Method for increasing plant biomass

09622429 ยท 2017-04-18

Assignee

Inventors

Cpc classification

International classification

Abstract

The invention relates to the use of a peptide comprising a six-member ring created by the disulfide bond between two cysteines in the increase of biomass of a photosynthetic organism, for its application in the wood industry, in obtaining energy coming from renewable sources and in agriculture.

Claims

1. A method for increasing the biomass of a photosynthetic organism which comprises cultivating said photosynthetic organism in the presence of an adrenomedullin, wherein the photosynthetic organism is a vascular plant or an alga, wherein the presence of adrenomedullin increases the biomass of the whole organism and wherein adrenomedullin is present in a concentration of 10.sup.8 to 10.sup.16 M.

2. The method according to claim 1, wherein said adrenomedullin is a human adrenomedullin.

3. The method according to claim 1, wherein said photosynthetic organism is a vascular plant and said adrenomedullin is administered as an additive to supplement the nutritive solution which feeds said plant in a hydroponic system, or it is administered to the irrigation water of said plant.

4. The method according to claim 1, wherein the photosynthetic organism is a vascular plant and said plant is selected from a plant used for the production of renewable energies, a plant for human or animal nutrition, a wood species, and an ornamental plant.

5. A gene construct for increasing the biomass of a photosynthetic organism comprising: (a) a nucleic acid encoding the peptide adrenomedullin, and (b) regulating elements for regulating its expression in a photosynthetic organism, wherein the photosynthetic organism is a vascular plant or an alga and wherein the adrenomedullin provided by the nucleic acid of the gene construct increases the biomass of the whole photosynthetic organism.

6. The gene construct according to claim 5, wherein said adrenomedullin is a human adrenomedullin.

7. A vector for increasing the biomass of a photosynthetic organism comprising a gene construct according to claim 5, wherein the photosynthetic organism is a vascular plant or an alga, and wherein the adrenomedullin provided by the nucleic acid of said gene construct increases the biomass of the whole organism.

8. A host cell for increasing the biomass of a photosynthetic organism comprising a gene construct according to claim 5 or a vector according to claim 7, wherein the photosynthetic organism is a vascular plant or an alga, and wherein the adrenomedullin provided by the nucleic acid of said gene construct or said vector increases the biomass of the whole organism.

9. A transgenic photosynthetic organism cell for increasing the biomass of a photosynthetic organism comprising, integrated in its genome, a gene construct according to claim 5, wherein the photosynthetic organism is a vascular plant or an alga, and wherein the adrenomedullin provided by the nucleic acid of said gene construct increases the biomass of the whole organism.

10. A transgenic photosynthetic organism for increasing the biomass of a photosynthetic organism comprising at least one transgenic photosynthetic organism cell according to claim 9, wherein the photosynthetic organism is a vascular plant or an alga, and wherein the adrenomedullin provided by the nucleic acid of the gene construct of said transgenic photosynthetic organism cell increases the biomass of the whole organism.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) FIG. 1 is a bar chart showing the relative growth of the plant biomass depending on the molar concentration of adrenomedullin present in the medium. Each bar represents the statistical mean and the standard deviation of 8 independent repetitions.

(2) FIG. 2 is a graph showing the adrenomedullin effect over a microalgae (Chlorella); microalgae treated with adrenomedullin grows up faster than the non-treated microalgae.

DETAILED DESCRIPTION OF THE INVENTION

(3) Method of the Invention

(4) In an aspect, the invention relates to a method for increasing the biomass of a photosynthetic organism (hereinafter referred to as method of the invention) which comprises cultivating said photosynthetic organism in the presence of a peptide (hereinafter referred to as growth factor of the invention) comprising: (i) the amino acid sequence

(5) TABLE-US-00003 [SEQIDNO:1] Cys-Xaa.sub.1-Xaa.sub.2-Xaa.sub.3-Xaa.sub.4-Cys wherein Xaa.sub.1, Xaa.sub.2, Xaa.sub.3 and Xaa.sub.4 independently represent an amino acid, and (ii) the cysteine residues of the amino acid sequence shown in (i) form a disulfide bridge between them.

(6) The amino acids Xaa.sub.1, Xaa.sub.2, Xaa.sub.3 and Xaa.sub.4 can be identical to or different from one another. In a particular embodiment, Xaa.sub.1, Xaa.sub.2, Xaa.sub.3 and/or Xaa.sub.4 is an amino acid different from Cys.

