Hatching fluid enzymes and uses thereof

09624483 ยท 2017-04-18

Assignee

Inventors

Cpc classification

International classification

Abstract

The present invention relates to various polypeptides from fish hatching fluid, their encoding nucleic acid sequences, pharmaceutical compositions comprising said polypeptides and nucleic acid molecules and their use in various medical and cosmetic applications to the skin, particularly for moisturizing skin and/or for exfoliation of the horny layer of the skin for treating or preventing skin disorders or conditions in an animal.

Claims

1. A method of treating a condition or disorder of the skin of an animal, said method comprising administering topically a pharmaceutical or cosmetic composition to said animal wherein: said pharmaceutical or cosmetic composition comprises: (i) an isolated polypeptide having metalloproteinase activity comprising an amino acid sequence as set forth in SEQ ID NO: 1; or (ii) an isolated polypeptide having metalloproteinase activity comprising an amino acid sequence which is at least 90% identical to a sequence as set forth in SEQ ID NO: 1; or (iii) an isolated polypeptide having metalloproteinase activity comprising a portion of an amino acid sequence as set forth in SEQ ID NO: 1, wherein said portion comprises at least 150 amino acids; or (iv) an isolated polypeptide having metalloproteinase activity comprising a portion of an amino acid sequence which is at least 90% identical to a comparable region of an amino acid sequence as set forth in SEQ ID NO: 1 and comprises at least 150 amino acids; and one or more pharmaceutically or cosmetically acceptable excipients and/or diluents, and wherein the condition or disorder of the skin of the animal selected from the group consisting of eczema, contact dermatitis, psoriasis, ichthyosis, acne, calluses, corns, warts, a benign hyperproliferative disorder and a pigmentation disorder.

2. The method as claimed in claim 1, wherein the pigmentation disorder liver spots.

3. The method as claimed in claim 1, wherein said benign hyperproliferative disorder is selected from the group consisting of epidermolytic hyperkeratosis, hair follicle keratosis, peripheral hypertrophy around scars and the formation of keloids.

4. The method as claimed in claim 1, wherein said amino acid sequence is at least 95% identical to an amino acid sequence as set forth in SEQ ID NO: 1.

5. The method as claimed in claim 1, wherein said portion is at least 95% identical to a comparable region of an amino acid sequence as set forth in SEQ ID NO: 1.

6. The method as claimed in claim 1, wherein said pharmaceutical or cosmetic composition further comprises one or more polypeptides selected from the group consisting of: (i) an isolated acidic polypeptide comprising an amino acid sequence as set forth in SEQ ID NO: 2 or a sequence which is at least 90% identical to said sequence; (ii) an isolated acidic polypeptide comprising an amino acid sequence as set forth in SEQ ID NO: 3 or a sequence which is at least 90% identical to said sequence; and (iii) an isolated acidic polypeptide comprising an amino acid sequence as set forth in SEQ ID NO: 4 or a sequence which is at least 90% identical to said sequence.

7. The method as claimed in claim 6, wherein said composition comprises a polypeptide as set forth in each of (i) to (iii).

8. The method as claimed in claim 6, wherein the polypeptide has a pI of 3-5.5.

Description

(1) The following Examples are given by way of illustration only in which the Figures referred to are as follows:

(2) FIG. 1 shows isoelectric focussing of the VAPs after their purification;

(3) FIG. 2 shows the effects of Atlantic salmon VAPs on human epithelium in which the skin culture is exposed to VAPs;

(4) FIG. 3 shows the effects of Atlantic salmon VAPs on human epithelium in which the skin culture is exposed to VAPs;

(5) FIG. 4 shows the control skin culture;

(6) FIG. 5 shows the effects of Atlantic salmon choriolysin L on human epithelium in which skin culture is exposed to choriolysin L; and

(7) FIG. 6 shows the control skin culture.

EXAMPLE 1

Identification and Characterization of VAPs

(8) Protein Isolation

(9) During the course of analyzing hatching fluid components of Atlantic salmon, new proteins present in the hatching fluid were identified.

(10) A method for preparing partially hatching fluid (from which zonase may be prepared) which may be used as the starting material for isolating the VAPs of the invention (or their precursor sequences) is provided in WO99/29836 which is hereby incorporated by reference (particularly Example 1 of the described method, but optionally without the urea step).

(11) Thus, the following method has been used for isolation. VAPs were isolated from hatching fluid (crude or filtered through 0.45 m filters). Subsequently the VAPs were precipitated by adding 4 volumes of acetone at room temperature or at 4 C. After 20-30 minutes the precipitated VAPs were collected as a pellet after centrifugation at low speed (around 5000g) and resuspended in the appropriate buffer (e.g. 10 mM TrisHCl, pH8.0 or PBS).

