was carried out using above mentioned protocol with few modifications. Plate bound anti-CD3 (2 g/ml) and anti-CD28 (1 g/ml) was used in place of irradiated splenocytes. In addition to above mention polarization condition, anti-IFN mAb (10 g/ml) was added into Th9 cultures and anti-IFN- mAb (10 g/ml) plus anti-IL-4 mAb (10 g/ml) was added into Th17 cultures.

(196) Tumor (Melanoma, Lewis Lung Carcinoma and Thymic Lymphoma) Induction, In Vivo T Cell Transfer and IL-9 Neutralization.

(197) Melanoma cell lines (B16F10 cells or B16F10-ova cells), T cell lymphoma (EL-4 or ovalbumin expressing EL-4 (EG-7)) and Lewis lung carcinoma (LLC1) were grown in RPMI1640 supplemented with 10% FBS, and penicillin/streptomycin. B16F10 cells (2-410.sup.5 cells/150 l/mouse), EL-4 (210.sup.5 cells/150 A/mouse), or LLC1 (510.sup.5 cells/150 A/mouse) were injected subcutaneously into the right or left flank of the mice and tumor development was monitored over time. Tumor volume was calculated by following formula: (major circumferenceminor circumference.sup.2)/2. Mice were sacrificed when there was external necrosis or/and tumor volume reached no greater than 2 cm in any direction.

(198) To investigate the role of effector subsets of Th cells on melanoma and thymic lymphoma growth, 2-million differentiated cells (Th1, Th2, Th9 and Th17) from CD45.1+CD45.2-OT2 TCR transgenic mice were injected (iv) into WT-C57BL6 mice or Rag1/ (C57BL6 background)) mice and, on the same day tumor cells (B16F10-ova cells: 310.sup.5 cells/150 l/mouse) were injected subcutaneously. Tumor growth was monitored over time.

(199) IL-9 activity in vivo was neutralized by injecting (i.p.) 100 g anti-IL-9 mAb (clone: MM9C1, a generous gift by Jacques van Snick (Ludwig Institute, Belgium)) for 4 times on day 0, day 3, day 6 and day 10. Melanoma cells were injected on day 0 and melanoma growth was monitored over time.

(200) rIL-9 (5 g/100 A PBS/mouse from Cell Sciences, USA) was injected (ip) from day 0 and every third day till the termination of the experiment. In lewis lung carcinoma (LLC-1) model, rIL-9 (50 ng/100 l PBS/mouse from RnD systems) was used on every alternate day till the termination of experiment. Unlike Cell Science rIL-9 (source: E. coli), rIL-9 from RnD systems is glycosylated and therefore has stronger biological activity compared to Cell Sciences. Thus, 100 times less rIL-9 was used in LLC-1 tumor model experiments compared to melanoma model experiments. In addition, melanoma bearing mice were treated with rIL-9 from RnD systems which produced similar results as were observed with rIL-9 from Cell Sciences (data not shown).

(201) Cytotoxicity Assay.

(202) For the cytotoxicity assay, CFSE labeled B16F10-ova cells (510.sup.5 cells/500 l) were cultured with differentiated Th cells (OT2-Th0, OT2-Th9 and OT2-Th17) in several different ratios. After 24 h of co-culture, cells (gate on CFSE labeled B16F10-ova cells) were analyzed for 7-AAD staining by flow cytometry. In addition, another cytotoxicity assay was used as described before.sup.4.

(203) Growth Curve Assay.

(204) Effect of rIL-9 on growth of B16F10 cells were studied by growth curve assay. B16F10 cells were seeded with rIL-9. After each incubation period cells were fixed (10% acetic acid in 10% ethanol). Cells were subsequently stained with 0.4% crystal violet in 10% ethanol for 30 min. Subsequently, 200 l 10% acetic acid was added. After 30 min, 100 L solution was transferred into 96-well plate and OD was measured at 595-wavelength.

(205) Measurement of Cytokines by Intracellular Cytokine Staining, CBA, ELISA and Quantitative RT-PCR.

(206) Intracellular cytokines by Lymph node (LNs) cells, splenocytes, TILs or in vitro differentiated Th cells were quantified after restimulation with PMA plus ionomycin and GolgiStop ss described previously.sup.35.

(207) Cytokines were quantified in cell free culture supernatants by cytometric bead array (CBA by BD Biosciences) or by ELISA (eBioscience) according to the manufacturer's instructions.

(208) RNA was extracted with High pure RNA isolation kit (Roche), cDNA was made by First strand cDNA synthesis kit (BioRad) and quantitative RT-PCR was done using multiplex kit (BioRad) on iCycler real time PCR detection system (BioRad) according to the manufacturer's instructions. IL-9R PCR was carried out by using IL-9R specific TaqMan (Thermofisher) probes and AB Biosystem PCR machine.

(209) Cell Purification, Sorting, Intracellular Cytokine Staining and Cytokine Quantification in Supernatants (Human Study).

(210) PBMCs were isolated from buffy coats of healthy donors by density centrifugation. Memory CD4+T cells were purified from freshly isolated PBMCs by negative selection using a Memory CD4+ T cells Isolation Kit (Miltenyi Biotech, Germany) and stimulated with anti-CD3/CD2/CD28 beads (Milyenyi) in presence of TGFb (3 ng/ml).

(211) Normal human skin samples were obtained as discarded material after cosmetic surgery according to Institutional Review Board of Partners Human Research Committee. Total skin T cells from healthy donors and T cells of melanoma metastasis were isolated from explant cultures grown with IL-2 and IL-15 as previously.sup.36 described.

(212) Activated memory T cells from PBMCs, and skin T cells and T cells of melanoma metastasis isolated by the explant culture technique were stimulated for 5 h in the presence of PMA/ionomycin (Sigma-Aldrich) plus Brefeldin A. After incubation, CD4+T cells were stained for IFN (anti-IFN: B27), IL-4 (anti-IL-4: MP4-25D2), IL-9 (antiIL-9: MH9A4) and IL-17 (anti-IL-17: eBio64DEC17,) using standard intracellular staining and analyzed by flow cytometry.sup.35.

