Chemically Activated Nanocapsid Functionalized for Cancer Targeting
20170107261 ยท 2017-04-20
Inventors
- R. Holland Cheng (Davis, CA, US)
- LI XING (DAVIS, CA, US)
- Chun Chieh Chen (Oakland, CA, US)
- MARIE STARK (DAVIS, CA, US)
Cpc classification
C12N2810/40
CHEMISTRY; METALLURGY
C12N2770/28142
CHEMISTRY; METALLURGY
C12N2770/28122
CHEMISTRY; METALLURGY
International classification
Abstract
Modified capsid proteins containing at least a portion of hepatitis E virus (HEV) open reading frame 2 (ORF2) having one or more cysteine residues in a surface variable loop or the C-terminus of HEV ORF2, or a portion thereof, are provided. The modified capsid proteins can be used to form hepatitis E virus (HEV) virus like particles (VLPs) having cysteine functional groups exposed on the outer-surface. The exposed cysteine functional groups can be modified via their thiol reactive group. For example, a bioactive agent, such as a cell-targeting ligand, can be conjugated to the one or more cysteines for targeted delivery of chemically activated nanocapsids.
Claims
1. A modified capsid protein comprising a portion of hepatitis E virus (HEV) open Reading Frame 2 (ORF2) protein that is able to form an acid and proteolytically stable HEV virus like particle (VLP), wherein: the portion of HEV ORF2 comprises a P-domain of the HEV ORF2 protein; the P-domain comprises at least one surface variable loop and a C-terminus; the P-domain comprises a cysteine in the at least one surface variable loop or at the C-terminus; and the HEV ORF2 portion retains its ability to form an acid and proteolytically stable HEV VLP when the surface variable loop or C-terminal cysteine is chemically derivatized.
2. The modified capsid protein of claim 1, wherein the HEV ORF2 portion retains its ability to form an acid and proteolytically stable HEV VLP when the surface variable loop or C-terminal cysteine is alkylated, agitated, arylated, succinylated, oxidized, or conjugated to a detectable label or bioactive agent.
3. The modified capsid protein of claim 1 or 2, wherein the modified capsid protein comprises an amino acid sequence at least 90%, 95%, or 99% identical, or identical, to residues 112-608 of the HEV ORF 2 protein of SEQ ID NO:1, 2, 3, 4, 5, or 6.
4. The modified capsid protein of claim 1 or 2, wherein the at least one P-domain surface variable loop or C-terminal cysteine is conjugated to a detectable label.
5. The modified capsid protein of claim 4, wherein the detectable label comprises a fluorophore, a superparamagnetic label, an MRI contrast agent, a positron emitting isotope, or a cluster of elements of group 3 through 18 having an atomic number greater than 20.
6. The modified capsid protein of claim 5, wherein the cluster of elements of group 3 through 18 having an atomic number greater than 20 comprises a gold nanocluster.
7. The modified capsid protein of claim 1 or 2, wherein the at least one P-domain domain surface variable loop or C-terminal cysteine is conjugated to a bioactive agent.
8. The modified capsid protein of claim 7, wherein the bioactive agent is a heterologous peptide.
9. The modified capsid protein of claim 8, wherein the heterologous peptide is a cell targeting ligand.
10. The modified capsid protein of claim 9, wherein the cell targeting ligand is a cancer cell targeting ligand.
11. The modified capsid protein of claim 10, wherein the cancer cell targeting ligand is LXY30.
12. The modified capsid protein of claim 10, wherein the cancer cell targeting ligand is an antibody that binds an antigen expressed on the surface of a cancer cell.
13. The modified capsid protein of claim 9 or 10, wherein the modified capsid protein further comprises a second cysteine in a P-domain surface variable loop or at the C-terminus of the P-domain.
14. The modified capsid protein of claim 13, wherein the second cysteine is conjugated to a chemotherapeutic.
15. The modified capsid protein of claim 13, wherein the second cysteine is conjugated to a detectable label.
16. The modified capsid protein of claim 15, wherein the detectable label conjugated to the second cysteine comprises a fluorophore, a superparamagnetic label, an MRI contrast agent, a positron emitting isotope, or a cluster of elements of group 3 through 18 having an atomic number greater than 20.
17. The modified capsid protein of claim 16, wherein the detectable label conjugated to the second cysteine comprising the cluster of elements of group 3 through 18 having an atomic number greater than 20 comprises a gold nanocluster.
18. The modified capsid protein of claim 1 or 2, wherein the at least one P-domain surface variable loop cysteine is alkylated, acylated, arylated, succinylated, or oxidized.
19. The modified capsid protein of claim 1 or 2, wherein the at least one P-domain surface variable loop cysteine of HEV ORF2 replaces Y485, T489, S533, N573, or T586 of HEV ORF2 or the C-terminal cysteine replaces residue 608 of HEV ORF2.
20. The modified capsid protein of any one of the previous claims, wherein the modified capsid protein is a component of an acid and proteolytically stable HEV VLP.
21. The modified capsid protein of claim 20, wherein the acid and proteolytically stable HEV VLP encapsulates a bioactive agent.
22. The modified capsid protein of claim 21, wherein the encapsulated bioactive agent is a heterologous nucleic acid, a heterologous peptide, a detectable label, a non-proteinogenic amino acid, an oligosaccharide, a synthetic macromolecule, or a chemotherapeutic.
23. The modified capsid protein of claim 22, wherein the encapsulated detectable label comprises a fluorophore, a superparamagnetic label, an MRI contrast agent, a positron emitting isotope, or a cluster of elements of group 3 through 18 having an atomic number greater than 20.
24. The modified capsid protein of claim 23, wherein the encapsulated detectable label comprising the cluster of elements of group 3 through 18 having an atomic number greater than 20 comprises a gold nanocluster.
25. A composition comprising the modified capsid protein of an one of the previous claims and a pharmaceutically acceptable excipient.
26. The composition of claim 25, wherein the composition comprises an HEV VLP having at least one cysteine within an HEV ORF2 P-domain surface variable loop or C-terminus that is chemically conjugated to a cell targeting ligand, a bioactive agent, or a detectable label.
27. A nucleic acid comprising a polynucleotide sequence encoding the modified capsid protein of any one of claims 1-24.
28. An expression cassette comprising a promoter operably linked to a polynucleotide sequence encoding the modified capsid protein of any one of claims 1-24.
29. A cell comprising the nucleic acid of claim 27 or the expression cassette of claim 28.
30. A cell comprising the modified capsid protein of any one of claims 1-24.
31. An organism comprising the modified capsid protein of any one of claims 1-24.
32. A method of producing a modified capsid protein comprising cultivating the cell of claim 29 under conditions suitable to permit expression of the modified capsid protein.
33. The method of claim 32 further comprising purifying the capsid protein.
34. The method of claim 33 further comprising derivatizing the at least one P-domain surface variable loop or C-terminal cysteine.
35. The method of claim 34, wherein the derivatizing comprises acylating, alkylating, arylating, succinylating, or oxidizing the P-domain surface variable loop or C-terminal cysteine.
36. The method of claim 34, wherein the derivatizing comprises conjugating a bioactive agent to the at least one P-domain surface variable loop or C-terminal cysteine.
37. A method of directing an HEV VLP to a target cell comprising contacting a cell with the HEV-VLP, wherein the HEV VLP comprises any one of the modified capsid proteins of claims 1-24, wherein the HEV VLP further comprises a cell targeting moiety having affinity for the target cell conjugated to the at least one P-domain surface variable loop or C-terminal cysteine.
38. The method of claim 37, wherein the HEV VLP further comprises a detectable label, and the method further comprises detecting the detectable label.
39. The method of claim 38, wherein the detecting the detectable label comprises detecting a fluorophore, a superparamagnetic label, an MRI contrast agent, a positron emitting isotope, or a cluster of elements of group 3 through 18 having an atomic number greater than 20.
40. The method of claim 39, wherein the detecting the cluster of elements of group 3 through 18 having an atomic number greater than 20 comprises detecting a gold nanocluster.
41. The method of claim 37, wherein the cell targeting moiety having affinity for the target cell conjugated to the at least one P-domain surface variable loop or C-terminal cysteine is a heterologous peptide comprising a cancer cell targeting ligand, and the target cell is a cancer cell.
42. The method of claim 41, wherein the HEV VLP or a component thereof enters the cancer cell.
43. The method of claim 37, wherein the HEV VLP encapsulates a bioactive agent, and the method comprises delivering the bioactive agent to the intracellular region of the cell.
44. The method of claim 43, wherein the encapsulated bioactive agent is a heterologous nucleic acid, a heterologous peptide, a detectable label, non-proteinogenic amino acid, an oligosaccharide, a synthetic macromolecule, or a chemotherapeutic.
45. The method of claim 44, wherein the encapsulated detectable label comprises a fluorophore, a superparamagnetic label, an MRI contrast agent, a positron emitting isotope, or a cluster of elements of group 3 through 8 having an atomic number greater than 20.
46. The method of claim 45, wherein the encapsulated cluster of elements of group 3 through 18 having an atomic number greater than 20 comprises an encapsulated gold nanocluster.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
DETAILED DESCRIPTION OF THE INVENTION
I. Definitions
[0029] As used in this specification and the appended claims, the singular forms a, an, and the include plural reference unless the context clearly dictates otherwise.
[0030] Hepatitis E virus or HEV refers to a virus, virus type, or virus class, which i) causes water-borne, infectious hepatitis; ii) is distinguished from hepatitis A virus (HAV), hepatitis B virus (HBV), hepatitis C virus (HCV), or hepatitis D virus (HDV) in terms of serological characteristics; and iii) contains a genomic region that is homologous to a 1.33 kb cDNA inserted in pTZKF1(ET1.1), a plasmid embodied in a E. coli strain deposited in American Type Culture Collection (ATCC) with accession number 67717.
[0031] The terms capsid protein and modified capsid protein, with reference to HEV, refer to a mature or modified (e.g., truncated, recombinantly mutated, or chemically derivatized) HEV open reading from 2 (ORF2) polypeptide. As used herein, reference to such ORF2 polypeptides or proteins is meant to include the full-length polypeptide, and fragments thereof, and also include any substitutions, deletions, or insertions or other modifications made to the ORF2 proteins. The capsid proteins must be capable of forming a virus like particle (VLP). Typically the capsid protein contains at least residues 112-608 of HEV ORF2, although the capsid protein can tolerate various additional substitutions, deletions, or insertions so long as they are tolerated without abrogating VLP formation.
[0032] In one embodiment, the term modified capsid protein refers to a capsid protein, or portion thereof, in which a surface variable loop of the P-domain of HEV ORF2 is modified to incorporate one or more cysteines that are not otherwise present in the wild-type capsid protein sequence. Alternatively, or additionally, the term modified capsid protein refers to a capsid protein, or portion thereof, in which the C-terminus (e.g., position 608) of HEV ORF2 is modified to incorporate one or more cysteines that are not otherwise present in the wild-type capsid protein sequence. Alternatively, or additionally, the term modified capsid protein refers to a capsid protein, or portion thereof, in which a cysteine (e.g., a cysteine of a surface variable loop of the P-domain of HEV ORF 2 or a cysteine recombinantly introduced at position 608) is chemically derivatized to covalently conjugate to the protein at least one heterologous atom or molecule. The cysteine can be inserted such that the HEV ORF2 protein length is increased, or the cysteine can replace one or more residues of a P-domain surface variable loop and/or C-terminus.