(12) FIG. 1 shows 2D PAGE of the VAPs after their purification as described above.

(13) Sequence Analysis

(14) The newly identified VAPs were subjected to characterization by MS analysis of the trypsinized spots. The MS analysis was MALDI-TOF-TOF (Matrix assisted laser desorption/ionization. Time of flight2).

(15) The following results were obtained for the best match as reflected by the top score.

(16) TABLE-US-00002 VAPI gi|185133695Mass:49859Score:419Expect:8.2e-36Queriesmatched:7 eggshellprotein[Salmosalar] SEQID Observed Mr(expt) Mr(calc) Delta Start End Miss Ions Peptide No 1105.6858 1104.6785 1104.5928 0.0857 126 135 0 56 K.DGQFWWSR.D 17 1439.6891 1438.6818 1438.6300 0.0519 210 220 0 102 R.DSHYDLVFQCR.Y 18 1538.8765 1537.8693 1537.8239 0.0453 221 234 0 R.YTGTSVETLVIEVK.T 19 1785.9341 1784.9269 1784.8767 0.0501 193 209 0 R.MSSSYVVGIGPFGDIT 20 R.D R.MSSSYVVGIGPFGDIT R.D 1801.9253 1800.9180 1800.8717 0.0464 193 209 0 130 + Oxidation(M) 21 2023.1099 2022.1027 2022.0569 0.0458 118 135 1 93 K.TVTVQCTKDGQFVVVV 22 SR.D 2311.1242 2310.1169 2310.0686 0.0484 173 192 0 K.VTECGTVVTEEPDTIV 23 YENR.M VAPII gi|158132194Mass:59145Score:502Expect:4.1e-44Queriesmatched:12 choriogeninHbeta[Oncorhynchusmasou] SEQID Observed Mr(expt) Mr(calc) Delta Start End Miss Ions Peptide No 1089.6560 1088.6488 1088.5979 0.0509 211 220 0 52 K.DGQFVVVVAR.D 24 1198.6832 1197.6759 1197.6717 0.0042 385 395 0 80 R.TDPNIVLTLGR.0 25 1346.7405 1345.7333 1345.7354 -0.0021 370 380 1 48 K.VLRDPVYTEVR.I 26 1432.6125 1431.6052 1431.6089 -0.0037 295 305 0 62 R.DSQYDLTFQCR.Y 27 1688.7701 1687.7629 1687.7772 -0.0143 450 463 0 K.MFTFVDPMSMTPL 28 R.E+ Oxidation (M) 1704.7646 1703.7573 1703.7721 -0.0149 450 463 0 K.MFTFVDPMSMTPL 29 R.E+ 2Oxidation (M) 1720.7581 1719.7508 1719.7671 -0.0162 450 463 0 K.MFTFVDPMSMTPL 30 R.E+ 3Oxidation (M) 1772.8510 1771.8438 1771.8563 -0.0126 278 294 0 93 R.MSSSYQVGVGPFGSI 31 TR.D 1788.8447 1787.8374 1787.8513 -0.0138 278 294 0 (88) R.MSSSYQVGVGPFGSI 32 TR.D+ Oxidation (M) 1977.0356 1976.0284 1976.0514 -0.0230 203 220 1 129 K.AVTVQCTKDGQFVVV 33 VAR.D 2361.0236 2360.0163 2360.0512 -0.0349 258 277 0 K.VTECGTVMTEETDTI 34 IYENR.M 2377.0210 2376.0137 2376.0461 -0.0324 258 277 0 K.VTECGTVMTEETDTI 35 IYENR.M+ Oxidation (M) VAPIII Comparisontopeptidesofchoriogenin(Oncorhynchusmasou) Start-End Observed Mr(expt) Mr(calc) Delta Miss Sequence SEQIDNo 103-115 1572.7675 1571.7602 1571.7184 0.0418 1 R.AECRENMVHVEAK.H 36 (Nomatch) 103-115 1588.7668 1587.7596 1587.7133 0.0462 1 R.AECRENMVHVEAK.H 37 Oxidation(M)(Nomatch) 188-201 1733.8167 1732.8094 1732.7661 0.0434 0 R.TNDAMINIECHYPR.K 38 (Nomatch) 188-201 1749.8474 1748.8401 1748.7610 0.0791 0 R.TNDAMINIECHYPR.K 39 Oxidation(M) (Ionsscore82) 222-232 1421.7118 1420.7045 1420.6696 0.0348 0 K.YAEELLYFSMR.L 40 (Nomatch) 222-232 1437.7161 1436.7088 1436.6646 0.0443 0 K.YAEELLYFSMR.L 41 Oxidation(M) (Ionsscore33) 233-242 1312.6294 1311.6221 1311.5918 0.0304 0 R.LMTADWQYER.A 42 (Nomatch) 233-242 1328.6293 1327.6220 1327.5867 0.0354 0 R.LMTADWQYER.A 43 Oxidation(M) (Ionsscore37) 269-287 2130.1112 2129.1039 2129.0575 0.0464 0 R.IFVDSCVATLEPNINANPR.Y 44 (Ionsscore143) 302-312 1278.6242 1277.6169 1277.5645 0.0524 0 K.MTGSHSQFMPR.S 45 (Nomatch) 318-326 1172.6300 1171.6228 1171.6026 0.0202 0 K.LYFQVEAFR.F 46 (Ionsscore78)