(213) Memory T cells from blood, skin and melanoma metastasis were stimulated at 10.sup.6 cells/ml with beads coated with CD3/CD2/CD28 (bead:T cell ratio: 1:2 from Miltenyi Biotech) in the presence of IL-2 (50 IU/ml) and TGF- (3 ng/ml) for 2 days. IL-9 in culture supernatants was measured by Luminex bead-based multiplex assays using a custom-made Luminex bead assay as described previously.sup.37.

(214) Statistical Analysis.

(215) Student t-test (two tailed) was performed for the data analysis using GraphPad Prism software program. A paired t-test was used in FIGS. 8H and 8J. The p value <0.005, 0.025 and 0.05 are represented as ***, ** and * respectively.

(216) All the references cited below and cited throughout the specification, are herein incorporated by reference in their entirety.

REFERENCES OF THE EXAMPLES

(217) 1. Hodi, F. S., et al. Improved survival with ipilimumab in patients with metastatic melanoma. N Engl J Med 363, 711-723 (2010). 2. Mumberg, D., et al. CD4(+) T cells eliminate MHC class II-negative cancer cells in vivo by indirect effects of IFN-gamma. Proc Natl Acad Sci USA 96, 8633-8638 (1999). 3. Perez-Diez, A., et al. CD4 cells can be more efficient at tumor rejection than CD8 cells. Blood 109, 5346-5354 (2007). 4. Quezada, S. A., et al. Tumor-reactive CD4(+) T cells develop cytotoxic activity and eradicate large established melanoma after transfer into lymphopenic hosts. J Exp Med 207, 637-650 (2010). 5. Xie, Y., et al. Naive tumor-specific CD4(+) T cells differentiated in vivo eradicate established melanoma. J Exp Med 207, 651-667 (2010). 6. Mattes, J., et al. Immunotherapy of cytotoxic T cell-resistant tumors by T helper 2 cells: an eotaxin and STATE-dependent process. J Exp Med 197, 387-393 (2003). 7. Numasaki, M., et al. Interleukin-17 promotes angiogenesis and tumor growth. Blood 101, 2620-2627 (2003). 8. Numasaki, M., et al. IL-17 enhances the net angiogenic activity and in vivo growth of human non-small cell lung cancer in SCID mice through promoting CXCR-2-dependent angiogenesis. J Immunol 175, 6177-6189 (2005). 9. Wang, L., et al. IL-17 can promote tumor growth through an IL-6-Stat3 signaling pathway. J Exp Med 206, 1457-1464 (2009). 10. Benchetrit, F., et al. Interleukin-17 inhibits tumor cell growth by means of a T-cell-dependent mechanism. Blood 99, 2114-2121 (2002). 11. Kryczek, I., et al. Phenotype, distribution, generation, and functional and clinical relevance of Th17 cells in the human tumor environments. Blood 114, 1141-1149 (2009). 12. Kryczek, I., Wei, S., Szeliga, W., Vatan, L. & Zou, W. Endogenous IL-17 contributes to reduced tumor growth and metastasis. Blood 114, 357-359 (2009). 13. Martin-Orozco, N., et al. T helper 17 cells promote cytotoxic T cell activation in tumor immunity. Immunity 31, 787-798 (2009). 14. Muranski, P., et al. Tumor-specific Th17-polarized cells eradicate large established melanoma. Blood 112, 362-373 (2008). 15. Ivanov, I I, Zhou, L. & Littman, D. R. Transcriptional regulation of Th17 cell differentiation. Semin Immunol 19, 409-417 (2007). 16. Jetten, A. M. & Joo, J. H. Retinoid-related Orphan Receptors (RORs): Roles in Cellular Differentiation and Development. Adv Dev Biol 16, 313-355 (2006). 17. Yang, X. O., et al. T helper 17 lineage differentiation is programmed by orphan nuclear receptors ROR alpha and ROR gamma. Immunity 28, 29-39 (2008). 18. Tilley, S. L., et al. Retinoid-related orphan receptor gamma controls immunoglobulin production and Th1/Th2 cytokine balance in the adaptive immune response to allergen. J Immunol 178, 3208-3218 (2007). 19. Kurebayashi, S., et al. Retinoid-related orphan receptor gamma (RORgamma) is essential for lymphoid organogenesis and controls apoptosis during thymopoiesis. Proc Natl Acad Sci USA 97, 10132-10137 (2000). 20. Elyaman, W., et al. IL-9 induces differentiation of TH17 cells and enhances function of FoxP3+ natural regulatory T cells. Proc Natl Acad Sci USA 106, 12885-12890 (2009). 21. Schmitt, E., et al. IL-9 production of naive CD4+ T cells depends on IL-2, is synergistically enhanced by a combination of TGF-beta and IL-4, and is inhibited by IFN-gamma. J Immunol 153, 3989-3996 (1994). 22. Angkasekwinai, P., Chang, S. H., Thapa, M., Watarai, H. & Dong, C. Regulation of IL-9 expression by IL-25 signaling. Nat Immunol 11, 250-256 (2010). 23. Wong, M. T., et al. Regulation of human Th9 differentiation by type I interferons and IL-21. Immunol Cell Biol 88, 624-631 (2010). 24. Dardalhon, V., et al. IL-4 inhibits TGF-beta-induced Foxp3+ T cells and, together with TGF-beta, generates IL-9+ IL-10+ Foxp3() effector T cells. Nat Immunol 9, 1347-1355 (2008). 25. Hung, K., et al. The central role of CD4(+) T cells in the antitumor immune response. J Exp Med 188, 2357-2368 (1998). 26. Knoops, L. & Renauld, J. C. IL-9 and its receptor: from signal transduction to tumorigenesis. Growth Factors 22, 207-215 (2004). 27. Oldford, S. A., et al. A critical role for mast cells and mast cell-derived IL-6 in TLR2-mediated inhibition of tumor growth. J Immunol 185, 7067-7076 (2010). 28. Yang, X. R., et al. Identification of modifier genes for cutaneous malignant melanoma in melanoma-prone families with and without CDKN2A mutations. Int J Cancer 125, 2912-2917 (2009). 29. Smith, S. E., Hoelzinger, D. B., Dominguez, A. L., Van Snick, J. & Lustgarten, J. Signals through 4-1BB inhibit T regulatory cells by blocking IL-9 production enhancing antitumor responses. Cancer Immunol Immunother 60, 1775-1787 (2011). 30. Atkins, M. B., Kunkel, L., Sznol, M. & Rosenberg, S. A. High-dose recombinant interleukin-2 therapy in patients with metastatic melanoma: long-term survival update. Cancer J Sci Am 6 Suppl 1, S11-14 (2000). 31. Dougan, M. & Dranoff, G. Immune therapy for cancer. Annu Rev Immunol 27, 83-117 (2009). 32. Ma, H. L., et al. IL-21 activates both innate and adaptive immunity to generate potent antitumor responses that require perforin but are independent of IFN-gamma. J Immunol 171, 608-615 (2003). 33. Steenwinckel, V., et al. IL-13 mediates in vivo IL-9 activities on lung epithelial cells but not on hematopoietic cells. J Immunol 178, 3244-3251 (2007). 34. Awasthi, A., et al. Cutting edge: IL-23 receptor gfp reporter mice reveal distinct populations of IL-17-producing cells. J Immunol 182, 5904-5908 (2009). 35. Purwar, R., et al. Resident memory T cells (T(RM)) are abundant in human lung: diversity, function, and antigen specificity. PLoS One 6, e16245 (2011). 36. Clark, R. A., et al. A novel method for the isolation of skin resident T cells from normal and diseased human skin. J Invest Dermatol 126, 1059-1070 (2006). 37. O'Leary, F. M., et al. Injury-induced GR-1+ macrophage expansion and activation occurs independently of CD4 T-cell influence. Shock 36, 162-169 (2011).