[0033] Generally, modified capsid proteins retain the ability to form HEV VLPs. In some cases, the one or more cysteines are conjugated to a bioactive agent (e.g., a cell-targeting ligand such as the peptide LXY30). P-domain surface variable loops include one or more of e.g., residues 475-493; residues 502-535; residues 539-569; residues 572-579; and residues 581-595 of HEV ORF 2 (SEQ ID NO:1, 2, 3, 4, 5, or 6). P-domain surface variable loops further include the residues of polypeptides comprising an amino acid sequence that is at least about 80%, 85%, 90%, 95%, 99%, or more identical to one or more of SEQ ID NOS:1, 2, 3, 4, 5, or 6 and that correspond to one or more of residues 475-493; residues 502-535; residues 539-569; residues 572-579; and residues 581-595 of SEQ ID NOS:1, 2, 3, 4, 5, or 6.
[0034] As used herein, the term virus-like particle (VLP) refers to an icosahedral shell (e.g., T1 or T3) formed by a capsid protein. VLPs are not infectious due to the lack of a viral genome. VLP refers to a nonreplicating icosahedral viral shell, derived from hepatitis E virus capsid protein HEV ORF2, a portion thereof VLPs can form spontaneously upon recombinant expression of the protein in an appropriate expression system. In some embodiments, the VLP is formed from a modified capsid protein, e.g., a capsid protein containing one or more cysteine residues in a surface variable loop of HEV ORF2, or a portion thereof. An HEV VLP can contain a mixture of modified and/or unmodified HEV ORF2 proteins.
[0035] The term acid and proteolytically stable in the context of an HEV VLP refers to an HEV VLP that is resistant to the acid and proteolytic environments of a mammalian digestive system. Methods of assessing acid and proteolytic stability are described in Jariyapong et al., 2013, and include, but are not limited to subjecting an HEV VLP to an acid (e.g., pH of, or of about, 6, 5.5, 5, 4.5, 4, 3.5, 3, 2,5, or 2) and/or proteolytic environment trypsin and/or pepsin) and examining the contacted HEV VLP by electron microscopy, gel filtration chromatography, or other suitable method to determine whether the quaternary structure (e.g., T=1, T=3, icosahedron, dodecahedron, etc.) of the HEV VLP is retained. A population of HEV VLPs (e.g., modified or unmodified) can be incubated under acid and/or proteolytic conditions for a suitable period of time (e.g., for at least, or for at least about, 1, 2, 3, 4, 5, 10, 15, 20, 30, 45, or 60 minutes) and then tested to determine the extent of quaternary structure retention. In this context, an acid and proteolytically stable modified. HEV VLP refers to a modified HEV VLP that when incubated as a population of VLPs under acid and/or proteolytic conditions and assayed by electron microscopy, at least 10%, 25%, 50%, 75%, 90%, 95%, 99%, or 100% of the VLPs of the population retain their quaternary structure.
[0036] Alternatively, the HEV VLP can be delivered to a subject via an oral route and the efficiency of delivery assessed by detecting and/or quantifying: (i) an immune response to an antigen within the HEV VLP; (ii) a detectable label conjugated to, recombinantly introduced into, or encapsulated by the HEV VLP; or (iii) a biological response due to delivery to a cell of a bioactive agent associated with (e.g., recombinantly introduced into, conjugated to, or encapsulated by) the HEV VLP. In this context, an acid and proteolytically stable modified HEV VLP refers to a modified HEV VLP that retains at least 10%, 25%, 50%, 75%, 90%, 95%, 99%, or 100% of the oral delivery efficacy and/or cell entry activity of an unmodified HEV VLP.
[0037] The term heterologous as used in the context of describing the relative location of two elements, refers to the two elements such as nucleic acids (e.g., promoter or protein encoding sequence) or proteins (e.g., an HEV ORF2 protein, or portion thereof, or modified capsid protein and another protein) that are not naturally found in the same relative positions. Thus, a heterologous promoter of a gene refers to a promoter that is not naturally operably linked to that gene.
[0038] Hepatitis E virus (HEV) is known to cause severe acute liver failure. HEV belongs to the genus Hepevirus in the family Hepeviridae. HEV contains a single-stranded positive-sense RNA molecule of approximately 7.2-kb. The RNA is 3 polyadenylated and includes three open reading frames (ORF). ORF1 encodes viral nonstructural proteins, located in the 5 half of the genome. ORF2 encodes a protein-forming viral capsid, located at the 3 terminus of the genome. ORF3 encodes a 13.5-kDa protein, overlapped with C-terminus of ORF1 and N-terminus of ORF2. ORF3 is associated with the membrane as well as with the cytoskeleton fraction.
[0039] The term encapsulation, or encapsulated, as used herein refers to the envelopment of a heterologous substance, such as a heterologous nucleic acid or protein, a chemotherapeutic, an imaging agent, a ferrite nanoparticle etc., within the VLPs defined herein.
[0040] The term bioactive agent refers to any agent, drug, compound, or mixture thereof that targets a specific biological location (targeting agent) and/or provides some local or systemic physiological or pharmacologic effect that can be demonstrated in vivo or in vitro. Non-limiting examples include drugs, hormones, vaccines, antibodies, antibody fragments, vitamins and co factors, polysaccharides, carbohydrates, steroids, lipids, fats, proteins, peptides, polypeptides, nucleotides, oligonucleotides, polynucleotides, and nucleic acids (e.g., mRNA, tRNA, snRNA, RNAi, DNA, cDNA, antisense constructs, ribozymes, etc.).
[0041] A pharmaceutically acceptable or pharmacologically acceptable material is one that is not biologically harmful or otherwise undesirable, i.e., the material may be administered to an individual along with the capsid protein or the HEV VLPs or the compositions of the present invention without causing any undesirable biological effects. Neither would the material interact in a deleterious manner with any of the components of the composition in which it is contained.
[0042] The term excipient refers to any essentially accessory substance that may be present in the finished dosage form of the composition of this invention. For example, the term excipient includes vehicles, binders, disintegrants, fillers (diluents), lubricants, glidants (flow enhancers), compression aids, colors, sweeteners, preservatives, suspending/dispersing agents, film formers/coatings, flavors and printing inks.
[0043] The term adjuvant refers to a compound that, when administered in conjunction with an antigen, augments the immune response to the antigen, but does not generate an immune response to the antigen when administered alone. Adjuvants can augment an immune response by several mechanism including lymphocyte recruitment, stimulation of B and/or T cells, and stimulation of macrophages.
[0044] An immunogenic response to an antigen or composition is the development in a subject of a humoral and/or a cellular immune response to an antigen present in the composition of interest. For purposes of the present disclosure, a humoral immune response refers to an immune response mediated by antibody molecules, while a cellular immune response is one mediated by T-lymphocytes and/or other white blood cells. One important aspect of cellular immunity involves an antigen-specific response by cytolytic T-cells (CTLs). CTLs have specificity for peptide antigens that are presented in association with proteins encoded by the major histocompatibility complex (MHC) and expressed on the surfaces of cells. CTLs help induce and promote the destruction of intracellular microbes, or the lysis of cells infected with such microbes. Another aspect of cellular immunity involves an antigen-specific response by helper T-cells. Helper T-cells act to help stimulate the function, and focus the activity of, nonspecific effector cells against cells displaying peptide antigens in association with MHC molecules on their surface. A cellular immune response also refers to the production of cytokines, chemokines and other such molecules produced by activated T-cells and/or other white blood cells, including those derived from CD4+ and CD8+ T-cells. Hence, an immunological response may include one or more of the following effects: the production of antibodies by B-cells; and/or the activation of suppressor T-cells and/or T-cells directed specifically to an antigen or antigens present in the composition or vaccine of interest. These responses may serve to neutralize infectivity, and/or mediate antibody-complement, or antibody dependent cell cytotoxicity (ADCC) to provide protection to an immunized host. Such responses can be determined using standard immunoassays and neutralization assays, well known in the art.
[0045] As used herein, the term host refers to humans as well as other animals.
[0046] The term mucosal delivery relates to delivery of a composition to a mucous membrane, such as the mucosa of the gastro-intestinal tract (e.g., the buccal or labial mucosa) or the mucosa of the respiratory tract (e.g., the nasal mucosa).
II. Production and Purification of Modified Capsid Proteins and VLP Formation
[0047] One aspect of the invention relates to methods for production and purification of capsid proteins and VLPs derived therefrom (See, Expression and self-assembly of empty virus-like particles of hepatitis E virus. Li T C, Yamakawa Y, Suzuki K, Tatsumi M, Razak M A, Uchida I, Takeda N, Miyamura T., J Virol. 1997 October; 71(10):7207-13. Essential elements of the capsid protein for self-assembly into empty virus-like particles of hepatitis E virus. Li T C, Takeda N, Miyamura T, Matsuura Y, Wang J C, Engvall H, Hammar L, Xing L, Cheng R H. J Virol. 2005 October; 79(20):12999-3006. Niikura M et al, Chimeric recombinant hepatitis E virus-like particles as an oral vaccine vehicle presenting foreign epitopes. Virology 2002; 293: 273-280). In one embodiment, the capsid proteins are modified capsid proteins and the VLPs derived therefrom are cysteine modified HEV VLPs. For example, the modified capsid proteins contain one or more cysteine residues in a surface variable loop of HEV ORF2, or a portion thereof.
[0048] Various expression systems can be used to express the capsid proteins of the present invention. Examples of expression systems useful for the production of virus-like particles of the present invention include, but are not limited to, bacterial expression system (e.g., Escherichia coli), insect cells, yeast cells and mammalian cells. Preferred expression system of the present invention includes baculovirus expression systems using insect cells. General methods, for example, for handling and preparing baculovirus vectors and baculoviral DNA, as well as insect cell culture procedures, are outlined in A Manual of Methods for Baculovirus Vectors and Insect Cell Culture Procedures.
[0049] The capsid proteins of the present invention can be cloned into the baculovirus vector, and used to infect appropriate host cells (see, for example, O'Reilly et al., Baculovirus Expression Vectors: A Lab Manual, Freeman & Co. 1992.). An insect cell (e.g., Sf9 or Tn5) can be transformed with a transfer vector containing polynucleic acids which encodes the capsid proteins of the invention. The transfer vector includes, for example, linearized baculovirus DNA and a plasmid containing the desired polynucleotides. The host cell line may be co-transfected with the linearized baculovirus DNA and a plasmid order to make a recombinant baculovirus.
[0050] Purification of the virus-like particles of the present invention can be carried out according to the standard technique in the art (See, Li T C, et al., J Virol. 1997 October; 71(10):7207-13. Li T C, et al., J. Virol. 2005 October; 79(20):12999-3006. Niikura M et al, Virology 2002; 293: 273-280). The purified VLPs are then resuspended in a suitable buffer.