(7) As used herein, the term photosynthetic organism includes any organism capable of performing photosynthesis, i.e., a process that converts carbon dioxide into organic compounds, especially sugars, using the energy from sunlight. Photosynthesis occurs in plants, algae, and many species of bacteria, e.g., cyanobacteria, etc., but not in archaea. Photosynthetic organisms are also called photoautotrophs, since they can create their own food.

(8) The term plant, as used herein, includes living organisms belonging to the kingdom Plantae, e.g., trees, flowers, herbs, bushes, grasses, vines, ferns, mosses, green algae, etc. Currently, plants can be classified in three groups, namely: (i) Land plants or embryophytes, more formally Embryophyta or Metaphyta, which constitute the most familiar group of plants and include non-vascular land plants or briophytes, vascular plants or tracheophytes, which include seed plants or spermatopphytes; (ii) Green plantsalso known as Viridiplantae, Viridiphyta or Chlorobiont; and (iii) Archaeplastida, Plastida or Primoplantae.

(9) As used herein, the term alga includes a large and diverse group of simple, typically autotrophic organisms, ranging from unicellular to multicellular forms. In a particular embodiment, the alga is a microalga, i.e., a microscopic alga, typically found in freshwater and marine systems.

(10) The term cyanobacteria, commonly referred to as blue-green algae, as used herein, although was traditionally included as alga in older textbooks, many modern sources regard this as outdated as they are now considered to be bacteria.

(11) In the context of the present invention, biomass of a photosynthetic organism is understood both the amount of biological material or organic matter which constitutes a photosynthetic organism, and the biological material or organic matter generated in a biological process, spontaneous or not spontaneous (i.e., provoked). In an embodiment, biomass is useable as an energy source, for example, wood, waste, (hydrogen) gas, alcohol fuels, etc.

(12) In an embodiment, wherein the photosynthetic organism is a vascular plant, the biomass of said plant includes the amount of biological material or organic matter present in the plant, i.e., the biological material or organic matter constituting both the aerial part of the plant, i.e., the stem, the trunk, the leaves, the branches, the fruit, the flower heads, etc. (aerial biomass), and the underground part thereof, i.e., the roots, calli, tubers, etc. (underground biomass). The plant biomass is often measured as the dry mass or weight (or fresh weight where appropriate) of the plant.

(13) In the present invention, the expression increasing the biomass of a photosynthetic organism is understood as the effect on the photosynthetic organism of obtaining a growth rate greater than 1, wherein the growth rate (GR) is defined by the formula:
GR=Final weight/initial weight

(14) Another way of measuring an increase in the biomass of a photosynthetic organism is based on the calculation of the relative growth rate (RGR) or biomass gain per unit of biomass and time, and is defined by the formula:
RGR=(LnW.sub.2LnW.sub.1)/(t.sub.1t.sub.2) wherein W.sub.1 and W.sub.2 are the weight of the plant in the times 2 and 1 (t.sub.2t.sub.1 respectively) [Valladares, F. 2004, Ecologa del bosque mediterrneo en un mundo cambiante, pp. 191-227. Ministerio de Medio Ambiente (Ministry of the Environment), EGRAF, S. A., Madrid].

(15) As the person skilled in the art will understand, in the case of vascular plants, there are other parameters in the state of the art which, directly or indirectly related to the GR, can be used to determine the growth of the plant biomass of said plant. Illustrative, non-limiting examples of said parameters include: the leaf area ratio (LAR) or leaf area to total plant weight ratio. It is expressed in m.sup.2 (leaf) kg.sup.1 (plant). The leaf area can be measured by several methods. There are automatic leaf area measuring devices provided with a video camera, digital card and computer image analysis software which allow fairly quick area measurements (in addition to other dimensions: width, length, etc.) of a number of leaves. Another system is to photocopy or scan the leaves and by means of an image analysis software, estimating the surface. Another simple alternative is to cut out the silhouettes of the photocopied leaves and weigh them, using a cut-out of the same paper with a known surface to calibrate the weight/area ratio. Once the surface of the leaves is measured, the leaves are stored in paper envelopes with their identification, are dried in an oven and weighed to thus obtain the dry weight; the specific leaf area (SLA) or leaf area to leaf weight ratio. It is expressed in m.sup.2 (leaf) kg.sup.1 (plant); the leaf mean fraction (LMF) or leaf biomass to total plant biomass ratio. It is expressed in kg (leaf) kg.sup.1 (plant); or the net assimilation rate (NAR) or rate of increase in the weight of the plant per unit of leaf area. It is expressed in kg (plant) m.sup.2 (leaf) day.sup.1. The relative growth rate is equal to the product of LAR times NAR.