(218) TABLE-US-00001 SEQUENCES HumanIL-9mRNAsequenceNCBIRefSeq:NM_000590 SEQIDNO:1 1 ccgctgtcaagatgcttctggccatggtccttacctctgccctgctcctgtgctccgtgg 61 caggccaggggtgtccaaccttggcggggatcctggacatcaacttcctcatcaacaaga 121 tgcaggaagatccagcttccaagtgccactgcagtgctaatgtgaccagttgtctctgtt 181 tgggcattccctctgacaactgcaccagaccatgcttcagtgagagactgtctcagatga 241 ccaataccaccatgcaaacaagatacccactgattttcagtcgggtgaaaaaatcagttg 301 aagtactaaagaacaacaagtgtccatatttttcctgtgaacagccatgcaaccaaacca 361 cggcaggcaacgcgctgacatttctgaagagtcttctggaaattttccagaaagaaaaga 421 tgagagggatgagaggcaagatatgaagatgaaatattatttatcctatttattaaattt 481 aaaaagctttctctttaagttgctacaatttaaaaatcaagtaagctactctaaatcagt 541 atcagttgtgattatttgtttaacattgtatgtctttattttgaaataaat HumanIL-9aminoacidsequenceNCBIRefNo:NP_000581 SEQIDNO:2 1 mllamvltsalllcsvagqgcptlagildinflinkmqedpaskchcsanvtsclclgip 61 sdnctrpcfserlsqmtnttmqtryplifsrvkksvevlknnkcpyfsceqpcnqttagn 121 altflkslleifqkekmrgmrgki HumanIL-9RamRNAsequenceNCBIRefNo:NM_002186 SEQIDNO:3 1 agcagctctgtaatgcgcttgtggtttcagatgtgggcggcctgtgtgaacctgtcgtgc 61 aaagctcacgtcaccaactgctgcagttatctcctgaatcaggctgagggtctttgctgt 121 gcacccagagatagttgggtgacaaatcacctccaggttggggatgcctcagacttgtga 181 tgggactgggcagatgcatctgggaaggctggaccttggagagtgaggccctgaggcgag 241 acatgggcacctggctcctggcctgcatctgcatctgcacctgtgtctgcttgggagtct 301 ctgtcacaggggaaggacaagggccaaggtctagaaccttcacctgcctcaccaacaaca 361 ttctcaggatcgattgccactggtctgccccagagctgggacagggctccagcccctggc 421 tcctcttcaccagcaaccaggctcctggcggcacacataagtgcatcttgcggggcagtg 481 agtgcaccgtcgtgctgccacctgaggcagtgctcgtgccatctgacaatttcaccatca 541 ctttccaccactgcatgtctgggagggagcaggtcagcctggtggacccggagtacctgc 601 cccggagacacgttaagctggacccgccctctgacttgcagagcaacatcagttctggcc 661 actgcatcctgacctggagcatcagtcctgccttggagccaatgaccacacttctcagct 721 atgagctggccttcaagaagcaggaagaggcctgggagcaggcccagcacagggatcaca 781 ttgtcggggtgacctggcttatacttgaagcctttgagctggaccctggctttatccatg 841 aggccaggctgcgtgtccagatggccacactggaggatgatgtggtagaggaggagcgtt 901 atacaggccagtggagtgagtggagccagcctgtgtgcttccaggctccccagagacaag 961 gccctctgatcccaccctgggggtggccaggcaacacccttgttgctgtgtccatctttc 1021 tcctgctgactggcccgacctacctcctgttcaagctgtcgcccagggtgaagagaatct 1081 tctaccagaacgtgccctctccagcgatgttcttccagcccctctacagtgtacacaatg 1141 ggaacttccagacttggatgggggcccacggggccggtgtgctgttgagccaggactgtg 1201 ctggcaccccacagggagccttggagccctgcgtccaggaggccactgcactgctcactt 1261 gtggcccagcgcgtccttggaaatctgtggccctggaggaggaacaggagggccctggga 1321 ccaggctcccggggaacctgagctcagaggatgtgctgccagcagggtgtacggagtgga 1381 gggtacagacgcttgcctatctgccacaggaggactgggcccccacgtccctgactaggc 1441 cggctcccccagactcagagggcagcaggagcagcagcagcagcagcagcagcaacaaca 1501 acaactactgtgccttgggctgctatgggggatggcacctctcagccctcccaggaaaca 1561 cacagagctctgggcccatcccagccctggcctgtggcctttcttgtgaccatcagggcc 1621 tggagacccagcaaggagttgcctgggtgctggctggtcactgccagaggcctgggctgc 1681 atgaggacctccagggcatgttgctcccttctgtcctcagcaaggctcggtcctggacat 1741 tctaggtccctgactcgccagatgcatcatgtccattttgggaaaatggactgaagtttc 1801 tggagcccttgtctgagactgaacctcctgagaaggggcccctagcagcggtcagaggtc 1861 ctgtctggatggaggctggaggctcccccctcaacccctctgctcagtgcctgtggggag 1921 cagcctctaccctcagcatcctggccacaagttcttccttccattgtcccttttctttat 1981 ccctgacctctctgagaagtggggtgtggtctctcagctgttctgccctcatacccttaa 2041 agggccagcctgggcccagtggacacaggtaaggcaccatgaccacctggtgtgacctct 2101 ctgtgccttactgaggcacctttctagagattaaaaggggcttgatggctgttaaaaaaa 2161 aaaaaaaaaaa HumanIL-9RaaminoacidsequenceNCBIRefNo:NP_002177 SEQIDNO:4 1 mglgrciwegwtlesealrrdmgtwllacicictcvclgvsvtgegqgprsrtftcltnn 61 ilridchwsapelgqgsspwllftsnqapggthkcilrgsectvvlppeavlvpsdnfti 121 tfhhcmsgreqvslvdpeylprrhvkldppsdlqsnissghciltwsispalepmttlls 181 yelafkkqeeaweqaqhrdhivgvtwlileafeldpgfihearlrvqmatleddvveeer 241 