[0051] In some embodiments, the modified capsid proteins or VLPs derived therefrom can be chemically conjugated to one or more bioactive agents. For example, one or more cysteine residues of the capsid proteins can be acylated, alkylated, arylated, succinylated, or oxidized using methods known in the art. In some cases, the one or more cysteine residues can be conjugated using a maleimide functional group to covalently conjugate a bioactive agent to the thiol moiety of the cysteine. In some cases, the bioactive agent can be modified to introduce a maleimide functional group using CLICK chemistry. For example, an alkyne derivative of the bioactive agent can be contacted with a maleimide-azide in the presence of CuSO.sub.4 and ascorbic acid to produce a maleimide bioactive agent. The maleimide can then be contacted with the one or more cysteines of the modified capsid protein to covalently link the two molecules. In some cases, the conjugating is performed on capsid protein that is not assembled into a VLP (e.g., in the presence of EDTA, EGTA, and/or a reducing agent such as DTT or betamercaptoethanol). In some cases, the conjugating is performed on capsid protein that is assembled into a VLP.
III. Encapsulation of Bioactive Agents
[0052] Another aspect of the invention relates to the encapsulation of one or more bioactive agents in HEV virus-like particles (e.g., cysteine modified HEV VLPs) (See, DNA vaccine-encapsulated virus-like particles derived from an orally transmissible virus stimulate mucosal and systemic immune responses by oral administration., Gene Therapy 2004. 11, 628-635. S Takamura, M Niikura, T-C Li, N Takeda, S Kusagawa, Y Takebe, T Miyamura and Y Yasutomi). Any standard technique in the art can be used to encapsulate a heterologous nucleic acid, protein, polypeptide, chemotherapeutic, imaging agent, nanoparticle, etc. into the VLPs of the present invention. The general procedure involves (1) disassembling the VLPs formed by the capsid protein according to the present invention; and (2) reconstructing the VLPs in the presence of the bioactive agent. A skilled artisan would recognize that it is preferred to have purified VLPs before the encapsulation procedure. It is particularly preferred to have the VLPs depleted of or substantially depleted of, any undesired materials (e.g., nucleic acids) before the encapsulation procedure.
[0053] Disassembly of VLPs can be carried out using any standard technique in the art, Reconstituted virus-like particle can be produced under physiological conditions (See, US Patent Publication No.: 20080131928). Often, disassembly of virus-like particles requires an agent to disrupt the assembly of VLPs, such as a reducing agent or a chelating agent (See, US Patent Publication No.: 20040152181). A skilled artisan would recognize that factors and conditions that affect assembly and disassembly include: pH, ionic strength, posttranslational modifications of viral capsid proteins, disulfide bonds, and divalent cation bonding, among others. For example, the importance of cation bonding, specifically calcium, in maintaining virion integrity has been shown for polyomavirus (Brady et al., J. Virol, 23:717-724, 1977), and rotovirus (Gajardo et al., J. Virol, 71:2211-2216, 1997). Also, disulfide bonds appear to be significant for stabilizing polyomavirus (Walter et al., Cold Spring Har Symp. Quant. 39:255-257, 1975; Brady et al., J. Virol, 23:717-724, 1977); and SV40 viruses (Christansen et al., J. Virol, 21:1079-1084, 1977). Also, it is known that factors such as pH and ionic strength influence polyomavirus capsid stability, presumably by affecting electrostatic interactions (Brady et al., J. Virol, 23:717-724, 1977; Salunke et al., Cell, 46:895-904, 1986; Salunke et al., Biophys. J, 56:887-900, 1980). Also, it is known that post-translational modifications of some viral capsid proteins may affect capsid stability and assembly, e.g., glycosylation, phosphorylation, and acetylation (Garcea et al., Proc. Natl. Acad. Sci. USA, 80:3613-3617, 1983; Xi et al., J. Gen. Virol, 72:2981-2988, 1991). Thus, there are numerous interrelated factors which may affect capsid stability, assembly and disassembly.
[0054] Preferably, the VLPs of the present invention is disassembled by the removal of calcium ions (See, Touze A, Coursaget P. In vitro gene transfer using human papillomavirus-like particles. Nucleic Acids Res 1998; 26:1317-1323; Takamura et al., DNA vaccine-encapsulated virus-like particles derived from an orally transmissible virus stimulate mucosal and systemic immune responses by oral administration. Gene Therapy 2004; 11:628-635). According to the present invention, a reducing agent or a chelating agent or both are used to disassemble the VLPs. Various reducing agents can be used. Preferred embodiments of the reducing agents include, but are not limited to, dithiothreitol (DTT). Various chelating agents can be used, e.g., ethylene glycol tetraacetic acid (EGTA) or ethylenediaminetetracid acid (EDTA). Examples of VLP disassembly conditions include, but are not limited to, the following: purified VLPs were disrupted by incubation of a buffer containing 50 mM Tris-HCl (pH 7.5), 150 mM NaCl, 1 mM EGTA and 20 mM dithiothreitol for 30 minutes.
[0055] A skilled artisan would also recognize that complete disassembly of the VLPs is not required, although preferred, to encapsulate a bioactive agent. An artisan would also recognize that, on other occasions, it is preferred to have partial disassembly of the VLPs. According to the present invention, the conditions for the partial disassembly of the VLPs can be controlled to still allow efficient encapsulation of a bioactive agent. Partial disassembly of the VLPs can be achieved by treatment of VLPs with reducing agents alone (e.g., 20 mM DTT) (Sapp et al, J. Gen. Virol., 76:2407-2412, 1995.). According to the present invention, once the VLPs are disassembled completely or partially, encapsulation of a bioactive agent can be carried out by reassembling the VLPs in the presence of the bioactive agent. In some cases, it can be advantageous to utilize a bioactive agent having a net negative charge to enhance encapsulation. For example, nucleic acids have a net negative charge and can be preferentially encapsulated as compared to compounds that have a positive or neutral charge.
[0056] In some embodiments of the present invention, reassembly of the VLPs is achieved by re-supplementation of calcium ions to the disrupted VLPs. Alternatively, reassembly of the VLPs is achieved by removal of the reducing agents or the chelating agents. Optionally, factors such as pH and ionic strength, other factors described in the present invention, can be adjusted to achieve efficient reassembly of the VLPs and efficient encapsulation of the bioactive agent.
[0057] In some embodiments, encapsulation is performed as follows: Following 30 min of incubation at room temperature, a bioactive agent in 50 mM Tris-HCl buffer (pH 7.5) and 150 mM NaCl is added to the disrupted VLP preparation. The disrupted VLP preparation is then refolded by incubation for 1 h with increasing concentrations of CaCl.sub.2 up to a final concentration of 5 mM. VLPs are pelleted by ultracentrifugation and resuspended in 10 mM potassium-MES buffer (pH 6.2). To estimate the amounts of encapsulated agent, refolded and purified VLPs are purified from any unencapsulated bioactive agent and disrupted with EGTA (1 mM). Absorbance of the supernatant, or other suitable methods can be used for detection of the bioactive agent.
[0058] In some embodiments, the bioactive agent or imaging agent to be encapsulated is conjugated to an encapsidation signal. For example, an RNA element corresponding to codons 35-59 of HEV open reading frame 1 is a powerful encapsidation signal, allowing specific interaction in vitro with HEV capsid protein, including truncated and/or cysteine modified versions of HEV ORF2 VLP as described herein. To use VLP as a carrier for therapeutic or imaging agents, chemical linkers (e.g., LC-SPDP or aptamer, telodendrimers) that tag the agent (e.g., chemotherapeutic) with an HEV encapsidation signal like the foregoing RNA element can be used prior to the capsid self-assembly.
[0059] In some embodiments, a detectable label (imaging agent) is encapsulated. The detectable label can be a moiety renders a molecule to which it is attached to detectable by a variety of mechanisms including chemical, enzymatic, immunological, or radiological means. Some examples of detectable labels include fluorescent molecules (such as fluorescein, rhodamine, Texas Red, and phycoerythrin) and enzyme molecules (such as horseradish peroxidase, alkaline phosphatase, and galactosidase) that allow detection based on fluorescence emission or a product of a chemical reaction catalyzed by the enzyme. Radioactive labels involving various isotopes, such as 3H, 125I, 35S, 14C, or 32P, can also be attached to appropriate molecules to enable detection by any suitable methods that registers radioactivity, such as autoradiography. See, e.g., Tijssen, Practice and Theory of Enzyme Immunoassays, Laboratory Techniques in Biochemistry and Molecular Biology, Burdon and van Knippenberg Eds., Elsevier (1985), pp. 9 20. An introduction to labels, labeling procedures, and detection of labels can also be found in Polak and Van Noorden, Introduction Immunocytochemistry, 2d Ed., Springer Verlag, NY (1997); and in Haugland, Handbook of Fluorescent Probes and Research Chemicals, a combined handbook and catalogue published by Molecular Probes, Inc. (1996). Further detectable labels include, but are not limited to, superparamagnetic labels (e.g., ferrite), contrast enhancing reagents e.g., MRI contrast agents), atom-clusters (e.g., gold clusters), and the like.
[0060] In some embodiments, a bioactive agent is encapsulated. In some cases, the bioactive agent is a chemotherapeutic. Suitable chemotherapeutics include, but are not limited to, cytotoxic drugs. Examples of cytotoxic drugs which may be used in the present invention include: alkylating drugs, such as cyclophosphamide, ifospfamide, chlorambucil, melphalan, busulfan, lomustine, carmustine, chlormethhine (mustine), estramustine, treosulfan, thiotepa, mitobronitol; cytotoxic antibiotics, such as doxorubicin, epirubicin, aclarubicin, idarubicin, daunorubicin, mitoxantrone (mitozantrone), bleomycin, dactinomycin and mitomycin; antimetabolites, such as methotrexate, capecitabine; cytarabine, fludarabine, ibine, gemcitabine, fluorouracil, raititrexed (tomudex), mercaptopurine, tegafur and tioguaninc; vinca alkaloids, such as vinblastine, vincristine, vindesine, vinorelbine and etoposide; other neoplastic drugs, such as amsacrine, altetarmine, crisantaspase, dacarbazine and temozolomide, hydroxycarbamide (hydroxyurea), pentostatin, platinum compounds including: carboplatin, cisplatin and oxaliplatin, porfimer sodium, procarbazine, razoxane; taxanes including: docetaxel and paclitaxel; topoisomerase I inhibitors including inotecan and topotecan, trastuzumab, and tretinoin. In some cases, one or more of the foregoing imaging agents and/or bioactive agents, or a combination thereof, can additionally or alternatively be conjugated to a cysteine (e.g., recombinantly introduced cysteine) in a P-domain surface variable loop or C-terminus via a thiol linkage. In some cases, one or more of the foregoing imaging agents and/or bioactive agents, or a combination thereof, can additionally or alternatively be conjugated to a second cysteine (e.g., recombinantly introduced cysteine) in a P-domain surface variable loop or C-terminus via a thiol linkage.
[0061] The size of the VLPs can vary when different constructs of the capsid protein are used. For example, the N-terminal portion of the capsid protein can be adjusted to increase or decrease the size and encapsulation capacity of the VLPs. In some embodiments of the invention, in constructing the HEV VLP, a portion of HEV ORF 3 protein fused to the N-terminal of a portion of HEV ORF 2 proteins is utilized to adjust the size of the VLPs. Typically, the HEV VLP is formed from a portion of HEV ORF2 having at least residues 112-608 of HEV ORF 2.