(17) From the above results, the sequences of the VAPs were generated by identifying peptides in the VAP sequence by MS and then inserting the intervening sequences using relevant portions of the known native sequence to which the comparison was made. The VAP sequences identified by this process are set out in SEQ ID Nos. 2-4 and the native sequences against which they were compared are provided in SEQ ID Nos. 5-8.

EXAMPLE 2

Medical/Cosmetic Applications of VAPs In Vitro

(18) Materials and Methods

(19) The following studies were carried out using the Atlantic salmon VAPs prepared as described in Example 1.

(20) Differentiated human skin epithelium cultures were obtained from SkinEthics (Nice, France) at day 16 after seeding onto plastic growth substrata with micropores allowing nutrients access to the epithelial tissue from below. Such cultures exhibit normal skin morphology after differentiation during the culturing period at 37 C. These cultures were maintained for two more days in vitro so that the upper stratum corneum was exposed to air, and stratum basalis to the growth substratum.

(21) Parallel cultures were moved to 30 C. moist atmosphere and presented with a medium Ca, Mg-containing phosphate-buffered saline for 6 hours with or without the presence of VAPs at 0.5 mg/ml (measured at OD280). Cultures were fixed in formalin and embedded in paraffin according to standard procedures, and stained with hematoxylin/eosin.
Results
A. Moisturizing Effects

(22) The results are shown in FIG. 2-4 in which A and B show the skin culture exposed to VAPs and C shows the control skin culture. These figures show that the VAPs cause the skin stratum corneum laminae to separate, thus delamination occurs. The laminae do not detach, or exfoliate, they simply separate from each other.

(23) This separation is caused by highly charged amphiphilic proteins which intercalate in the stratum corneum, and which due to their amphiphilic character carry water to separate the skin laminae. The water is therefore piggybacked into the stratum corneum by the VAPs reducing trans-epidermal water loss (TEWL).

EXAMPLE 3

Medical/Cosmetic Applications of Choriolysin L In Vitro

(24) Materials and Methods

(25) The following studies were carried out using the Atlantic salmon choriolysin L prepared as described in Yasumasu et al., 1989, supra, from salmon hatching fluid.

(26) The human skin epithelium cultures were prepared as described in Example 2 and choriolysin L from Salmon hatching fluid was applied at 0.15 mU/ml for 6 hours at 30 C.

(27) Results

(28) A. Exfoliation Effects

(29) The results are shown in FIGS. 5 and 6 in which A shows the skin culture exposed to salmon choriolysin L and B shows the control skin culture. The results show that choriolysin L causes delamination and rupture of skin lamellae.

(30) Exfoliation may also be analysed by assessing the supernatant of skin cultures to assess the amount of epithelial cells which are removed from the skin cultures during treatment. As choriolysin L is inhibited by 1 mM EDTA, its effects can be readily inhibited to prove its action on the skin.

EXAMPLE 4

Medical/Cosmetic Applications of VAPs and Choriolysin L In Vivo

(31) Cosmetic Applications

(32) Individuals suffering from dry skin and/or skin requiring exfoliation (e.g. calluses or corns) are administered cosmetic or placebo creams as described below. Treatment is repeated periodically, e.g. every 8 hours.

(33) The effects of the cream on the skin are analysed based on qualitative effects such as appearance and feel (e.g. itchiness) or may be analyzed more quantitatively, e.g. on water content or thickness.

(34) Medical Applications

(35) Individuals suffering from a condition or abnormality of the skin such as acne, eczema or psoriasis are administered treatment or placebo creams as described below. Treatment is repeated periodically, e.g. every 8 hours.

(36) The effects of the cream on the skin are analysed based on qualitative effects such as appearance, feel (e.g. pain) or colour or may be analyzed more quantitatively, e.g. on size of the remaining abnormality, extent of inflammation or thickness.