(16) Other growth analysis parameters include: the stem mass fraction (SMF) or stem biomass to total plant biomass ratio. It is expressed in kg (stem) kg.sup.1 (plant); the root mass fraction (RMF) or root biomass to total plant biomass ratio. It is expressed in kg (root) kg.sup.1 (plant); and the dry matter (DM) or the dry plant weight to fresh plant weight ratio. It is expressed in kg (dry weight) kg.sup.1 (fresh weight).

(17) The method of the invention can be applied to any type of photosynthetic organism, e.g., a plant, an alga, etc. Therefore, according to the present invention, when practically any photosynthetic organism is contacted with the growth factor of the invention, an increase in the biomass of said photosynthetic organism is obtained.

(18) As indicated at the beginning of the present description, the growth factor of the invention is a peptide comprising the motif [Cys-Xaa.sub.1-Xaa.sub.2-Xaa.sub.3-Xaa.sub.4-Cys]. However, in a particular embodiment, the growth factor of the invention is a peptide comprising the motif [Cys-Xaa.sub.1-Xaa.sub.2-Xaa.sub.3-Xaa.sub.4-Cys], with the proviso that said peptide is not the peptide of SEQ ID NO: 4 or the peptide of SEQ ID NO: 6.

(19) As the person skilled in the art will understand, said motif, optionally, will be flanked by other amino acid sequences forming part of the peptide identified as the growth factor of the invention.

(20) Thus, in a particular embodiment, said peptide (growth factor of the invention) comprises the amino acid sequence

(21) TABLE-US-00004 X.sub.1-Cys-Xaa.sub.1-Xaa.sub.2-Xaa.sub.3-Xaa.sub.4-Cys-X.sub.2 wherein: X.sub.1 represents the amino acid sequence of the amino-terminal end of the peptide, and X.sub.2 represents the amino acid sequence of the carboxyl-terminal end of the peptide.

(22) As it is used herein, the term peptide relates to a molecule formed by amino acid binding by means of peptide bonds, and it includes, for the sake of simplicity, peptides, polypeptides and proteins, although it is generally accepted that the term protein is applied to complete biological molecules with a stable conformation whereas the term peptide is generally reserved for short-chain amino acid oligomers which often lack a stable three-dimensional structure; likewise, the term polypeptide is typically reserved for any side chain of amino acids, regardless of their length (generally), which often lacks a defined conformation.

(23) Although the length of the amino acid sequence of the amino-terminal end of the peptide (X.sub.1) can vary within a broad range, in a particular embodiment X.sub.1 has a length comprised between 1 and 250 amino acids, or even more typically between 1 and 175 amino acids, usually between 1 and 100 amino acids, more usually between 1 and 50 amino acids, even more usually between 2 and 40 amino acids, and yet even more usually between 5 and 35 amino acids.

(24) Likewise, although the length of the amino acid sequence of the C-terminal end (or carboxyl terminus) of the peptide (X.sub.2) can vary within a broad range, in a particular embodiment X.sub.2 has a length comprised between 1 and 250 amino acids, or even more typically between 1 and 175 amino acids, usually between 1 and 100 amino acids, more usually between 1 and 50 amino acids, even more usually between 2 and 40 amino acids.

(25) In a particular embodiment, the amino acid sequence of the C-terminal end of the peptide (X.sub.2) comprises the amino acid sequence GRRRR (SEQ ID NO: 7), which, in a further particular embodiment, is located at a distance of 10 to 50 amino acids from the last Cys of the sequence Cys-Xaa.sub.1-Xaa.sub.2-Xaa.sub.3-Xaa.sub.4-Cys, i.e., there are from 10 to 50 amino acids between the last amino acid (Cys) of said sequence and the first amino acid (G) of sequence GRRRR (SEQ ID NO: 7).

(26) In a particular embodiment, the C-terminal end of X.sub.2 is amidated.

(27) Illustrative examples of peptides comprising said motif [Cys-Xaa.sub.1-Xaa.sub.2-Xaa.sub.3-Xaa.sub.4-Cys] include but are not limited to the adrenomedullin, the Arabidopsis proteins the amino acid sequences of which are shown in sequences SEQ ID NO: 4, SEQ ID NO: 5 and SEQ ID NO: 6, the Oryza sativa (rice) proteins the amino acid sequences of which are shown in SEQ ID NO: 8, SEQ ID NO: 9 and SEQ ID NO: 10, and the Thalassiosira pseudonana (diatom) protein the amino acid sequence of which is shown in sequence SEQ ID NO: 11.