IV. Pharmaceutical Compositions, Formulations and Administration
[0062] The present invention also provides pharmaceutical compositions or physiological compositions comprising a cysteine modified HEV VLP formed by the capsid protein of the present invention. Such pharmaceutical or physiological compositions also include one or more pharmaceutically or physiologically acceptable excipients or carriers. Pharmaceutical compositions of the invention are suitable for use in a variety of drug delivery systems. Suitable formulations for use in the present invention are found in Remington's Pharmaceutical Sciences, Mack Publishing Company, Philadelphia, Pa., 17th ed. (1985). For a brief review of methods for drug delivery. See Langer, Science 249: 1527-1533 (1990).
[0063] The compositions of the present invention can be administered to a host with an excipient. Excipients useful for the present invention include, but are not limited to, vehicles, binders, disintegrants, fillers (diluents), lubricants, glidants (flow enhancers), compression aids, colors, sweeteners, preservatives, suspending/dispersing agents, film formers/coatings, flavors and printing inks.
[0064] Various adjuvants can be used to increase the immunological response, depending on the host species, and include but are not limited to, Freund's (complete and incomplete), mineral gels such as aluminum hydroxide, surface active substances such as lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, keyhole limpet hemocyanins, dinitrophenol, and potentially useful human adjuvants such as BCG (bacille Calmette Guerin) and Corynebacterium parvum. Such adjuvants are also well known in the art. Further adjuvants that can be administered with the compositions of the invention include, but are not limited to, Monophosphoryl immunomodulator, AdjuVax 100a, QS 21, QS 18, CRL1005, Aluminum salts, ME 59, and Virosomal adjuvant technology. The adjuvants can also comprise a mixture of these substances.
[0065] One advantage of the compositions and methods of the present invention is that the compositions of the present invention can be administered to stimulate immune response without an adjuvant. Therefore, the compositions of the present invention are in some cases administered to a host without an adjuvant.
[0066] Another advantage of the present invention is that the compositions of the present invention are suitable for oral delivery. Because mucosa surfaces are inter-connected, stimulation of one mucosal surface by an antigen can induce mucosal immunity not only on the directly stimulated surface, but also on the distant ones. For example, oral delivery of the compositions of the present invention can protect against respiratory and genital-urinary infections. The compositions of the present invention are also suitable for mucosal delivery, such as delivery to the buccal or labial mucosa or the respiratory tract mucosa, including the nasal mucosa.
[0067] The pharmaceutical compositions of the present invention can be administered by various routes, e.g., oral, subcutaneous, transderrnal, intradermal, intramuscular, intravenous, or intraperitoneal. The preferred routes of administering the pharmaceutical compositions are oral delivery at daily doses of about 0.01-5000 mg, preferably 5-500 mg. The appropriate dose may be administered in a single daily dose or as divided doses presented at appropriate intervals, for example as two, three, four, or more subdoses per day.
[0068] For preparing pharmaceutical compositions of the present invention, inert and pharmaceutically acceptable carriers are used. The pharmaceutical carrier can be either solid or liquid. Solid form preparations include, for example, powders, tablets, dispersible granules, capsules, cachets, and suppositories. A solid carrier can be one or more substances that can also act as diluents, flavoring agents, solubilizers, lubricants, suspending agents, binders, or tablet disintegrating agents; it can also be an encapsulating material.
[0069] In powders, the carrier is generally a finely divided solid that is in a mixture with the finely divided active component, e.g., a chimeric virus-like particles with an encapsulated nucleic acid. in tablets, the active ingredient (a chimeric virus-like particles with an encapsulated nucleic acid) is mixed with the carrier having the necessary binding properties in suitable proportions and compacted in the shape and size desired.
[0070] For preparing pharmaceutical compositions in the form of suppositories, a low-melting wax such as a mixture of fatty acid glycerides and cocoa butter is first melted and the active ingredient is dispersed therein by, for example, stirring. The molten homogeneous mixture is then poured into convenient-sized molds and allowed to cool and solidify.
[0071] Powders and tablets preferably contain between about 5% to about 70% by weight of the active ingredient. Suitable carriers include, for example, magnesium carbonate, magnesium stearate, talc, lactose, sugar, pectin, dextrin, starch, tragacanth, methyl cellulose, sodium carboxymethyl cellulose, a low-melting wax, cocoa butter, and the like.
[0072] The pharmaceutical compositions can include the formulation of the active compound with encapsulating material as a carrier providing a capsule in which the active component (with or without other carriers) is surrounded by the carrier, such that the carrier is thus in association with the compound. In a similar manner, cachets can also be included. Tablets, powders, cachets, and capsules can be used as solid dosage forms suitable for oral administration.
[0073] Liquid pharmaceutical compositions include, for example, solutions suitable for oral or parenteral administration, suspensions, and emulsions suitable for oral administration. Sterile water solutions of the active component (e.g., a chimeric virus-like particles with an encapsulated nucleic acid) or sterile solutions of the active component in solvents comprising water, buffered water, saline, PBS, ethanol, or propylene glycol are examples of liquid compositions suitable for parenteral administration. The compositions may contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions, such as pH adjusting and buffering agents, tonicity adjusting agents, wetting agents, detergents, and the like.
[0074] Sterile solutions can be prepared by suspending the active component (e.g., a chimeric virus-like particles with an encapsulated nucleic acid) in the desired solvent system, and then passing the resulting solution through a membrane filter to sterilize it or, alternatively, by dissolving the sterile compound in a previously sterilized solvent under sterile conditions. The resulting aqueous solutions may be packaged for use as is, or lyophilized, the lyophilized preparation being combined with a sterile aqueous carrier prior to administration. The pH of the preparations typically will be between 3 and 9, more preferably from 5 to 8, and most preferably from 6 to 7.
[0075] The pharmaceutical compositions of the present invention can be administered for prophylactic and/or therapeutic treatments. In therapeutic applications, compositions are administered to a patient already suffering from a condition in an amount sufficient to prevent, cure, reverse, or at least partially slow or arrest the symptoms of the condition and its complications. An amount adequate to accomplish this is defined as a therapeutically effective dose. Amounts effective for this use will depend on the severity of the disease or condition and the weight and general state of the patient, but generally range from about 0.1 mg to about 2,000 mg of the composition per day for a 70 kg patient, with dosages of from about 5 mg to about 500 mg of the composition per day for a 70 kg patient being more commonly used.
[0076] In prophylactic applications, pharmaceutical compositions of the present invention are administered to a patient susceptible to or otherwise at risk of developing a disease or condition, in an amount sufficient to delay or prevent the onset of the symptoms. Such an amount is defined to be a prophylactically effective dose. In this use, the precise amounts of the composition again depend on the patient's state of health and weight, but generally range from about 0.1 mg to about 2,000 mg of the inhibitor for a 70 kg patient per day, more commonly from about 5 mg to about 500 mg for a 70 kg patient per day.
[0077] Single or multiple administrations of the compositions can be carried out with dose levels and pattern being selected by the treating physician. In any event, the pharmaceutical formulations should provide a quantity of composition of the present invention sufficient to effectively stimulate immune response in the patient, either therapeutically or prophylatically.
[0078] All patents, patent applications, and other publications, including GenBank Accession Numbers, cited in this application are incorporated by reference in the entirety for all purposes.
V. EXAMPLES
[0079] The following examples are provided by way of illustration only and not by way of limitation. Those of skill in the art will readily recognize a variety of non-critical parameters that could be changed or modified to yield essentially the same or similar results.
Example 1
Chemically Activatable Viral Capsid Functionalized for Cancer Targeting
Introduction
[0080] Virus-like particles (VLPs) have been proposed for use as nanocarriers to display foreign epitopes and/or deliver small molecules, a method for combating many diseases..sup.1 This application relies mainly on the property of self-assembly as well as the ease of genetic modifications, to fulfill the designed application for the given VLP. Compared to genetic engineering, chemical conjugation of foreign peptides to VLP displays a significant advantage because it allows a great variety of entities, such as peptide or oligosaccharide, to be conjugated to the surface of virus like particles in modulated and flexible manner without alteration of VLP assembly.
[0081] Hepatitis E virus (HEV) is composed of a non-enveloped icosahedral capsid, enclosing a single stranded RNA genome of 7.2 kilo bases. The major capsid protein is encoded by the second open reading frame (ORF2) and is essential not only for virus assembly, but also for immunogenicity and host interaction..sup.6 The recombinant capsid protein (PORF2) is able to self-assemble into VLPs when expressed in insect cells after deletion of 111 amino acids from the N-terminal end and 52 amino acids from the C-terminal end. PORF2 folds into three domains: S (shell; amino acids 118-317), M (middle; amino acids 318-451) and P (protruding; amino acids 452-606)..sup.9-11 Recombinant HEV-VLPs consists of 60 copies of PORF2, in which the S-domain possesses typical eight anti-parallel folding and stabilizes icosahedral shell and the P-domain protrudes as a surface spike that contributes greatly to HEV antigenicity. With three-domain modularity, HEV-VLP can be readily manipulated to, e.g., alter antigenicity, reduce the size from a T3 icosahedral particle to a T1 icosahedral particle, and/or modify the sequence at the P-domain without interfering, with HEV-VLP assembly.
[0082] Like the native virus, HEV-VLP can be stable in acidic environment.sup.15 and resistant to proteolytic digestion,.sup.13 thus it poses a great advantage as an oral delivery vehicle. In fact, oral administration of HEV-VLP elicits both systemic and mucosal immunity without eliciting tolerance, and thus can provide protective immunity against HEV challenge in non-human primates.sup.16 Chimeric VLPs carrying a foreign epitope are able to elicit mucosal and systemic antibodies against both HEV and the foreign epitope after oral administration..sup.14 Importantly, HEV-VLP can orally deliver plasmid DNA to the epithelial cells of the small intestine and induce antibody and cytotoxic T lymphocyte (CTL) responses against the plasmid encoded antigen..sup.17 All of these studies have established the feasibility of utilizing HEV-VLP for mucosal delivery, in a route resembling virus native transmission.
[0083] Cancer theranostics requires direct contact of drug with pathological foci; therefore, a capsule carrying specific ligands is preferential for targeted delivery of anti-cancer reagents. Current delivery system based on liposome and/or organic polymers such as polyethylene glycol gives feasible yet low specificity cancer cell targeting. In this study, we created an HEV-VLP based theranostic capsule whose entry specificity can be defined by the VLP-conjugated targeting ligand. The modified HEV-VLP after conjugation with LXY30, a ligand peptide with a high affinity for human malignant breast tumor cells,.sup.18 showed specific targeting to breast tumor cell both in vitro and in vivo, indicating that delivery route of virus-like particle can be manipulated to facilitate targeted delivery of chemotherapeutic drugs or siRNA to pathologic foci.
Results
[0084] Cysteine Replacement at the Surface Loops of the P-Domain
[0085] Alkylation and acylation are the two traditional bioconjugation methods that are used to covalently modify virus particles by attaching a ligand at amine group of lysine or thiol group on cysteine, respectively. HEV ORF2 naturally has four lysine residues that are exposed on the surface of the P-domain. An external ligand will randomly couple with one or more of the four lysine residues. In order to avoid this random coupling, it was decided to genetically introduce a cysteine replacement to the surface of the P-domain, which allowed acylation to be used to site-specifically anchor the external ligand, while alkylation was used for conjugation of a fluorescent dye to surface lysine residues.