ytgqwsewsqpvcfqapqrqgplippwgwpgntivaysifllltgptyllfklsprvkri 301 fyqnvpspamffqplysvhngnfqtwmgahgagvllsqdcagtpqgalepcvqeatallt 361 cgparpwksvaleeeqegpgtrlpgnlssedvlpagctewrvqtlaylpqedwaptsltr 421 pappdsegsrssssssssnnnnycalgcyggwhlsalpgntqssgpipalacglscdhqg 481 letqqgvawvlaghcqrpglhedlqgmllpsvlskarswtf HumanIL2RGmRNAsequenceNCBIRefNo:NM_000206 SEQIDNO:5 1 agaggaaacgtgtgggtggggaggggtagtgggtgagggacccaggttcctgacacagac 61 agactacacccagggaatgaagagcaagcgccatgttgaagccatcattaccattcacat 121 ccctcttattcctgcagctgcccctgctgggagtggggctgaacacgacaattctgacgc 181 ccaatgggaatgaagacaccacagctgatttcttcctgaccactatgcccactgactccc 241 tcagtgtttccactctgcccctcccagaggttcagtgttttgtgttcaatgtcgagtaca 301 tgaattgcacttggaacagcagctctgagccccagcctaccaacctcactctgcattatt 361 ggtacaagaactcggataatgataaagtccagaagtgcagccactatctattctctgaag 421 aaatcacttctggctgtcagttgcaaaaaaaggagatccacctctaccaaacatttgttg 481 ttcagctccaggacccacgggaacccaggagacaggccacacagatgctaaaactgcaga 541 atctggtgatcccctgggctccagagaacctaacacttcacaaactgagtgaatcccagc 601 tagaactgaactggaacaacagattcttgaaccactgtttggagcacttggtgcagtacc 661 ggactgactgggaccacagctggactgaacaatcagtggattatagacataagttctcct 721 tgcctagtgtggatgggcagaaacgctacacgtttcgtgttcggagccgctttaacccac 781 tctgtggaagtgctcagcattggagtgaatggagccacccaatccactgggggagcaata 841 cttcaaaagagaatcctttcctgtttgcattggaagccgtggttatctctgttggctcca 901 tgggattgattatcagccttctctgtgtgtatttctggctggaacggacgatgccccgaa 961 ttcccaccctgaagaacctagaggatcttgttactgaataccacgggaacttttcggcct 1021 ggagtggtgtgtctaagggactggctgagagtctgcagccagactacagtgaacgactct 1081 gcctcgtcagtgagattcccccaaaaggaggggcccttggggaggggcctggggcctccc 1141 catgcaaccagcatagcccctactgggcccccccatgttacaccctaaagcctgaaacct 1201 gaaccccaatcctctgacagaagaaccccagggtcctgtagccctaagtggtactaactt 1261 tccttcattcaacccacctgcgtctcatactcacctcaccccactgtggctgatttggaa 1321 ttttgtgcccccatgtaagcaccccttcatttggcattccccacttgagaattacccttt 1381 tgccccgaacatgtttttcttctccctcagtctggcccttccttttcgcaggattcttcc 1441 tccctccctctttccctcccttcctctttccatctaccctccgattgttcctgaaccgat 1501 gagaaataaagtttctgttgataatcatcaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa HumanIL2RGaminoacidsequenceNCBIRefNo:NP_000197 SEQIDNO:6 1 mlkpslpftsllflqlpllgvglnttiltpngnedttadfflttmptdslsystlplpev 61 qcfvfnveymnctwnsssepqptnlfthywyknsdndkvqkcshylfseeitsgcqlqkk 121 eihlyqtfvvqlqdpreprrqatqmlklqnlvipwapenlfthk1sesqlelnwnnrfln 181 hclehlvqyrtdwdhswteqsvdyrhkfslpsvdgqkrytfrvrsrfnplcgsaqhwsew 241 shpihwgsntskenpflfaleavvisvgsmgliisllcvyfwlertmpriptlknledlv 301 teyhgnfsawsgvskglaeslqpdyserlclvseippkggalgegpgaspcnqhspywap 361 pcytlkpet HumanTH2AF1cDNAsequenceNCBIRefNo:NM_017625 SEQIDNO:7 1 aggagcgtttttggagaaagctgcactctgttgagctccagggcgcagtggagggaggga 61 gtgaaggagctctctgtacccaaggaaagtgcagctgagactcagacaagattacaatga 121 accaactcagcttcctgctgtttctcatagcgaccaccagaggatggagtacagatgagg 181 ctaatacttacttcaaggaatggacctgttcttcgtctccatctctgcccagaagctgca 241 aggaaatcaaagacgaatgtcctagtgcatttgatggcctgtattttctccgcactgaga 301 atggtgttatctaccagaccttctgtgacatgacctctgggggtggcggctggaccctgg 361 tggccagcgtgcacgagaatgacatgcgtgggaagtgcacggtgggcgatcgctggtcca 421 gtcagcagggcagcaaagcagtctacccagagggggacggcaactgggccaactacaaca 481 cctttggatctgcagaggcggccacgagcgatgactacaagaaccctggctactacgaca 541 tccaggccaaggacctgggcatctggcacgtgcccaataagtcccccatgcagcactgga 601 gaaacagctccctgctgaggtaccgcacggacactggcttcctccagacactgggacata 661 atctgtttggcatctaccagaaatatccagtgaaatatggagaaggaaagtgttggactg 721 acaacggcccggtgatccctgtggtctatgattttggcgacgcccagaaaacagcatctt 781 attactcaccctatggccagcgggaattcactgcgggatttgttcagttcagggtattta 841 ataacgagagagcagccaacgccttgtgtgctggaatgagggtcaccggatgtaacactg 901 agcaccactgcattggtggaggaggatactttccagaggccagtccccagcagtgtggag 961 atttttctggttttgattggagtggatatggaactcatgttggttacagcagcagccgtg 