(28) Therefore, in a particular embodiment of the method of the invention the growth factor of the invention is selected from the group consisting of adrenomedullin, the peptides the amino acid sequences of which are shown in SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10 and SEQ ID NO: 11, and combinations thereof, which will be described in detail below.

(29) Adrenomedullin

(30) Adrenomedullin (AM) is a hypotensive peptide originally found in human pheochromocytoma which consists of 52 amino acids, has an intramolecular disulfide bridge [Cys-Cys] and has high homology with the calcitonin gene-related peptide. The precursor protein, the preproadrenomedullin (SEQ ID NO: 2) has a length of 185 amino acids (GenBank accession no. AAC60642.1) which, after being processed intracellularly, will give rise to a mature protein having 52 amino acids, which will be adrenomedullin. In a particular embodiment of the method of the invention, AM is human adrenomedullin defined by SEQ ID NO: 3. Without wishing to be bound by any theory, it is believed that the fact that human AM presents activity on plant tissues is due to the existence of a similar factor in plants or in the microorganisms associated with them.

(31) TABLE-US-00005 SEQIDNO:2 (preproadrenomedullin) MKLVSVALMYLGSLAFLGADTARLDVASEFRKKWNKWALSRGKRELRMSS SYPTGLADVKAGPAQTLIRPQDMKGASRSPEDSSPDAARIRVKRYRQSMN NFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGYGRRR RRSLPEAGPGRTLVSSKPQAHGAPAPPSGSAPHFL [Theaminoacidsequenceoftheadrenomedullinisunderlinedandthe aminoacidsequenceofthemotifGRRRRistwofoldunderlinedandin boldprint] SEQIDNO:3 (humanadrenomedullin) YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH.sub.2 [Thecharacteristicmotifofadrenomedullin(Cys-Xaa.sub.1-Xaa.sub.2-Xaa.sub.3-Xaa.sub.4- Cys)isinboldprint,wherethetwocysteinesformingthedisulfide bridgeareunderlined]

(32) As the person skilled in the art will understand, any variant of SEQ ID NO: 3 with the capacity to increase the biomass of a photosynthetic organism is also included within the present invention.

(33) As it is used herein, the term variant of SEQ ID NO: 3 relates to any peptide the amino acid sequence of which can be obtained from SEQ ID NO: 3 by means of conservative amino acid changes and checking that the resulting variant has the capacity to increase the biomass of a photosynthetic organism by means of the measurement of any of the parameters mentioned above. The conservative amino acid substitutions relate to the interchangeability of residues having similar side chains. For example, a group of amino acids having aliphatic side chains consists of glycine, alanine, valine, leucine, and isoleucine; a group of amino acids having aliphatic-hydroxyl side chains consists of serine and threonine; a group of amino acids having side chains containing an amide group consists of asparagine and glutamine; a group of amino acids having aromatic side chains consists of phenylalanine, tyrosine and tryptophan; a group of amino acids having basic side chains consists of lysine, arginine, and histidine; and a group of amino acids having sulfur-containing side chains consists of cysteine and methionine. The preferred conservative amino acid substitution groups are: valine-leucine-isoleucine, phenylalanine-tyrosine, lysine-arginine, alanine-valine, and asparagine-glutamine.

(34) The functionally equivalent variants of adrenomedullin include polypeptides which are substantially homologous to native adrenomedullin [SEQ ID NO: 3]. As it is used herein, the expression substantially homologous relates to any of the amino acid sequences having a degree of identity with respect to the amino acid sequence shown in SEQ ID NO: 3 of at least 50%, advantageously at least 60%, preferably at least 70%, more preferably at least 85% and even more preferably at least 95%. The degree of identity between two peptides can be determined using computer algorithms and methods which are widely known by the persons skilled in the art. The identity between two amino acid sequences of two peptides is preferably determined using the BLASTP algorithm (BLAST Manual, Altschul, S. et al., NCBI NLM NIH Bethesda, Md. 20894, Altschul, S., et al., J., 1990, Mol. Biol. 215:403-410).

(35) On the other hand, adrenomedullin has a characteristic motif (or identifying feature) in its amino acid sequence which is involved in the adrenomedullin receptor recognition, consisting of a 6 amino acid ring created by the disulfide bond between two cysteines [Cys-Xaa.sub.1-Xaa.sub.2-Xaa.sub.3-Xaa.sub.4-Cys]. Adrenomedullin additionally has an amidated carboxyl-terminal end (CONH.sub.2) separated from the motif by about 20-40 amino acids. Any adrenomedullin variant having the Cys-Xaa.sub.1-Xaa.sub.2-Xaa.sub.3-Xaa.sub.4-Cys motif in its amino acid sequence will recognize the adrenomedullin receptor and trigger the processes which lead to an increase of the biomass of the photosynthetic organism. Thus, the present invention also contemplates those adrenomedullin variants with the capacity for increasing the biomass of a photosynthetic organism comprising said 6 amino acid ring created by the disulfide bond between two cysteines. The SEQ ID NO: 3 variants can additionally have an amidated carboxyl-terminal end.