(37) Placebo Cream:

(38) TABLE-US-00003 Phase/ Name INCI Name % Temp ( C.) Cetiol V Decyl Oleate 4 A/75 Dynacerin 660 Oleyl Erucate 6 A/75 CUTINA GMS V Glyceryl stearate 3 A/75 Cire da lanol CTO Cetearyl alcohol & 2 A/75 Cteareth 33 Nacol 16-95 Cetyl alcohol 1 A/75 Edenor L2 SM GS Stearic acid & Palmitic 3 A/75 acid Nacol 18-94 Cetyl alcohol 1 A/75 Radia 7730 Isopropyl myristate 4 A/75 dH.sub.2O 25 B/75 Glycerin 4810 Glyerin 3 B/75 Optiphen 1 B/75 Triethanolamine 85% 0.4 B/75 dH.sub.2O 46.3 C/75 Nipa Biopure 100 Imidazolodinyl urea 0.3 C/25
Cosmetic/Treatment Cream with 10% Active Ingredient:

(39) TABLE-US-00004 Phase/ Name INCI Name % Temp ( C.) Cetiol V Decyl Oleate 4 A/75 Dynacerin 660 Oleyl Erucate 6 A/75 CUTINA GMS V Glyceryl stearate 3 A/75 Cire da lanol CTO Cetearyl alcohol & 2 A/75 Cteareth 33 Nacol 16-95 Cetyl alcohol 1 A/75 Edenor L2 SM GS Stearic acid & Palmitic 3 A/75 acid Nacol 18-94 Cetyl alcohol 1 A/75 Radia 7730 Isopropyl myristate 4 A/75 dH.sub.2O 25 B/75 Glycerin 4810 Glyerin 3 B/75 Optiphen 1 B/75 Triethanolamine 85% 0.4 B/75 dH.sub.2O 36.3 C/75 Nipa Biopure 100 Imidazolodinyl urea 0.3 C/25 VAP and/or choriolysin L 10 25
Sequences:

(40) TABLE-US-00005 SEQIDNo.1:ChoriolysinL-Atlanticsalmon MDHRPTLSLLLLLLLLGLSQASGNEFHDEPDHVSITSVIL KSNNGTNELLLDGDILAPRTRNAMKCFSSQYSCLWKKSSD GLVYVPYILSAVYSSLEVETIETAMKYFQGKTCIRFIPRK TQTAYLDIQSSGGCFGTVGTVGDRQTLSLAQFGCVQHGII QHELLHALGFYHEHNRSDREQYIRINWQYIYDYAVGNFQK EDTNNLHTAYDYSSVMHYDRTAYTNDYGKETITPIPDPSV AIGQRLGMSDIDVLKVNKLYQC SEQIDNo.2:VAPI-Atlanticsalmon TVTVQCTKDGQFVVVVSRDATLPNLELDSISLLGANGAHC TPVGTTSAFAIYQFKVTECGTVVTEEPDTIVYENRMSSSY WVVIGPFGDITRDSHYDLVFQCRYTGTSVETLVIEVK SEQIDNo.3:VAPII-Salmon AVTVQCTKDGQFVVVVARDATLPSLELDSISLLGTNGPHC HAIGTTSVFAIYQFKVTECGTVMTEETDTIIYENRMSSSY QVGVGPFGSITRDSQYDLTFQCRYKGSTIVVVWIDVKPVP PPNPDIAPGPLTVELRLGSGTCLTKGCNEEEVAYTSYYTE ADYPVTKVLRDPVYTEVRILARTDPNIVLTLGRCWATTNP NPLSLPQWDLLIDGCPYQDDRYLTTPINVGPSSGLSFPTH YRRFVLKMFTFVDPMSMTPLR SEQIDNo.4:VAPIII-Salmon AECRENMVHVEAKHDLLGIGQLIQLEDLTLGDCPMSGFDN INQVLIFESPLQSCGSQLRMTTNSLIYIFTLYYKPKPLAN TPLIRTNDAMINIECHYPRKHNVSSLALIPTWTPFSAAKY AEELLYFSMRLMTADWQYERAGNMYVLGDMVNIEASVMQY FHVPLRIFVDSCVATLEPNINANPRYAFIENHGCLIDAKM TGSHSQFMPRSADYKLYFQVEAFR SEQIDNo.5:Fulllengthzr-protein-Atlantic salmon MKWSAVCLVAVATLGWLCDAQNFLEKPGWPPIQTPPSWPP QTPQRPVQPLPQRPAQPFLQKPAQPIPQRIPYTEDDTKQT CEVVDKDKVSCGLSGITAAQCQAISCCFDGRMCFYGKTVT VQCTKDGQFVVVVSRDATLPNLELDSISLLGANGAHCTPV GTTSAFAIYQFKVTECGTVVTEEPDTIVYENRMSSSYVVG IGPFGDITRDSHYDLVFQCRYTGTSVETLVIEVKTYPNPN PVVTVDAVLNVELRLANGRCLSKGCDEMQEAYTSYYTVAD YPVTKVLRDPVYAEVRILGMTDPNVVLTLEQCWATIDPTG DRLPRWDLLVNGCPYQDDRYLTVPIASDSSYIPPGEFLSH YKRFVFKMFTFVDPTSMVPLQENVYIHCRATVCHALAGSC EQRCNRQRRDLSAQGQKKTKGDVVVSSQKVIMIDPSLYA SEQIDNo.6:FulllengthchoriogeninH-Pacific salmon MKWSAVCLVAVATLGWLCDAQIYLEKPGWPPIQTPASWPA QPPEKPVQPPQRPAQPPQWPAQPPQWPAQPPQRPAQPPQR PAQTQQWPGQPPQRPAQPPQWPAQPPQRPAQPPQRPAQPP QRPAQPPPRPAQPPQWPVHPPQWPVQPGTPLQRPKFPSDP GSKQSCDVDSQHKVQCGLPDITAAHCDAINCCFDGRMCFY GKAVTVQCTKDGQFVVVVARDATLPSLELDSISLLGTNGP HCHAIGTTSVFAIYQFKVTECGTVMTEETDTIIYENRMSS SYQVGVGPFGSITRDSQYDLTFQCRYKGSTIVAVVIDVKP VPPPNPDIAPGPLTVELRLGSGTCLTKGCNEEEVAYTSYY TEADYPVTKVLRDPVYTEVRILARTDPNIVLTLGRCWATT NPNPLSLPQWDLLIDGCPYQDDRYLTTPINVGPSSGLSFP THYRRFVLKMFTFVDPMSMTPLRETVFIHCNTAVCLPSHG DSCEPRCYRKRRDIPAAVQKTTRIKSNLVSSGELILTDPR ELTN SEQIDNo.7:FulllengthchoriogeninL-Pacific salmon MAMKWSVVCLVAVAMLGCLCVAQIWPPSIKPVQQPFRPNR PPPQQPQQPPYQKPRIPPKDQTQAKQKFETPLDWTYPLDP KPEPKIIGGSEARTPVAANSVRAECRENMVHVEAKHDLLG IGQLIQLEDLTLGDCPMSGFDNINQVLIFESPLQSCGSQL RMTTNSLIYIFTLYYKPKPLANTPLIRTNDAMINIECHYP RKHNVSSLALIPTWTPFSAAKYAEELLYFSMRLMTADWQY ERAGNMYVLGDMVNIEASVMQYFHVPLRIFVDSCVATLEP NINANPRYAFIENHGCLIDAKMTGSHSQFMPRSADYKLYF QVEAFRFQSQRGSDPIIPQKTKIPFQPAADYPATLDMIFL TCHLKATTIAFPIDFEYKACSFINTWREAGGNDGVCGCCD STCSNRKGRDTTTHQKPANIWEGDVQLGPIFISEKVEQ SEQIDNo.8:Alternativezr-protein-Atlantic salmon KWSYQLPQKLAQPLPQKPAQPLPQWPVQPLPQRPAEPLPQ RPAQPLPQWPVQPLPQRPAEPLPQRPAQPLPQRPVQPLPQ RPAQPFLQKPAQPIPQRIPYTKDDTKQTCEVVDKDKVSCG LSGITAAQCQAISCCFDGRMCFYGKTVTFQCTKDGQFVVV VSRDATLPNLELDSISLLGANGAHCTPVGTTSAFAIYQFK VTECGTVVTEEPDTIVYENRMSSSYVVGIGPFGDITRDSH YDLVFQCRYTGTSVETLVIEVKTYPNPNPVVTVDAVLNVE LRLANGRCLSKGCDEMQEAYTSYYTVADYPVTKVLRDPVY AEVRILGMTDPNVVLTLEQCWATTDPTGDRLPRWDLLVNG CPYQDDRYLTVPIASDSSYIPPGEFLSHYKRFVFKMFTFV