1021 agataactgaggcagctgtgcttctattctatcgttgagagttttgtgggagggaaccca 1081 gacctctcctcccaaccatgagatcccaaggatggagaacaacttacccagtagctagaa 1141 tgttaatggcagaagagaaaacaataaatcatattgactcaaaaaaaaaaaaaaaaaaaa 1201 aaaaaaaaa HumanTH2AF1aminoacidsequenceNCBIRefNo:NP_060095 SEQIDNO:8 1 mnqlsfllfliattrgwstdeantyfkewtcssspslprsckeikdecpsafdglyflrt 61 engviyqtfcdmtsggggwtlvasvhendmrgkctvgdrwssqqgskavypegdgnwany 121 ntfgsaeaatsddyknpgyydiqakdlgiwhvpnkspmqhwrnssllryrtdtgflqtlg 181 hnlfgiyqkypvkygegkcwtdngpvipvvydfgdaqktasyyspygqreftagfvqfry 241 fnneraanalcagmrvtgcntehhciggggyfpeaspqqcgdfsgfdwsgygthvgysss 301 reiteaavllfyr HumanCLCA2cDNAsequenceNCBIRefNo:NM_006536 SEQIDNO:9 1 tcccagatggatccaccccagacttttcaaagaagacacctccttcatcttgtgttctaa 61 aaccttgcaagttcaggaagaaaccatctgcatccatattgaaaacctgacacaatgtat 121 gcagcaggctcagtgtgagtgaactggaggcttctctacaacatgacccaaaggagcatt 181 gcaggtcctatttgcaacctgaagtttgtgactctcctggttgccttaagttcagaactc 241 ccattcctgggagctggagtacagcttcaagacaatgggtataatggattgctcattgca 301 attaatcctcaggtacctgagaatcagaacctcatctcaaacattaaggaaatgataact 361 gaagcttcattttacctatttaatgctaccaagagaagagtatttttcagaaatataaag 421 attttaatacctgccacatggaaagctaataataacagcaaaataaaacaagaatcatat 481 gaaaaggcaaatgtcatagtgactgactggtatggggcacatggagatgatccatacacc 541 ctacaatacagagggtgtggaaaagagggaaaatacattcatttcacacctaatttccta 601 ctgaatgataacttaacagctggctacggatcacgaggccgagtgtttgtccatgaatgg 661 gcccacctccgttggggtgtgttcgatgagtataacaatgacaaacctttctacataaat 721 gggcaaaatcaaattaaagtgacaaggtgttcatctgacatcacaggcatttttgtgtgt 781 gaaaaaggtccttgcccccaagaaaactgtattattagtaagctttttaaagaaggatgc 841 acctttatctacaatagcacccaaaatgcaactgcatcaataatgttcatgcaaagttta 901 tcttctgtggttgaattttgtaatgcaagtacccacaaccaagaagcaccaaacctacag 961 aaccagatgtgcagcctcagaagtgcatgggatgtaatcacagactctgctgactttcac 1021 cacagctttcccatgaatgggactgagcttccacctcctcccacattctcgcttgtacag 1081 gctggtgacaaagtggtctgtttagtgctggatgtgtccagcaagatggcagaggctgac 1141 agactccttcaactacaacaagccgcagaattttatttgatgcagattgttgaaattcat 1201 accttcgtgggcattgccagtttcgacagcaaaggagagatcagagcccagctacaccaa 1261 attaacagcaatgatgatcgaaagttgctggtttcatatctgcccaccactgtatcagct 1321 aaaacagacatcagcatttgttcagggcttaagaaaggatttgaggtggttgaaaaactg 1381 aatggaaaagcttatggctctgtgatgatattagtgaccagcggagatgataagcttctt 1441 ggcaattgcttacccactgtgctcagcagtggttcaacaattcactccattgccctgggt 1501 tcatctgcagccccaaatctggaggaattatcacgtcttacaggaggtttaaagttcttt 1561 gttccagatatatcaaactccaatagcatgattgatgctttcagtagaatttcctctgga 1621 actggagacattttccagcaacatattcagcttgaaagtacaggtgaaaatgtcaaacct 1681 caccatcaattgaaaaacacagtgactgtggataatactgtgggcaacgacactatgttt 1741 ctagttacgtggcaggccagtggtcctcctgagattatattatttgatcctgatggacga 1801 aaatactacacaaataattttatcaccaatctaacttttcggacagctagtctttggatt 1861 ccaggaacagctaagcctgggcactggacttacaccctgaacaatacccatcattctctg 1921 caagccctgaaagtgacagtgacctctcgcgcctccaactcagctgtgcccccagccact 1981 gtggaagcctttgtggaaagagacagcctccattttcctcatcctgtgatgatttatgcc 2041 aatgtgaaacagggattttatcccattcttaatgccactgtcactgccacagttgagcca 2101 gagactggagatcctgttacgctgagactccttgatgatggagcaggtgctgatgttata 2161 aaaaatgatggaatttactcgaggtattttttctcctttgctgcaaatggtagatatagc 2221 ttgaaagtgcatgtcaatcactctcccagcataagcaccccagcccactctattccaggg 2281 agtcatgctatgtatgtaccaggttacacagcaaacggtaatattcagatgaatgctcca 2341 aggaaatcagtaggcagaaatgaggaggagcgaaagtggggctttagccgagtcagctca 2401 ggaggctccttttcagtgctgggagttccagctggcccccaccctgatgtgtttccacca 2461 tgcaaaattattgacctggaagctgtaaaagtagaagaggaattgaccctatcttggaca 2521 gcacctggagaagactttgatcagggccaggctacaagctatgaaatnagaatgagtaaa 2581 agtctacagaatatccaagatgactttaacaatgctattttagtaaatacatcaaagcga 2641 aatcctcagcaagctggcatcagggagatatttacgttctcaccccaaatttccacgaat 2701 ggacctgaacatcagccaaatggagaaacacatgaaagccacagaatttatgttgcaata 2761 