[0086] Five sites for cysteine replacement from the surface variable loops of the P-domain were selected based on the known structure of HEV-VLP (
[0087] Chimeric N573C VLP do not React with HEV Antibody
[0088] Because the P-domain carries the antigenic structure of HEV, sequence mutation may alter the immunoreactivity of HEV antibodies against the obtained chimeric VLPs. In order to get an insight into the antigenicity of the chimeric VLPs, the antigenicity of the chimeric N573C VLP to the wild type HEV-VLP in the presence or absence of biotin conjugation was compared. An ELISA plate was coated with N573C VLP without conjugation, maleimide-biotin conjugated N573C VLP, or the wild type HEV-VLP and then incubated with two monoclonal antibodies, HEP230 or HEP40-4. In contrast to REP40-4, HEP230 exhibited strong binding for the wild type HEV-VLP, but failed to exhibit detectable binding to N573C VLP regardless of biotin conjugation (
[0089] Residue N573 is Involved in FAB230 Binding
[0090] Proposed mutation sites lie in the surface variable loops of the P-domain. Residues Y485, T489, and T586 are exposed on the outmost surface of the P-domain plateau while residue S533 and N573 are located on the stem region of the P-domain (
[0091] Chimeric VLP in complex with Fab of HEP230 (Fab230) appeared to resemble the morphology of HEV-VLP on cryo-electron micrographs. These complexes showed a homogenous size-distribution. The three dimensional reconstruction was calculated by superimposing icosahedral symmetry although the sixty antibody-binding sites on each VLP that were not filly occupied by Fab230. It revealed that HEV-VLP contains 30 protruding spikes, each of which extends outward along icosahedral two-fold axis (
[0092] We subsequently validated this finding by releasing the five-fold and three-fold symmetries from three-dimensional reconstruction, i.e., using 2-2-2 symmetry instead of 5-3-2 symmetry during image processing. After five iterations of refinement, a single, slender density was observed extending from the same site of the P-domain inwardly towards the 5-fold axis (data not shown). This helped to confirm that Fab230 binds to this region. Model docking with the crystal structure of an Fab fragment (PDB code 3RKD) of HEV antibody 8C11 revealed that the extra density did cover the three contact loops in the Fab (
[0093] LXY30 Conjugated to N573C VLP Shows Cancer Cell Targeting
[0094] To assess the targeting and diagnostic capability of N573-VLP, a breast cancer cell targeting ligand, LXY30, was chemically added to the surface N573C-VLPs through a cysteine-anchored melamine-alkyne. The LXY30-decorated N573C-VLPs (LXY30-VLPs) remained intact after the chemical conjugation (
[0095] To determine if LXY30-VLPs enter the MDA-MB-231 cells, we examined the distribution of HEV ORF2 after incubation of LXY30-VLPs and MDA-MB-231 cells by the confocal microscopy. For this imaging, the LXY30-VLPs were labeled with the near infrared dye, Cy5.5, and incubated with MDA-MB-231 cells at 37 C. for 1 hour. As shown in
[0096] In Vivo Targeting of LXY30 Conjugated to N573C VLPs to Breast Tumor Cells
[0097] Noninvasive in vivo imaging has been shown to be a powerful tool to visually monitor the delivery of therapeutic reagents. In vivo NIR optical imaging was used to investigate the distribution of the VLPs in nude mice bearing MDA-MB-231 breast cancer xenografts as a criterion to evaluate the specificity of tumor targeting. Both Cy5.5 labeled LXY30-VLPs and the Cy5.5 labeled wild type VLPs were intravenously injected via tail vein in nude mice bearing MDA-MB-231 xenografts, respectively. The mice were scanned with the fluorescence imager at various intervals for up to 72 hours, Both Cy5.5-labeled wild type VLPs and LXY30-VLPs distributed throughout the body of the mice immediately after the intravenous injection, and gradually accumulated into the MDA-MB-231 tumor via the enhanced permeability and retention (EPR) effect. However, the uptake rate of LXY30-VLPs in the tumor site was faster than that of wild type VLPs. The fluorescence intensity of Cy5.5-labeled LXY30-VLPs in MDAMB-231 tumor was also significantly higher than that of Cy5.5-labeled wild type VLPs at 1 and 6 hours post-injection (
[0098] HEV, as an enteric transmitted virus, preferentially enters hepatocytes in liver. It is not surprising that Cy5.5 labeled VLPs accumulated within one hour at the abdominal organs including liver. Ex vivo imaging of excised organs were performed at 72 hours post injection. The remaining signal of Cy5.5 was found predominantly at the liver and kidney, however, the signal appeared weak in excised tumor (data not shown). The high uptake in liver and kidney could be explained in part as leaking of the breakdown VLPs from circulating vessels, Overall, these results indicate that Cy5.5/LXY30 linked HEV-VLPs is able to target MDA-MB-231 xenografts in vivo.
Discussion
[0099] There have been several attempts to use VLPs as a drug delivery system for diseases that require the delivery of cytotoxic drugs or specific genetic modifications, cell tagging, or drugs that require encapsulation. VLPs provide an opportunity for tissue/cell specific approaches while minimizing the overall damage to healthy cells. Compared to other nano-delivery systems that have a limited half-life due to early degradation; HEV-VLP, like the Hepatitis E virus can maintain its structure through the low pH and proteolytic mucosa/gastro environment and does not require cold-temperature for storage. This implies that HEV-VLPs could have a higher propensity for efficient delivery and reduced accumulation due to particle degradation,.sup.20 both are critical factors for therapeutic nano carriers. The baculovirus expression vector-based production of HEV ORF2 in commercially-available insect High Five cells generates HEV-Cys-VLP capsid protein that is easily purified at high yield and low cost..sup.21 In contrast many other nano-delivery systems are compromised due to variable expression levels and inefficiency in production.
[0100] Cysteine replacement on the surface of the HEV-VLP P-domain was engineered so that accessibility to the ligands to the target cells was retained. Among all of the chimeric VLPs that were generated, N573C VLP construct appeared to show the strongest streptavidin binding on the basis of western blot analysis (
[0101] The N573 residue is located within the binding footprint of Fab (
[0102] In conclusion, the HEV-573C VLPs were chosen as a platform of modularized theranostic capsule because of its possibility of weakening the immunoresistance against the pre-existing HEV antibodies as well as the possibility of multivalent binding with the ligand. In our experiment, we utilized two different conjugation methods: thiol-selective conjugation between maleimide and cysteine, and amine-selective conjugation between amine group and NHS-ester. We chose thiol-selective conjugation for coupling a cancer cell targeting ligand to VLP, because of the spatial specificity provided by cysteine replacement. To avoid competition, the conjugation of dye was performed by amine-selective conjugation that gave rise to sufficient NIR signal for us to detect VLP distribution in MDA-MB-231 breast cancer cells in vitro and in vivo (in mice). Therefore, the HEV-Cys LVPs can be used as a platform for dual-functional, tagging with cancer adhesion-ligand and a detection marker, a robust candidate for cancer diagnosis.
[0103] Besides conjugating the cancer-cell targeting ligand on the surface, the utilization of a modularized theranostic capsule can be expanded by using the interior space of HEV-Cys-VLPs as well. The HEV-Cys-VLP is capable of encapsulation of a variety of bioactive substances. For example, HEV-Cys-VLPs can encapsulate magnetic nano-particles such as ferrite, for both diagnosis under MRI and thermotherapy. In such cases, the magnetic nanoparticles can be selectively stimulated using ultrasound or radio frequency electromagnetic radiation to heat the ferrite particles encapsulated in the tumor targeted theroanostic capsule..sup.22 Negatively charged micro-RNA/siRNA could be also encapsulated into the interior of HEV-Cys-VLPs..sup.17 By binding the cancer cell targeting ligand on its surface, HEV-Cys-VLP could have potential applications in cancer cell targeting gene therapy; consequently, this would improve current treatments used in cancer patients.
Materials and Methods
[0104] Site-Directed Mutagenesis of the P Domain of HEV ORF2
[0105] Five amino acid residues (Y485, T489, S533, N573, and T1586) of the P domain of HEV ORF2 (
[0106] Production and Purification of HEV-Cys VLPs and In Vitro Disassembly
[0107] The mutated HEV ORF2 proteins were expressed in insect High Five cells (Invitrogen, Carlsbad, Calif., USA) using baculovirus-based expression vectors. The recombinant baculoviruses used to express the mutated HEV ORF2 proteins were generated using the Bac-to-Bac Baculovirus Expression System (Invitrogen) on Sf9 cells (Invitrogen) and each of the pFastBac1/HEV ORF2 plasmids described above according to the protocols supplied by the manufacturer. The Sf9 and High Five cells were maintained on ESF921 medium (Expression Systems, Davis, Calif. USA) and Excell 420 medium (SAFC Biosciences, Lenexa, Kans.) supplemented with 2.5% heat-inactivated FBS, respectively, following standard protocols..sup.24 The production and purification of HEV-Cys-VLPs from the various mutated POR2 constructs were conducted as described previously..sup.7 In order to express the mutated POR2 proteins and generate VLPs, the High Five cells were inoculated with each baculovirus construct at a multiplicity of infection of 5 and cultured for 6-7 days. The VLPs were collected and purified through multiple steps of CsCl equilibrium density gradient ultracentrifugation as described previously..sup.7 The purified VLPs were resuspended in 10 mM potassium-MES buffer, pH 6.2, and stored at 4 C. A Mini dialysis device (Millipore) was used in the disassembly experiments. The purified VLPs were disrupted by dialysis against buffer containing EDTA (10 mM) or/and DTT (20 mM).
[0108] Transmission Electron Microscopy
[0109] The purified VLPs were loaded onto a glow-discharged, carbon-coated EM grid and stained with 2% uranyl acetate and examined under a JOEL JEM-1230 transmission electron microscope at a magnification of 30,000. The images were recorded on a CCD camera (TVIPS Gauting, Germany).
[0110] Conjugation of Biotin to HEV-Cys VLPs
[0111] To chemically conjugate maleimide linked biotin to HEV-Cys VLPs, maleimide linked biotin (20 M-200 M) was used to react with HEV-Cys VLPs (4 M-40 M) in 0.01M PBS, pH 7.2 at 4 C. overnight. The unbound maleimide-biotin was then removed using a 7,000 MWCO desalting column, (Zeba Spin Desalting Columns, Thermo Scientific).
[0112] Western Blotting
[0113] A total of 2 g of the biotin conjugated HEV-Cys ORF2 were loaded per lane on a 10% SDS-PAGE running under reducing condition. The proteins were then transferred to a polyvinylidene fluoride (PVDF) membrane (Millipore Co.) for Western immunoblotting. The PVDF membrane was first blocked with 5% skim milk and then incubated for 1 hour at room temperature with HRP conjugated streptavidin at a ratio of 1:10,000. The biotin-streptavidin reaction was then detected by an enhanced chemiluminescence method using an ECL kit (Amersham Biosciences, Piscataway, N.J.).
[0114] Enzyme-Linked Immunosorbent Assay (ELISA)
[0115] Both recombinant HEV-WT-VLP particles including HEV-WT and HEV-Cys mutants were prepared in 10 mM potassium-MES, pH 6.2 coating buffer. The proteins were diluted to the final concentrations of 1-100 ng/ml and coated overnight at 4 C. onto a clear bottom 96-well plate (Nunc, Pleasant Prairie, Wisc.). Control wells were incubated with 0.01 M PBS, pH 7.12. The coated VLPs were incubated with 50 l of the HEV antibodies for two hours at 37 C. after blocking with 0.5% Tween-20 Tris buffer containing 20 mM Tris, pH 7.4, and 150 mM NaCl. The associated HEV antibodies were detected using alkaline phosphatase-labeled anti-mouse FAb. The enzymatic reaction was developed using pnitrophenylphosphate (pNPP) solution (Sigma Co). The yellow color product of nitrophenyl was measured at 405 nm using a microplate reader and the average absorbance value of each VLP was calculated.