DPTSMVPLQENVYIHCRATVCHALAGSCEQRCNRQRRDLS AQGQKKTKGDVVVSSQKVIMIDPSLYA SEQIDNo.9:Nucleotidesequence,choriolysinL, Atlanticsalmon atggaccacagacccactcttagcctgcttctgctgctgctgctgctggg cctatcacaggccagtggaaatgagttccatgatgagccggaccatgtgt ccatcacttcagtaatcctgaagtccaacaacggaaccaatgagctactg ctggatggagacattctagctcctagaaccaggaacgccatgaagtgctt tagcagccagtacagctgtctctggaagaagtcatctgacggcttggtgt acgtgccttacatcctcagcgctgtatattccagcttggaggtagagact attgagacggccatgaagtacttccaaggcaagacctgcatccgcttcat tccacgtaagacacagactgcctacctggacattcagagcagcggcgggt gttttggtaccgtggggactgttggggacaggcagacattgtctcttgca cagtttggctgtgttcaacatggtatcatccagcatgagctgcttcacgc cctgggcttctaccacgagcacaacaggagtgaccgtgaacagtatatca ggatcaactggcaatacatctatgactacgccgttgggaacttccagaag gaggacaccaacaacctgcacactgcatacgactactcctctgtcatgca ctatgatagaaccgcttacactaacgactacggaaaggaaaccatcactc ccatcccagacccatctgtggccattggacagagactgggcatgtccgac attgatgtcctgaaggtcaacaagctctaccaatgctaagaggaagagcg ccattgttgaaaatgtgtgatgctggatgtgctgtcatgtgctgatgtat tttattgttggaagtttgtatgtatccttttaatcacattggtaataata aagcatggttatggtaaaaaaaaa SEQIDNo.10:Nucleotidesequenceencoding SEQIDNo.2,VAPI acagtgactgtccagtgtaccaaggatggccagtttgtggtggtggtttc cagggatgccactctgcccaaccttgagctagattccatcagcctgctag gggcaaacggagcccactgcacccctgtcggcaccacatctgcctttgcc atctaccagttcaaagttactgaatgtggaactgtggtgacggaggaacc tgatactattgtctatgagaacaggatgtcctcttcatatgtagtgggga ttggacccttcggcgacattaccagggacagccactatgacctggtcttc cagtgtcggtatactgggacttccgttgagacattggttatcgaggt gaaa SEQIDNo.11:Nucleotidesequenceencoding SEQIDNo.3,VAPII gcagtgactgttcagtgtaccaaggatggccagtttgtggtggtggtggc cagggatgccactctgcccagcctggaactggactccatcagcctgctgg ggacaaacggaccccactgccatgctattggcacaacttctgtctttgcc atctaccagtttaaagtcactgaatgtggaactgtcatgacggaggaaac tgatactattatctatgagaataggatgtcctcttcatatcaagtggggg ttggcccctttggctccatcaccagggacagccaatatgatctaacattc cagtgcagatataagggcagtaccattgtggctgtggttattgatgtgaa gccggttcctcctccaaatcctgatatagctcctggacccctcacagttg agctcagactcggcagcggaacatgccttaccaagggatgtaatgaagag gaagtggcctacacctcttactacacagaggcagactaccctgtcaccaa ggtcctcagggatcctgtgtacactgaggttcgcatcctggcgaggacag atcccaacattgtgctgaccctgggtcgctgctgggctaccacaaaccca aaccctctcagcctgccccagtgggaccttctcattgatggatgtcctta ccaggatgaccgttacctgaccactcccatcaatgtgggaccctcttcgg gtctgtccttcccaacccactacaggcgcttcgtccttaagatgttcacc tttgtggatccaatgctgagg SEQIDNo.12:Nucleotidesequenceencoding SEQIDNo.4,VAPIII gctgagtgcagggagaacatggtccacgtggaagcgaagcatgacctgct ggggatcggccagttgatccagctagaagacctcactttgggagactgcc ctatgtctggattcgacaatatcaaccaggtgctcatctttgagtctccg ctgcagtcatgtggcagccagctaaggatgactaccaactccctcatcta catcttcactctatattacaaacccaaacctctggcaaacacccccctca tcaggacaaatgacgcgatgatcaatattgagtgccactatccaaggaaa cacaatgtgagcagcctggccctgatcccaacctggacccctttctccgc tgctaagtatgcagaggaactcctgtacttctccatgaggctcatgactg ctgactggcagtatgagagggccggtaacatgtacgtgttgggtgatatg gtgaacatcgaggcctctgtcatgcagtacttccacgttcccctgcgtat ctttgtggacagctgtgtggccaccctggaacccaacataaacgccaatc ccagatatgccttcattgagaatcatgggtgtctgatcgatgccaaaatg acaggttcccactcccagttcatgcctcgttccgcagactacaagctgta