cgagcaatggataggaactccttacagtctgctgtatctaacattgcccaggcgcctctg 2821 tttattccccccaattctgatcctgtacctgccagagattatcttatattgaaaggagtt 2881 ttaacagcaatgggtttgataggaatcatttgccttattatagttgtgacacatcatact 2941 ttaagcaggaaaaagagagcagacaagaaagagaatggaacaaaattattataaataaat 3001 atccaaagtgtcttccttcttagatataagacccatggccttcgactacaaaaacatact 3061 aacaaagtcaaattaacatcaaaactgtattaaaatgcattgagtttttgtacaatacag 3121 ataagatttttacatggtagatcaacaaattctttttgggggtagattagaaaaccctta 3181 cactttggctatgaacaaataataaaaattattctttaaagtaatgtctttaaaggcaaa 3241 gggaagggtaaagtcggaccagtgtcaaggaaagtttgttttattgaggtggaaaaatag 3301 ccccaagcagagaaaaggagggtaggtctgcattataactgtctgtgtgaagcaatcatt 3361 tagttactttgattaatttttcttttctccttatctgtgcagaacaggttgcttgtttac 3421 aactgaagatcatgctatattttatatatgaagcccctaatgcaaagctctttacctctt 3481 gctattttgttatatatattacagatgaaatctcactgctaatgctcagagatctttttt 3541 cactgtaagaggtaacctttaacaatatgggtattacctttgtctcttcataccggtttt 3601 atgacaaaggtctattgaatttatttgtttgtaagtttctactcccatcaaagcagcttt 3661 ctaagttattgccttggttattatggatgatagttatagcccttataatgccttaactaa 3721 ggaagaaaagatgttattctgagtttgttttaatacatatatgaacatatagttttattc 3781 aattaaaccaaagaagaggtcagcagggagatactaacctttggaaatgattagctggct 3841 ctgttttttggttaaataagagtctttaatcctttctccatcaagagttacttaccaagg 3901 gcaggggaagggggatatagaggtcacaaggaaataaaaatcatctttcatctttaattt 3961 tactccttcctcttatttttttaaaagattatcgaacaataaaatcatttgcctttttaa 4021 ttaaaaaaaaaaaaaaaaaaaaa HumanCLCA2aminoacidsequenceNCBIRefNo:NP_006527 SEQIDNO:10 1 mtqrsiagpicnIkfvtllvalsselpflgagvqlqdngynglliainpqvpenqnlisn 61 ikemiteasfylfnatkrryffrnikilipatwkannnskikqesyekanvivtdwygah 121 gddpytlqyrgcgkegkyihftpnfllndnltagygsrgrvfvhewahlrwgvfdeynnd 181 kpfyingqnqikvtrcssditgifvcekgpcpqenciisklfkegctfiynstqnatasi 241 mfmqslssvvefcnasthnqeapnlqnqmcslrsawdvitdsadfhhsfpmngtelpppp 301 tfslvqagdkvvclvldvsskmaeadrllqlqqaaefylmqiveihtfvgiasfdskgei 361 raqlhqinsnddrkllvsylpttvsaktdisicsglkkgfevveklngkaygsvmilvts 421 gddkllgnclptvlssgstihsialgssaapnleelsrltgglldfvpdisnsnsmidaf 481 srissgtgdifqqhiqlestgenvkphhqlkntvtvdntvgndtmflvtwqasgppeiil 541 fdpdgrkyytnnfitnltfrtaslwipgtakpghwtytlnnthhslqalkvtvtsrasns 601 avppatveafverdslhfphpymiyanvkqgfypilnatvtatvepetgdpvtlrllddg 661 agadvikndgiysryffsfaangryslkvhvnhspsistpahsipgshamyvpgytangn 721 iqmnaprksvgrneeerkwgfsrvssggsfsvlgvpagphpdvfppckiidleavkveee 781 ltlswtapgedfdqgqatsyeirmskslqniqddfnnailvntskrnpqqagireiftfs 841 pqistngpehqpngetheshriyvairamdrnslqsavsniaqaplfippnsdpvpardy 901 lilkgvltamgligiicliivvthhtlsrkkradkkengtkll HumanROR cDNAsequenceNCBIRefNo:NM_001001523 SEQIDNO:11 1 agagagctaggtgcagagcttcaggctgaggcgctgctgagagggcctcgccccgcctct 61 gccgccagctgcaccccactcctggaccaccccctgctgagaaggacagggagccaaggc 121 cggcagagccaaggctcagtcatgagaacacaaattgaagtgatcccttgcaaaatctgt 181 ggggacaagtcgtctgggatccactacggggttatcacctgtgaggggtgcaagggcttc 241 ttccgccggagccagcgctgtaacgcggcctactcctgcacccgtcagcagaactgcccc 301 atcgaccgcaccagccgaaaccgatgccagcactgccgcctgcagaaatgcctggcgctg 361 ggcatgtcccgagatgctgtcaagttcggccgcatgtccaagaagcagagggacagcctg 421 catgcagaagtgcagaaacagctgcagcagcggcaacagcagcaacaggaaccagtggtc 481 aagacccctccagcaggggcccaaggagcagataccctcacctacaccttggggctccca 541 gacgggcagctgcccctgggctcctcgcctgacctgcctgaggcttctgcctgtccccct 601 ggcctcctgaaagcctcaggctctgggccctcatattccaacaacttggccaaggcaggg 661 ctcaatggggcctcatgccaccttgaatacagccctgagcggggcaaggctgagggcaga 721 gagagcttctatagcacaggcagccagctgacccctgaccgatgtggacttcgttttgag 781 gaacacaggcatcctgggcttggggaactgggacagggcccagacagctacggcagcccc 841 agtttccgcagcacaccggaggcaccctatgcctccctgacagagatagagcacctggtg 901 cagagcgtctgcaagtcctacagggagacatgccagctgcggctggaggacctgctgcgg 961 cagcgctccaacatcttctcccgggaggaagtgactggctaccagaggaagtccatgtgg 1021 gagatgtgggaacggtgtgcccaccacctcaccgaggccattcagtacgtggtggagttc 