[0116] Preparation of LXY30-VLP-Cy5.5
[0117] Maleimide-conjugated LXY30 was prepared by mixing 650 M maleimide-azide and 650 M alkyne-LXY30 in the presence of 200 M CuSO4 and 1 mM ascorbic acid at 4 C. overnight. Then maleimide-conjugated LXY30 was added at molar ratio of 3:1 (ligand vs. binding site) to react with the Cys residues on HEV-Cys mutants though a thiol reaction at 4 C. overnight. The unconjugated molecules were removed by a 7,000 MWCO desalting columns, (Zeba Spin Desalting Columns, Thermo Scientific).
[0118] To chemically conjugate Cy5.5 NHS ester (Limiprobe) to HEV-Cys VLPs, Cy5.5 NHS ester (200 nm) was used to react with HEV-Cys mutants (20 M) at molar ratio of 300:1 (dye vs VLP) in buffer containing 0.1 M PHs, pH 7.2 at room temp for 2 hrs, following by incubation at 4 C. overnight. The free Cy5.5 NHS ester was then removed by a 7,000 MWCO desalting column, (Zeba Spin Desalting Columns, Thermo Scientific).
[0119] Flow Cytometry
[0120] MDA-MB-231 breast cancer cells were incubated with Cy5.5-labeled HEV-573C VLPs (VLP-Cy5.5) or Cy5.5/LXY30 conjugated HEV-573C VLPs (LXY3-VLP Cy5.5) for 1 hour at 37 C., respectively. Then the cells were washed with PBS 3 times and re-suspended in PBS for the flow cytometric analysis..sup.18 A total of 10,000 events were collected for each sample. Unstained cells were used as a control.
[0121] Confocal Microscopy
[0122] The sample preparation was performed according to previously established protocols..sup.25 Briefly, MDA-M B-231 breast cancer cells were seeded in the coverglass chamber slides (VWR LabShop, Batavia, Ill.). After reaching 80% confluence, the cells were incubated with Cy5.5-labeled HEV-573C VLPs (VLP-Cy5.5) and Cy5.5-labeled LXY30-conjugated HEV-573C VLPs (LXY3-VLP-Cy5.5), respectively for 1 h at 37 C. The cell nuclei were stained with Hoechst 33342 (invitrogen) for 5 min. The cells were washed twice with PBS and replaced with fresh medium before observation under a Zeiss confocal fluorescence microscope.
[0123] In Vivo Optical Imaging
[0124] Female SPF BALB/c mice, 10-12 weeks age, were purchased from Charles River (Davis, Calif.)) and kept under pathogen-free conditions according to AAALAC guidelines and were allowed to acclimatize for at least 4 days prior to any experiments. MDA-MB-231 breast cancer cells were injected subcutaneously into nude mice to form subcutaneous nodules. All animal experiments were performed in compliance with institutional guidelines and according to protocol No. 06-12262 approved by the Animal Use and Care Administrative Advisory Committee at the University of California, Davis. MDA-MB-231 tumors bearing mice were intravenously injected through the tail vein with 4 nmol/L Cy5.5 fluorescent-labeled HEV-573C VLPs (VLP-Cy5.5) and LXY30 conjugated HEV-573C VLPs (LXY30-VLP-Cy5.5) respectively.
[0125] At different time points (1, 6, 24 and 48 hours post-injection), the mice were scanned with Kodak imaging system IS2000MM. according to the procedure described previously..sup.26 Images were collected with an excitation bandpass filter at 625 nm and an emission at 700 nm, exposure time was 30 s per image. After in vivo imaging, animals were euthanized by CO.sub.2 overdose at 72 h after injection. Tumors, organs, and muscle tissue were excised and imaged with the Kodak imaging station.
[0126] Preparation of VLP-Fab Complexes for Cryoelectron Microscopy
[0127] The VLP-Fab complexes were prepared by incubating VLPs and Fabs at a molar ratio of 1:180 at 4 C. overnight. To ensure optimal purity, maximal occupancy, and ultimately reduced background noise during structural determination, pure VLP-FAB complexes were obtained by passing the sample through a short Sephacryl-300 gel-filtration column. Optical density readings at a wavelength of 280 nm were used to select the fractions that contained VLP-Fab complexes. The purified VLP fraction was then characterized by SDS-PAGE under reducing condition to validate the binding of Fab.
[0128] Cryoelectron Microscopy
[0129] Procedures regarding cryo-EM and its sample preparation were essentially similar to as those previously described..sup.27 Briefly, a drop of HEV-VLP aliquot of optimal concentration was applied to a glow-discharged holey carbon-coated copper grid, blotted to remove excess liquid, and immediately plunged into liquid ethane. The frozen-hydrated specimen was then transferred onto a Gatan 626DH cryo holder and examined under a transmission electron microscope (TEM-2100F, JEOL) at liquid nitrogen temperature. Micrographs were acquired under minimal dose system on a TemCam-F415 CCD camera (TVIPS) at a pixel size of 2 at the specimen space. The applied defocus varied from 1,000 to 3,000 nm among the micrographs. Particle concentration, optimal ice thickness, and minimal specimen shift were the visual criteria for selecting micrographs.
[0130] Imaging Processing
[0131] Particles were then manually selected and initially centered via cross-correlating each one against the sum of the image circular average. Astigmatism and defocus values were evaluated by superimposing power spectra from all the particles within a single micrograph. The contrast transfer function was determined and phase correction was applied to the data used for structural determination. The initial model of the wild type HEV-VLP was obtained from previous study..sup.13 The Polar Fourier transformation (PFT) algorithm.sup.28 was used to iteratively carry out origin and orientation refinements for each particle. Three-dimensional reconstructions were computed by combining a set of particles with orientations that spread evenly in an icosahedral asymmetric unit while superimposing the 5-3-2 icosahedral symmetry. The reliability of the reconstruction was assessed with classical Fourier Shall Correction and the final resolution was determined at 15 using 0.5 as cut off.
[0132] Fitting the Crystal Structure into Cryo-EM Density Maps
[0133] Manual fitting was carried out by translational and rotational movement of the HEV decanter composed of ten units of the HEV ORF2 protein (PDB ID 2ZZQ) into the cryo-EM density maps using program O..sup.29 The fitting was first manually refined by minimizing the crashes between symmetry related HEV ORF2 molecules and then evaluated based on the cross correlation coefficient (CC value) between the cryo-EM density and the density computed from the fitted HEV ORF2 coordinates. Fitting was halted when the CC value reached 80%. The Fab coordinates were obtained from the crystal structure of Fab8C11 bound HEV P-domain (PDB ID 3RKD) and was docked into the cryoEM map while maintaining the binding interface as the contacting surface to the VLP.
REFERENCES
[0134] 1. Ludwig, C.; Wagner, R., Virus-like particles-universal molecular toolboxes. Curr Opin Biotechnol 2007, 18, 537-545.
[0135] 2. Purcell, R. H., Hepatitis virus. In Fields Virology, 3rd Ed, ed.; Fields, B. N.; Knipe, D. M.; Howley, P. M., Eds. LippincottRaven Publishers: Philadelphia, 1996; pp 2831-2843.
[0136] 3. Tam, A. W.; Smith, M. M.; Guerra, M. E.; Huang, C. C.; Bradley, D. W.; Fry, K. E.; Reyes, G. R., Hepatitis E virus (HEV): molecular cloning and sequencing of the full-length viral genome. Virology 1991, 185 (1), 120-31.
[0137] 4. Xing, L.; Wang, J. C.; Li, T. C.; Yasutomi, Lara, J.; Khudyakov, Y.; Schofield, D.; Emerson, S. U.; Purcell, R. H.; Takeda, N.; Miyamura, T.; Cheng, R. H., Spatial configuration of hepatitis E virus antigenic domain. J Virol 2011, 85 (2), 1117-24.
[0138] 5. Schofield, D. J.; Glamann, J.; Emerson, S. U.; Purcell, R. H., identification by phage display and characterization of two neutralizing chimpanzee monoclonal antibodies to the hepatitis E virus capsid protein. J Virol 2000, 74 (12), 5548-5555.
[0139] 6. Yu, H.; Li, S.; Yang, C. Y.; Wei, M.; Song, C.; Zheng, Z.; Gu, Y.; Du, H.; Zhang, J.; Xia, N. S., Homology model and potential virus-capsid binding site of a putative HEV receptor Grp78. J Mol Model 2010, Epub ahead of print.
[0140] 7. Li, T.-C.; Takeda, Miyamura, T.; Matsuura, Y.; Wang, J. C. Y.; Engvall, H.; Hammar, L.; Xing, L.; Cheng, R. H., Essential elements of the capsid protein for self-assembly into empty virus-like particles of hepatitis E virus, J. Virol. 2005, 79 (20), 12999-13006.
[0141] 8. Li, T. C.; Yamakawa, Y.; Suzuki, K.; Tatsurni, M.; Razak, M. A.: Uchida, T.; Takeda, N.; Miyamura, T., Expression and self-assembly of empty virus-like particles of hepatitis E virus. J Virol 1997, 71 (10), 7207-7213.
[0142] 9. Guu, T.; Liu, Z.; Ye, Q.; Mata, D.; Li, K.; Yin, C.; Zhang, J.; Tao, Y., Structure of the hepatitis E virus-like particle suggests mechanisms for virus assembly and receptor binding. Proc Natl Acad Sci USA 2009, 106, 12992-12997.
[0143] 10. Xing, L.; Li, T. C.; Miyazaki, N.; Simon, M. N.; Wall, J. S.; Moore, M.; Wang, C. Y.; Takeda, N.; Wakita, T.; Miyamura, T.; Cheng, R. H., Structure of hepatitis E virion-sized particle reveals an RNA-dependent viral assembly pathway. J Biol Chem 2010, 285, 33175-33183.
[0144] 11. Yamashita, T.; Mori, Y.; Miyazaki, N.; Cheng, H.; Yoshimura, M.; Unno, H.; Shima, R.; Moriishi, K.; Tsukihara, T.; Li, T. C.; Takeda, N.; Miyamura, T.; Matsuura, Y., Biological and immunological characterics of hepatitis E virus-like particles based on the crystal structure. Proc Natl Acad Sci USA 2009, 106, 12986-12991.
[0145] 12. Xing, L.; Kato, K.; Li, T.; Takeda, N.; Miyamura, T.; Hammar, L.; Cheng, R. H., Recombinant hepatitis E capsid protein self-assembles into a dual-domain T=1 particle presenting native virus epitopes. Virology 1999, 265 (1), 35-45.
[0146] 13. Jariyapong, P.; Xing, L.; van Houten, N. E.; Li, T. C.; Weerachatyanukul, W.; Hsieh, B.; Moscoso, C. G.; Chen, C. C.; Niikura, M.; Cheng, R. H., Chimeric hepatitis E virus-like particle as a carrier for oral-delivery. Vaccine 2013, 31 (2), 417-24.