tttccaggtggaggctttcagg SEQIDNo.13:FulllengthNucleotidesequence encodingSEQIDNo.5,zr-proteinAtlanticsalmon atgaagtggagtgcagtttgtctagtggcagtggccacgcttggctggct gtgtgatgctcagaatttcttggaaaaaccagggtggccacccatccaga caccaccgtcatggcctccccaaacccctcagaggcctgtccaacccctt cctcagagacctgctcaaccctttcttcagaagcctgcccaacccatacc tcaacggataccctacaccgaagacgacacaaaacagacctgtgaggttg tggacaaggacaaggtgtcgtgtggactttctggcatcactgctgcccaa tgccaggccatcagctgctgttttgatggacggatgtgcttctacgggaa aacagtgactgtccagtgtaccaaggatggccagtttgtggtggtggttt ccagggatgccactctgcccaaccttgagctagattccatcagcctgcta ggggcaaacggagcccactgcacccctgtcggcaccacatctgcctttgc catctaccagttcaaagttactgaatgtggaactgtggtgacggaggaac ctgatactattgtctatgagaacaggatgtcctcttcatatgtagtgggg attggacccttcggcgacattaccagggacagccactatgacctggtctt ccagtgtcggtatactgggacttccgttgagacattggttatcgaggtga aaacgtatccaaaccccaacccagtggtcactgttgatgcagttctcaac gtggagctccgactggccaatggacgttgtctctccaagggatgtgatga aatgcaagaagcatacacctcttactacacggtggcagactaccctgtca ccaaggtcctcagggatcccgtgtacgctgaggttcgcatcctggggatg acagatcccaatgttgtcctgacactggagcagtgctgggccaccataga ccccacaggtgataggctgccccggtgggacctactagttaatgggtgtc cctaccaggatgaccgttacctgaccgtgcccatcgcctcggacagctcc tatatccctccgggagaattcttatcccactacaagcgcttcgtcttcaa gatgttcacctttgtggatccgacatctatggtccccctgcaggagaacg tgtacatccactgtcgtgcaacagtgtgccacgctctagcaggatcctgt gaacaaaggtgcaacaggcaaaggagagatctttctgctcaaggccaaaa gaagactaaaggagatgttgtggtttccagtcaaaaagtcatcatgattg acccaagtctttatgcttaa SEQIDNo.14:Fulllengthnucleotidesequence encodingSEQIDNo.6,choriogeninH-Pacific salmon atgaagtggagtgcagtttgtctagtggcagtggccacgcttggctggct gtgtgatgctcagatttacttggaaaaaccagggtggccacccatccaga caccagcgtcatggcctgcccaaccccctgagaagcctgttcaaccccct cagaggcctgcccagccccctcagtggcctgcccagccccctcagtggcc tgcccagccccctcagaggcctgcccagccccctcagaggcctgcccaaa cccagcagtggcctggccaaccccctcagaggcctgcccagccccctcag tggcctgcccaaccccctcagaggcctgcccaaccccctcaaagacctgc ccaaccccctcagaggcctgcccaaccccctccgaggcctgcccaacccc ctcagtggcctgttcatccccctcagtggcctgtccaacccggtacgccg cttcagaggcctaaattcccctctgacccaggctcaaagcagagctgtga tgttgatagccaacacaaggtgcagtgtggacttcctgacatcactgccg cccattgtgatgccattaactgctgttttgatggacggatgtgcttctac ggaaaagcagtgactgttcagtgtaccaaggatggccagtttgtggtggt ggtggccagggatgccactctgcccagcctggaactggactccatcagcc tgctggggacaaacggaccccactgccatgctattggcacaacttctgtc tttgccatctaccagtttaaagtcactgaatgtggaactgtcatgacgga ggaaactgatactattatctatgagaataggatgtcctcttcatatcaag tgggggttggcccctttggctccatcaccagggacagccaatatgatcta acattccagtgcagatataagggcagtaccattgtggctgtggttattga tgtgaagccggttcctcctccaaatcctgatatagctcctggacccctca cagttgagctcagactcggcagcggaacatgccttaccaagggatgtaat gaagaggaagtggcctacacctcttactacacagaggcagactaccctgt caccaaggtcctcagggatcctgtgtacactgaggttcgcatcctggcga ggacagatcccaacattgtgctgaccctgggtcgctgctgggctaccaca aacccaaaccctctcagcctgccccagtgggaccttctcattgatggatg tccttaccaggatgaccgttacctgaccactcccatcaatgtgggaccct cttcgggtctgtccttcccaacccactacaggcgcttcgtccttaagatg ttcacctttgtggatccaatgtctatgacccccctgagggagacggtgtt catccattgtaatacagctgtgtgtctgccatcccatggagacagctgtg aaccaagatgctacagaaagaggagagacattcctgctgcagtccagaag