1081 gccaagaggctctcaggctttatggagctctgccagaatgaccagattgtgcttctcaaa 1141 gcaggagcaatggaagtggtgctggttaggatgtgccgggcctacaatgctgacaaccgc 1201 acggtcttttttgaaggcaaatacggtggcatggagctgttccgagccttgggctgcagc 1261 gagctcatcagctccatctttgacttctcccactccctaagtgccttgcacttttccgag 1321 gatgagattgccctctacacagcccttgttctcatcaatgcccatcggccagggctccaa 1381 gagaaaaggaaagtagaacagctgcagtacaatctggagctggcctttcatcatcatctc 1441 tgcaagactcatcgccaaagcatcctggcaaagctgccacccaaggggaagcttcggagc 1501 ctgtgtagccagcatgtggaaaggctgcagatcttccagcacctccaccccatcgtggtc 1561 caagccgctttccctccactctacaaggagctcttcagcactgaaaccgagtcacctgtg 1621 gggctgtccaagtgacctggaagagggactccttgcctctccctatggcctgctggccca 1681 cctccctggaccccgttccaccctcacccttttcctttcccatgaaccctggagggtggt 1741 ccccaccagctctttggaagtgagcagatgctgcggctggctttctgtcagcaggccggc 1801 ctggcagtgggacaatcgccagagggtggggctggcagaacaccatctccagcctcagct 1861 ttgacctgtctcatttcccatattccttcacacccagcttctggaaggcatggggtggct 1921 gggatttaaggacttctgggggaccaagacatcctcaagaaaacaggggcatccagggct 1981 ccctggatgaatagaatgcaattcattcagaagctcagaagctaagaataagcctttgaa 2041 atacctcattgcatttccctttgggcttcggcttggggagatggatcaagctcagagact 2101 ggcagtgagagcccagaaggacctgtataaaatgaatctggagctttacattttctgcct 2161 ctgccttcctcccagctcagcaaggaagtatttgggcaccctaccctttacctggggtct 2221 aaccaaaaatggatgggatgaggatgagaggctggagataattgttttatgggatttggg 2281 tgtgggactagggtacaatgaaggccaagagcatctcagacatagagttaaaactcaaac 2341 ctcttatgtgcactttaaagatagactttaggggctggcacaaatctgatcagagacaca 2401 tatccatacacaggtgaaacacatacagactcaacagcaatcatgcagttccagagacac 2461 atgaacctgacacaatctctcttatccttgaggccacagcttggaggagcctagaggcct 2521 caggggaaagtcccaatcctgagggaccctcccaaacatttccatggtgctccagtccac 2581 tgatcttgggtctggggtgatccaaataccaccccagctccagctgtcttctaccactag 2641 aagacccaagagaagcagaagtcgctcgcactggtcagtcggaaggcaagatcagatcct 2701 ggaggactttcctggcctgcccgccagccctgctcttgttgtggagaaggaagcagatgt 2761 gatcacatcaccccgtcattgggcaccgctgactccagcatggaggacaccagggagcag 2821 ggcctgggcctgtttccccagctgtgatcttgcccagaacctctcttggcttcataaaca 2881 gctgtgaaccctcccctgagggattaacagcaatgatgggcagtcgtggagttggggggg 2941 ttgggggtgggattgtgtcctctaaggggacgggttcatctgagtaaacataaaccccaa 3001 cttgtgccattctttataaaatgattttaaaggcaaaaaaaaaaaaaaaaaaaa HumanROR aminoacidsequenceNCBIRefNo:NP_001001523 SEQIDNO:12 1 mrtqievipckicgdkssgihygvitcegckgffrrsqrcnaaysctrqqncpidrtsrn 61 rcqhcrlqkclalgmsrdavkfgrmskkqrdslhaevqkqlqqrqqqqqepvvktppaga 121 qgadtltytlglpdgqlplgsspdlpeasacppgllkasgsgpsysnnlakaglngasch 181 leyspergkaegresfystgsqltpdrcglrfeehrhpglgelgqgpdsygspsfrstpe 241 apyaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwerca 301 hhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegk 361 yggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveq 421 lqynlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafppl 481 ykelfstetespvglsk HumanRORtcDNAsequenceNCBIRefNo:NM_005060 SEQIDNO:13 1 gccaggtgctcccgccttccaccctccgccctcctccctcccctgggccctgctccctgc 61 cctcctgggcagccagggcagccaggacggcaccaagggagctgccccatggacagggcc 121 ccacagagacagcaccgagcctcacgggagctgctggctgcaaagaagacccacacctca 181 caaattgaagtgatcccttgcaaaatctgtggggacaagtcgtctgggatccactacggg 241 gttatcacctgtgaggggtgcaagggcttcttccgccggagccagcgctgtaacgcggcc 301 tactcctgcacccgtcagcagaactgccccatcgaccgcaccagccgaaaccgatgccag 361 cactgccgcctgcagaaatgcctggcgctgggcatgtcccgagatgctgtcaagttcggc 421 cgcatgtccaagaagcagagggacagcctgcatgcagaagtgcagaaacagctgcagcag 481 cggcaacagcagcaacaggaaccagtggtcaagacccctccagcaggggcccaaggagca 541 gataccctcacctacaccttggggctcccagacgggcagctgcccctgggctcctcgcct 601 gacctgcctgaggcttctgcctgtccccctggcctcctgaaagcctcaggctctgggccc 661 tcatattccaacaacttggccaaggcagggctcaatggggcctcatgccaccttgaatac 721 agccctgagcggggcaaggctgagggcagagagagcttctatagcacaggcagccagctg 