[0147] 14. Niikura, M.; Takamura, S.; Kim, G.; Kawai, S.; Saijo, M.; Morikawa, S.; Kurane, I.; Li, T. C.; Takeda, N.; Yasutomi, Y., Chimeric recombinant hepatitis E virus-like particles as an oral vaccine vehicle presenting foreign epitopes. Virology 2002, 293 (2), 273-280.
[0148] 15. Zafrullah, M.; Khursheed, Z.; Yadav, S.; Sahgal, D.; Jameel, S.; Ahmad, Acidic pH enhances structure and structural stability of the capsid protein of hepatitis E virus. Biochem Biophys Res Commun 2004, 313 (1), 67-73.
[0149] 16. Li, T.-C.; Suzaki, Y.; Ami, Y.; Dhole, T. N.; Miyamura, T.; Takeda, N., Protection of cynomolgus monkeys against HEV infection by oral administration of recombinant hepatitis E virus-like particles. Vaccine 2004, 22, 370-377.
[0150] 17. Takamura, S.; Niikura, M.; Li, T. C.; Takeda, N.; Kusagawa, S.; Takebe, Y.; Miyamura, T.; Yasutomi, Y., DNA vaccine-encapsulated virus-like particles derived from an orally transmissible virus stimulate mucosal and systemic immune responses by oral administration. Gene Ther 2004, 11 (7), 628-635.
[0151] 18. Yao, N.; Xiao, W.; Wang, X.; Marik, J.; Park, S. H.; Takada, Y.; Lam, K. S., Discovery of targeting ligands for breast cancer cells using the one-head one-compound combinatorial method. J Med Chem 2009, 52 (1), 126-33.
[0152] 19. Calaway, F. A.; Stockley, P. G., MS2 viruslike particles; a robust, semisynthetic targeted drug delivery platform. Molecular pharmaceutics 2013, 10 (1), 59-68.
[0153] 20. Ma, Y.; Nolte, R. J.; Cornelissen, J. J., Virus-based nanocarriers for drug delivery. Advanced drug delivery reviews 2012, 64 (9), 811-25.
[0154] 21. Kawano, M.; Xing, L.; Lam, K. S.; Handa, H.; Miyamura, T.; Barnett, S.; Sreivastava, I. K.; Cheng, R. H. Design platforms of nanocapsules for human therapeutics or vaccine In Development of Vaccines Singh; Srivastava, I. K., Eds. Wiley Pub 2011; pp 125-140.
[0155] 22. Roemer, R. B., Engineering aspects of hyperthermia therapy. Annu Rev Biomed Eng 1999, 1, 347-76.
[0156] 23. Nilsson, J.; Miyazaki, N.; Xing, L.; Wu, B.; Hammar, L.; Li, T. C.; Takeda, N.; Miyamura, T.; Cheng, R. H., Structure and Assembly of a T=1 Virus-Like Particle in BK Polyomavirus. J. Virol. 2005, 79 (9), 5337-5345.
[0157] 24. Merrington, C. L.; King, L. A.; R. D., P., Baculovirus expression systems. In Protein Expression: A practical Approach, Higgins, S. J.; Hames, B. D., Eds. Oxford University Press: 1999; pp 101-127.
[0158] 25. Xiao, K.; Li, Y.; Lee, J. S.; Gonik, A. M.; Dong, T.; Fung, G,; Sanchez, E.; Xing, L.; Cheng, H. R.; Luo, J.; Lam, K. S., OA02 peptide facilitates the precise targeting of paclitaxel-loaded micellar nanoparticles to ovarian cancer in vivo. Cancer Res 2012, 72 (8), 2100-10.
[0159] 26. Luo, J.; Xiao, K.; Li, Y.; Lee, J. S.; Shi, L.; Tan, Y.; Xing, L.; Cheng, H.; Liu, G.; Lam, K. S., Well defined, size-tunable, multifunctional micelles for efficient paclitaxel delivery for cancer treatment, Bioconjugate Chem. 2010, 21, 1216-1224.
[0160] 27. Kawano, M. A.; Xing, L.; Tsukamoto, H.; Inoue, T.; Handa, H.; Cheng, R. H., Calcium bridge triggers capsid disassembly in the cell entry process of simian virus 40. J. Biol Chem 2009, 284 (50), 34703-12.
[0161] 28. Baker, T.; Cheng, H., A model based approach for determining orientations of biological macromolecules imaged by cryo-electron microscopy. J. Struct. Biol. 1996, 116, 120-130.
[0162] 29. Jones, T. A.; Zou, J. Y.; Cowan, S. W.; Kjeldgaard, M., Improved method for building protein model in electron density maps and the location of errors in these models. Acta crystallogr. Sect. A 1991, 47, 110-119.
Example 2
Functionalized Nanocarriers
Introduction
[0163]
[0164] Intratumoral delivery is a challenge task for modern medical research and is a process that comprises lots of negotiations between nanocarriers with cells, extracellular matrix, and the vasculature inside the tumor. Described herein is an HEV-VLP based nanocarrier for targeted tumor delivery guided by imaging the in situ distribution of VLP at the whole animal level, to the tumor interior, and ultimately down to subcellular organelles. Engineered HEV-VLPs for tumor targeting are provided by adding adhesion tag(s) to the surface of the P-domain. A genetically inserted a fluorescence marker can also be inserted into the VLP so that it can be used as endogenous reporter. Use of these nanoparticles demonstrate the power of correlative microscopic studies on the role it plays in the development of nanocarriers.
[0165] The use of nanoparticles in passive and targeted drug delivery has been dramatically increased over the past decades. Nanocarriers composed of synthetic polymers, Liposomes, and dendrimers, have been well-investigated, however, there are only two FDA-approved antibody-conjugates and four FDA-approved nanoparticle-based drug delivery carriers. Virus like particle (VLP) is natural provided nanocarriers that possess several attractive features. They can be self-assembled into monodisperse, nansized particles, with defined periodicity that enables dense, repetitive display of tumor targeting agents. In addition, the VLP possesses multiple unique features that make it more attractive as potential nanocarrier.
[0166] HEV VLP nanoparticles can be characterized with electron microscopy in the presence or absence of contrast enhancing reagents. Microscopic characterization of nanoparticles can be routinely performed to examine the physical properties of the nanocarriers using methods described herein, such as imaging frozen hydrated multifunctional particles, e.g., using contrast enhanced gold atom clusters (
[0167] Moreover, correlative microscopic techniques can be based on these newly described conjugates to achieve the utilization of multiple imaging modalities in the examination of the same tumor specimen in order to deliver information above and beyond the capability of either modality alone. For instance, light and electron microscopy can be used to image from the organismal level, to the organ level, to cells, and even subcellular details. In combination with Near-Infrared (NIR) whole animal imaging and/or micro-CT, correlative light and electron microscopy (CLEM) allows in vitro and in vivo imaging of VLP intratumoral distribution. With, e.g., high pressure freezing and freeze substitution, tumor diagnosis can be preserved to maintain the sufficient antigenicity of HEV-VLP for immunofluorescence labeling.
[0168] Region identification is one of the critical issues for tumor diagnosis, where both light and electron microscopies indeed image the same object. For instance, with HEV VLPs described herein, the coordinates of 1) photoconversion of DAB (3,3-diaminobenzidine tetrahydrochrloride); 2) dual functional probe, FluoroNanogold; and 3) EM finder grids can be informative in multiple modalities of tumor identification. The first method uses free oxygen radicals that formed upon illumination of fluorochromes to induce oxidation of DAB in situ. While visualizing specimen under fluorescence microscope in the presence of DAB solution, the oxidized DAB forms networks that will be stained with osmium tetroxide as fine granular, dense precipitates at the sites of the former fluorescent signals. FluoroNanogold conjugated antibody is a commercially available reagent that provides both light and electron microscope contrast by conjugation of 1.4 nm gold clusters either with green or with red fluorophore. Unlike colloidal gold of other sizes, the 1.4 nm nanogold cluster does not quench fluorescence.
[0169] HEV VLPs described herein allow detection and visualization by 3D electron tomography to monitoring drug delivery. Electron tomography provides 3D spatial information to describe the biodistribution of drug delivery vehicles inside the tumor. In a three-dimensional entity, the microenvironment of tumor can be much more complex than what found in vitro with cultured monolayer cells. Electron tomography can be used as a complement to CLEM in analyzing the intratumoral accumulation of drug-loaded VLP, so as to elucidate the mechanism for VLP extravasation and passing through the cell layers inside a tumor.