accaccagaatcaagtctaatttggtttccagtggcgaactgatcctgac tgacccaagggagctcaccaactag SEQIDNo.15:Fulllengthnucleotidesequence encodingSEQIDNo.7,choriogeninL-Pacific salmon atggcgatgaagtggagtgtagtttgtctcgtggcagtggccatgcttgg ctgtctgtgtgttgctcagatttggccaccctccattaaaccagtgcagc aacccttcagacccaatcgtccaccacctcagcagcctcagcaaccaccg tatcagaaacccaggatcccaccaaaagaccaaacccaggccaagcagaa gtttgagacaccattggattggacctatcctctggacccaaagccagagc ccaagattattgggggctcagaggcgagaacccctgtggctgccaattca gtgagggctgagtgcagggagaacatggtccacgtggaagcgaagcatga cctgctggggatcggccagttgatccagctagaagacctcactttgggag actgccctatgtctggattcgacaatatcaaccaggtgctcatctttgag tctccgctgcagtcatgtggcagccagctaaggatgactaccaactccct catctacatcttcactctatattacaaacccaaacctctggcaaacaccc ccctcatcaggacaaatgacgcgatgatcaatattgagtgccactatcca aggaaacacaatgtgagcagcctggccctgatcccaacctggaccccttt ctccgctgctaagtatgcagaggaactcctgtacttctccatgaggctca tgactgctgactggcagtatgagagggccggtaacatgtacgtgttgggt gatatggtgaacatcgaggcctctgtcatgcagtacttccacgttcccct gcgtatctttgtggacagctgtgtggccaccctggaacccaacataaacg ccaatcccagatatgccttcattgagaatcatgggtgtctgatcgatgcc aaaatgacaggttcccactcccagttcatgcctcgttccgcagactacaa gctgtatttccaggtggaggctttcaggttccagagccagagggggagtg acccaattattccgcagaaaacaaagataccttttcagcctgcggcagat tatcccgctacgctcgacatgatcttccttacctgtcacctgaaggcaac cacaatcgctttccccattgattttgagtacaaggcctgctctttcatta atacgtggagggaggctggtgggaatgatggagtgtgtggctgctgtgac tccacctgtagcaacaggaagggacgcgataccactacacatcaaaaacc agcaaatatatgggagggagatgttcagcttggtcccatctttatctcgg aaaaggttgagcaataa SEQIDNo.16:FulllengthNucleotidesequence encodingSEQIDNo.8,Altnerativezr-protein Atlanticsalmon gaagtggtcttaccaactccctcagaagcttgcccaaccccttcctcaga agcctgcccaacctcttcctcagtggcctgtccaaccccttcctcagagg cctgctgaaccccttcctcagaggcctgctcaaccccttcctcagtggcc tgtccaaccccttcctcagaggcctgctgaaccccttcctcagaggcctg ctcaaccccttcctcagaggcctgtccaaccccttcctcagagacctgct caaccctttcttcagaagcctgcccaacccatacctcaacggatacccta caccaaagacgacacaaaacagacctgtgaggttgtggacaaggacaagg tgtcgtgtggactttctggcatcactgctgcccaatgccaggccatcagc tgctgttttgatggacggatgtgcttctacgggaaaacagtgactttcca gtgtaccaaggatggccagtttgtggtggtggtttccagggatgccactc tgcccaaccttgagctagattccatcagcctgctaggggcaaacggagcc cactgcacccctgtcggcaccacatctgcctttgccatctaccagttcaa agttactgaatgtggaactgtggtgacggaggaacctgatactattgtct atgagaacaggatgtcctcttcatatgtagtggggattggacccttcggc gacattaccagggacagccactatgacctggtcttccagtgtcggtatac tgggacttccgttgagacattggttatcgaggtgaaaacgtatccaaacc ccaacccagtggtcactgttgatgcagttctcaacgtggagctccgactg gccaatggacgttgtctctccaagggatgtgatgaaatgcaagaagcata cacctcttactacacggtggcagactaccctgtcaccaaggtcctcaggg atcccgtgtacgctgaggttcgcatcctggggatgacagatcccaatgtt gtcctgacactggagcagtgctgggccaccacagaccccacaggtgatag gctgccccggtgggacctactagttaatgggtgtccctaccaggatgacc gttacctgaccgtgcccatcgcctcggacagctcctatatccctccggga gaattcttatcccactacaagcgcttcgtcttcaagatgttcacctttgt ggatccgacatctatggtccccctgcaggagaacgtgtacatccactgtc gtgcaacagtgtgccacgctctagcaggatcctgtgaacaaaggtgcaac aggcaaaggagagatctttctgctcaaggccaaaagaagactaaaggaga tgttgtggtttccagtcaaaaagtcatcatgattgacccaagtctttatg cttaa