781 acccctgaccgatgtggacttcgttttgaggaacacaggcatcctgggcttggggaactg 841 ggacagggcccagacagctacggcagccccagtttccgcagcacaccggaggcaccctat 901 gcctccctgacagagatagagcacctggtgcagagcgtctgcaagtcctacagggagaca 961 tgccagctgcggctggaggacctgctgcggcagcgctccaacatcttctcccgggaggaa 1021 gtgactggctaccagaggaagtccatgtgggagatgtgggaacggtgtgcccaccacctc 1081 accgaggccattcagtacgtggtggagttcgccaagaggctctcaggctttatggagctc 1141 tgccagaatgaccagattgtgcttctcaaagcaggagcaatggaagtggtgctggttagg 1201 atgtgccgggcctacaatgctgacaaccgcacggtcttttttgaaggcaaatacggtggc 1261 atggagctgttccgagccttgggctgcagcgagctcatcagctccatctttgacttctcc 1321 cactccctaagtgccttgcacttttccgaggatgagattgccctctacacagcccttgtt 1381 ctcatcaatgcccatcggccagggctccaagagaaaaggaaagtagaacagctgcagtac 1441 aatctggagctggcctttcatcatcatctctgcaagactcatcgccaaagcatcctggca 1501 aagctgccacccaaggggaagcttcggagcctgtgtagccagcatgtggaaaggctgcag 1561 atcttccagcacctccaccccatcgtggtccaagccgctttccctccactctacaaggag 1621 ctcttcagcactgaaaccgagtcacctgtggggctgtccaagtgacctggaagagggact 1681 ccttgcctctccctatggcctgctggcccacctccctggaccccgttccaccctcaccct 1741 tttcctttcccatgaaccctggagggtggtccccaccagctctttggaagtgagcagatg 1801 ctgcggctggctttctgtcagcaggccggcctggcagtgggacaatcgccagagggtggg 1861 gctggcagaacaccatctccagcctcagctttgacctgtctcatttcccatattccttca 1921 cacccagcttctggaaggcatggggtggctgggatttaaggacttctgggggaccaagac 1981 atcctcaagaaaacaggggcatccagggctccctggatgaatagaatgcaattcattcag 2041 aagctcagaagctaagaataagcctttgaaatacctcattgcatttccctttgggcttcg 2101 gcttggggagatggatcaagctcagagactggcagtgagagcccagaaggacctgtataa 2161 aatgaatctggagctttacattttctgcctctgccttcctcccagctcagcaaggaagta 2221 tttgggcaccctaccctttacctggggtctaaccaaaaatggatgggatgaggatgagag 2281 gctggagataattgttttatgggatttgggtgtgggactagggtacaatgaaggccaaga 2341 gcatctcagacatagagttaaaactcaaacctcttatgtgcactttaaagatagacttta 2401 ggggctggcacaaatctgatcagagacacatatccatacacaggtgaaacacatacagac 2461 tcaacagcaatcatgcagttccagagacacatgaacctgacacaatctctcttatccttg 2521 aggccacagcttggaggagcctagaggcctcaggggaaagtcccaatcctgagggaccct 2581 cccaaacatttccatggtgctccagtccactgatcttgggtctggggtgatccaaatacc 2641 accccagctccagctgtcttctaccactagaagacccaagagaagcagaagtcgctcgca 2701 ctggtcagtcggaaggcaagatcagatcctggaggactttcctggcctgcccgccagccc 2761 tgctcttgttgtggagaaggaagcagatgtgatcacatcaccccgtcattgggcaccgct 2821 gactccagcatggaggacaccagggagcagggcctgggcctgtttccccagctgtgatct 2881 tgcccagaacctctcttggcttcataaacagctgtgaaccctcccctgagggattaacag 2941 caatgatgggcagtcgtggagttgggggggttgggggtgggattgtgtcctctaagggga 3001 cgggttcatctgagtaaacataaaccccaacttgtgccattctttataaaatgattttaa 3061 aggcaaaaaaaaaaaaaaaaaaaa HumanRORtaminoacidsequenceNCBIRefNo:NM_005051 SEQIDNO:14 1 mdrapqrqhrasrellaakkthtsqievipckicgdkssgihygvitcegckgffrrsqr 61 cnaaysctrqqncpidrtsrnrcqhcrlqkclalgmsrdavkfgrmskkqrdslhaevqk 121 qlqqrqqqqqepvvktppagaqgadtltytlglpdgqlplgsspdlpeasacppgllkas 181 gsgpsysnnlakaglngaschleyspergkaegresfystgsqltpdrcglrfeehrhpg 241 lgelgqgpdsygspsfrstpeapyaslteiehlvqsvcksyretcqlrledllrqrsnif 301 sreevtgyqrksmwemwercahhlteaiqyvvefakrlsgfmelcqndqivllkagamev 361 vlvrmcraynadnrtvffegkyggmelfralgcselissifdfshslsalhfsedeialy 421 talvlinahrpglqekrkveqlqynlelafhhhlckthrqsilaklppkgklrslcsqhv 481 erlqifqhlhpivvqaafpplykelfstetespvglsk KP-20aminoacidseqence SEQIDNO:15 FSRVKKSVEVLKNNKAPYFS KP-89aminoacidsequence SEQIDNO:16 SRRASVGFSRVKKSVEVLKNNKAPYFS TAXaminoacidsequence SEQIDNO17 1 hfpgfgqsllfgypvyvfgdcvqgdwcpisgglcsarlhrhallatcpehqitwdpidgr 61 vigsalqfliprlpsfptqrtsktlkvltppithttpnippsflqamrkyspfrngymep 121 tlgqhlptlsfpdpglrpqnlytlwggsvvcmylyqlsppitwpllphvifchpgqlgaf 181 ltnvpykrieellykislttgaliilpedclpttlfqparapvtltawqngllpfhstlt 241 tpgliwtftdgtpmisgpcpkdgqpslvlqsssfifhkfqtkayhpsfllshgliqyssf 301 hslhllfeeytnipisllfnekeaddndhepqispggleppsekhfretev