[0170] Furthermore, besides the gold clusters, HEV VLPs can be equipped and encapsulated with additional imaging agents, e.g., water-soluble CdSe/ZnS quantum dots or Ferrite, in a disassembly-and-reassembly process (
TABLE-US-00001 SEQIDNO:1> HEVgenotype1(NP_056788.1) 1mrprpilllllmflpmlpapppgqpsgrrrgrrsggsgggfwgdradsqpfaipyihptn 61pfapdvtaaagagprvrqparplgsawrdqaqrpaaasrrrpttagaapltavapahdtp 121pvpdvdsrgaiirrqynlstspltssvatgtnlvlyaaplspllplqdgtnthimateas 181nyaqyrvvratiryrplvpnavggyaisisfwpqttttptsvdmnsitstdvrilvqpgi 241asehvipserlhyrnqgwrsvetsgvaeeeatsglvmlcihgslvnsytntpytgalgll 301dfalelefrnltpgntntrvsrysstarhrlrrgadgtaeltttaatrfmkdlyftstng 361vgeigrgialtlfnladtllgglptelissaggqlfysrpvvsangeptvklytsvenaq 421qdkgiaiphdidlgesrvviqdydnqheqdrptpspapsrpfsvlrandvlwlsltaaey 481dqstygsstgpvyvsdsvtlvnvatgaqavarsldwtkvtldgrplsttqqysktffvlp 541lrgklsfweagttkagypynynttasdqllvenaaghrvaistyttslgagpvsisavav 601laphsalalledtmdyparahtfddfcpecrplglqgcafqstvaelqrlkmkvgktrel SEQIDNO:2> HEVgenotype3(BAH10873.1) 1mrpravlllffvllpmlpappagqpsgrrrgrraggagggfwgdrvdsqpfalpyihptn 61pfaadvvsqsgagarprqpprplgsawrdqsqrpsaaprrrsapagaapltaispapdta 121pvpdvdsrgailrrqynlstspltssvapgtnlvlyaaplnpllplqdgtnthimeteas 181nyaqyrvvratiryrplvpnavggyaisisfwpqttttptavdmnsitstdvrilvqpgi 241aselvipserlhyrnqgwrsvettgvaeeeatsglvmlcihgspvnsytntpytgalgll 301dfalelefrnltpgntntrvsrytstarhrlrrgadgtaeltttaatrfmkdlhftgtng 361vgevgrgialtlfnladtllgglptelissaggqlfysrpvvsangeptvklytsvenaq 421qdkgitiphdidlgsdrvviqdydnqheqdrptpspapsrpfsvlrandvlwlsltaaey 481dqttygsstnpmyvsdtvtfvnvatgaqavarsldwskvtldgrplttiqqysktfyvlp 541lrgklsfweagttkagypynynttasdqilienaaghrvaistyttslgagptsisavgv 601laphsalavledttdyparahtfddfcpecrtlglqgcafqstiaelqrlkmkvgktres SEQIDNO:3> HEVgenotype4(ABE27148.1) 1mrpravlllffvllpmlpappagqpsgrrrgrrsggtgggfwgdrvdsqpfalpyihptn 61pfasdiptatgagarprqparplgsawrdqsqrpaaparrrsapagaspltavapapdta 121pvpdvdsrgailrrqynlstspltstiatgtnlvlyaaplspllplqdgtnthiiateas 181nyaqvrvvratiryrplvpnavggyaisisfwpqttttptsvdmnsitstdvrilvqpgi 241aselvipserlhyrnqgwrsvetsgvaeeeatsglvmlcihgspvnsytntpytgalgll 301dfalelefrnltpgntntrvsrysssarhklcrgpdgtaeltttaatrfmkdlhftgtng 361vgevgrgialtllnladtllgglptelissaggqlfysrpvvsangeptvklytsvenaq 421qdkgiaiphdidlgesrvviqdydnqheqdrptpspapsrpfsvlrandvlwlsltaaey 481dqttygsstnpmyvsdtvtfvnvatgtqgvsrsldwskvtldgrplttiqqysktffvlp 541lrgklsfweagttkagypynynttasdqilienapghrvcistyttnlgsapvsisavgv 601laphsalaaledtvdyparahtfddfcpecralglqgcafqstvaelqrlkmkvgktqey SEQIDNO:4> HEVgenotype2(M74506.1) 1mtprpllllfllflpmlpapptgqpsgrrrgrrsggtgggfwgdrvdsqpfaipyihptn 61pfapdvaaasgsgprlrqparplgstwrdqaqrpsaaarrrpatagaaaltavapahdts 121pvpdvdsrgailrrqynlstspltssvasgtnlvlyaaplnpplplqdgtnthimateas 181nyaqvrvaratiryrplvpnavggyaisisfwpqttttptsvdmnsitstdvrilvqpgi 241aselvipserlhyrnqgwrsvetsgvaeeeatsqlvmlcihqspvnsytntpytgalqll 301dfalelefrnlttcntntrvsrysstarhsargadgtaeltttaatrfmkdlhftglngv 361gevgrgialtllnladtllgglptelissaggqlfysrpvvsangeptvklytsvenaqq 421dkgvaiphdidlgdsrvviqdydnqheqdrptpapaparpfsvlrandvlwlsltaaeyd 481qstygsstgpvyisdsvtlvnvatgaqavarsldwskvtldgrplptvegysktffvlpl 541rgklsfweagttkagypynynttasdqilienaaghrvaistyttrlgagpvaisaaavl 601aprsalalledtfdypgrahtfddfcpecralglqgcafqstvaelqrlkvkvgktrel SEQIDNO:5> HEVgenotype5(BAJ77116) 1mnnmflcfacgyatmrpraillllvvllpmlpappagqssgrrrgrrsggagsgfwgdrv 61dsqpfalpyihptnpfasdtiaatatgarsrqsarplgsawrdqtqrppaasrrrstptg 121aspltavapapdtrpvpdvdsrgailrrqynlstspltstiasgtnlvlyaaplspllpl 181qdgtnthimateasnyaqyrvvratiryrplvpnavggyaisisfwpqttttptsvdmns 241itstdvrivvqpglaselvipserlhyrnqgwtsvetsgvaeeeatsglvmlcihgspvn 301sytntpytgalglldfalelefrnltpgntntrvsrysstarhrlhrgadgtaeltttaa 361trfmkdlxftgsngigevgrgialtlfnladtllgglptelissaggqlfysrpvvsang 421eptvklytsvenaqqdkgiaiphdidlgdsrvviqdydnqheqdrptpspapsrpfsvlr 481vndvlwltmtaaeydqttygtstdpvyvsdtvtfvnvatgaqgvarsldwskvtldgrpl 541ttiqrhsknyfvlplrgklsfweagttkagypynynttasdqilienaaghrvcistytt 601algsgpvsvs SEQIDNO:6> HEVgenotype6(BAJ61827.1) 1mrpravlllflmllpmlpappagqpsgrrrgrrsggsgggfwgdrvdsqpfalpyihptn 61pfasdvstsagagararqaarplgsawrdqsqrpsasarrrptpagaspltavapapdtt 121pvpdvdsrgailrrqynlstspltstvasgtnlvlyaaplgpllplqdgtnthimateas 181nyaqqrviratiryrplvpnavggyaisisfwpqttttptsvdmnsitstdvrilvqpgl 241aseliipserlhyrnqgwrsvetsgvaeeeatsglvmlcihgspvnsytntpytgalgll 301dfalelefrnltpgntntrvsrytstarhrlrrgpdgtaeltttaatrfmkdlyftgsng 361lgevgrgialtlfnladtllgglptelissaggqlfysrpvvsangeptvklytsvenaq 421qdkgiaipheidlgdsrvtiqdydnqneqdrptpspapsrpfsvlrvndvlwltltaaey 481dqttygsttnpmyvsdtvtfvnvatgaqgvaraldwskvtfdgrplttvqqygksffvlp 541lrgklsfweagtvkagypynynttasdqilvenapghrvcistyttnlgsgpvsisavgv 601laphaataal SEQIDNO:7> HEVgenotype1(NP_056788.1),residues112-608 112avapahdtppvpdvdsrgailrrqynlstspltssvatgtnlvlyaaplspllplqdgtnthimateas180 181nyaqyrvvratiryrplvpnavggyaisisfwpqttttptsvdmnsitstdvrilvqpgiasehvipser250 251lhyrnqgwrsvetsgvaeeeatsglvmlcihgslvnsytntpytgalglldfalelefrnltpgntntrv320 321srysstarhrlrrgadgtaeltttaatrfmkdlyftstngvgeigrgialtlfnladtllgglpteliss390 391aggqlfysrpvvsangeptvklytsvenaqqdkgialphdidlgesrvvlqdydnqheqdrptpspapsr460 461pfsvlrandvlwlsltaaeydqstygsstgpvyvsdsvtlvnvatgaqavarsldwtkvtldgrplsttq530 531qysktffvlplrgklsfweagttkagypynynttasdqllvenaaghrvaistyttslgagpvsisavav600 601laphsala608 SEQIDNO:8> HEVgenotype3(BAH10873.1),residues112-608 112aispapdtapvpdvdsrgailrrqynlstspltssvasgtnlvlyaaplnpllplqdgtnthimateas180 181nyaqyrvvratiryrplvpnavggyaisisfwpqttttptsvdmnsitstdvrilvqpgiaselvipser250 251lhyrnqgwrsvettgvaeeeatsglvmlcihgspvnsytntpytgalglldfalelefrnltpgntntrv320 321srytstarhrlrrgadgtaeltttaatrfmkdlhftgtngvgevgrgialtlfnladtllgglpteliss390 391aggqlfysrpvvsangeptvklytsvenaqqdkgitiphdidlgdsrvviqdydnqheqdrptpspapsr460 461pfsvlrandvlwlsltaaeydqttygsstnpmyvsdtvtfvnvatgaqavarsldwskvtldgrplttiq530 531qysktfyvlplrgklsfweagttkagypynynttasdqilienaaghrvaistyttslgagptsisavgv600 601laphsala608 SEQIDNO:9> HEVgenotype4(ABE271481),residues112-608 112avapapdtapvpdvdsrgailrrqynlstspltstiatgtnlvlyaaplspllplqdgtnthilateas180 181nyaqyrvvratiryrplvpnavggyaisisfwpqttttptsvdmnsitstdvrilvqpglaselvipser250 251lhyrnqgwrsvetsgvaeeeatsglvmlcihgspvnsytntpytgalglldfalelefrnltpgntntrv320 321srysssarhklcrgpdgtaeltttaatrfmkdlhftgtngvgevgrgialtllniadtllgglpteliss390 391aggqlfysrpvvsangeptvklytsvenaqqdkgiaiphdidlgesrvviqdydnqheqdrptpspapsr460 461pfsvlrandvlwlsltaaeydqttygsstnpmyvsdtvtfvnvatgtqgvsrsldwskvtldgrplttiq530 541qysktffvlplrgklsfwargttkagypynynttasdqilienapghrvcistyttnlgsgpvsisavgv600 601laphsala608 SEQIDNO:10> HEVgenotype2(M745061),residues112-608 112avapahdtspvpdvdsrgailrrgynlstspltssvasgtnlvlyaaplnpplplqdgtnthimateas180 181nyaqyrvaratiryrplvpnavggyaisisfwpqttttptsvdmnsitstdvrilvqpgiaselvipser250 251lhyrnqgwrsvetsgvaeeeatsglvmlcihgspvnsytntpytgalglldfalelefrnlttcntntrv320 321srysstarhsargadgtaeltttaatrfmkdlhftglngvgevgrgialtllniadtllgglptelissa390 391qqglfysrpvvsangeptvklytsvenaqqdkgvaiphdidlgdsrvviqdydnqheqdrptpspapsrp460 461fsvlrandvlwlsltaaeydqstygsstgpvyisdsvtlvnvatgaqavarsldwskvtldgrplptveq530 531ysktffvlplrgklsfweagttkagypynynttasdqilienaaghrvaistyttrlgagpvaisaaavl600 601aprsalal SEQIDNO:11> HEVgenotype5(BAJ77116),residues112-608 112srrrstptg 121aspltavapapdtrpvpdvdsrgailrrqynlstspltstiasgtnlvlyaaplspllpl 181qdgtnthimateasnyaqyrvvratiryrplvpnavggvaisisfwpqttttptsvdmns 241itstdvrivvqpglaselvipserlhyrnqgwrsvetsgvaeeeatsglvmlcihgspvn 301sytntpytgalglldfalelefrnltpqntntrvsrysstarhrlhrgadqtaeltttaa 361trfmkdlxftgsngigevgrgialtlfnladtllgglptelissaggqlfysrpvvsang 421eptvklytsvenaqqdkgiaiphdidlgdsrvviqdydnqheqdrptpspapsrpfsvlr 481vndvlwltmtaaeydqttygtstdpvyvsdtvtfvnvatgaqgvarsldwskvtldgrpl 541ttiqrhsknyfvlplrgklsfweagttkagypynynttasdqilienaaghrvcistytt 601slgsgpvs SEQIDNO:12> HEVgenotype6(BAJ61827.1),residues112-608 112avapapdtt 121pvpdvdsrgaiirrqynlstspltstvasgthlvlyaaplqpllplqdgtnthimateas 181nvaqyrviratiryrplvpnavggyaisisfwpqttttptsvdmnsitstdvrilvqpgl 241aseliipserlhyrnqgwrsvetsgvaeeeatsglvmlcihgspvnsytntpytgalgll 301dfalelefrnltpqntntrvsrytstarhrlrrgpdgtaeltttaatrfmkdlyftgsng 361lgevgrgialtlfnladtllgglptelissaggqlfysrpvvsangeptvklytsvenaq 421qdkgiaipheidlgdsrvtiqdydnqheqdrptpspapsrpfsvlrvndvlwltltaaey 481dqttvasttnpmyvsdtvtfvnvatgaqgvaraldwskvtfdgrplttvqqygksffvlp 541lrgklsfweagtvkagypynynttasdqilvenapghrvcistyttnlgsgpvsisavav 601laphaata