(36) Finally, fragments of adrenomedullin or of the variants thereof as previously defined are also included within the present invention provided they maintain the capacity to increase the biomass of a photosynthetic organism. Said capacity can be determined by means of the parameters mentioned in previous paragraphs.

(37) Arabidopsis Proteins

(38) Other particular embodiments of the growth factor of the invention include the Arabidopsis proteins described in SEQ ID NO: 4, SEQ ID NO: 5 and SEQ ID NO: 6.

(39) TABLE-US-00006 Theproteinidentifiedundersequence SEQIDNO:4 [MLDTLIGGIVGGIAGAIIGTVDGFARGIGICPDSYQSCTRTDCEEHKKK LPTNLSRNGGAAAVKAKENGRRRRQKDRE-NH.sub.2] isaproteinof anunknownnamewithGenBankaccessionno. NP_564910. Theproteinidentifiedundersequence SEQIDNO:5 [MDPKSCENSSDVKGQTSDSVSKKVLIEEEEDVKKPQQGKENDSRMAKDV VSCSSNISAHVVHEEVADNVTAVSCNEAESDISKAKAKEFHTIDLSGVGE RICRICHFGSDQSPEASGDDKSVSPELIEIGCKCKNELGLAHFHCAEAWF KLRGNSVCEICGCTAKNVTVRLMEDWSGERDNTLDGRRRRGRGQSCCIFM VFLLTILLLHWFFKKISGYYQNT-NH.sub.2] isaproteinofthe zincfingerfamily(C3HC4-typeRingfinger)with GenBankaccessionno.NP_180967. Theproteinidentifiedunder SEQIDNO:6 [MGDVILFIDDTKSKVRITRCRICHEEEEESFFEVPCACSGTVKFAHRNC IQRWCNEKGNTTCEICLQVYKDGYTAVLKQSKLIEQEVTIRVNGRRRRRS RRLVSIAESDISQCNSVADRGASFCRSLTFTLSVFLLMKHTFDVIYGTEE YPFSVFTVLTLKAIGILLPMFIIIRTISTIQKTLRRRHQYPESEEEDRLS SDDDDDLEEEDEEQQQHLA-NH.sub.2] isaproteincalled pitchoun1(PIT1)withGenBankaccessionno. NP_567222. [Inallthecases,thecharacteristicmotifofthe growthfactoroftheinvention(Cys-Xaa.sub.1-Xaa.sub.2- Xaa.sub.3-Xaa.sub.4-Cys)isinboldprint,thetwocysteines formingthedisulfidebridgeareunderlinedand theaminoacidsequenceofthemotifGRRRRis twofoldunderlinedandinboldprint]

(40) As the person skilled in the art will understand, variants and fragments of said proteins also are included in the context of the present invention, provided they conserve the characteristic motif of the growth factor of the invention and when they are administered to a photosynthetic organism they increase the biomass thereof. The increase of the biomass of a photosynthetic organism can be ascertained by means of any of the parameters mentioned above, for example, by means of a plant biomass increase assay such as the one described in Example 1, or by means of an alga biomass increase assay such as the one described in Example 2. The term variant and its meaning in the context of the present invention have been defined in previous paragraphs.

(41) Oryza sativa Proteins

(42) The peptides comprising the motif [Cys-Xaa.sub.1-Xaa.sub.2-Xaa.sub.3-Xaa.sub.4-Cys] include, without limitation, the proteins of Oryza sativa (rice) whose amino acid sequences are shown in SEQ ID NO: 8, SEQ ID NO: 9 and SEQ ID NO: 10.

(43) TABLE-US-00007 SEQIDNO:8: MEAAPRDDKPARMNSEDDDGHRRWGSDGGEAMPRTTSPVRRCDAGGGGGVADSAWEEEGPTGEI PARRMERPARHGGVPAKYGRRLDGEDDGVLVPGEVVATSASAQETRQRRPEAEQWRQRHCCRRG CTSGGVRGKRRAGRGRGGDYDAGGGDGTAGRRADAAAGVAGFGRRRRRERRSATVWLGRSGRGK TEGEVD* SEQIDNO:9(proteinreceptor-likeproteinkinase2precursor, putative,expressed): MHAACLCSTCCSCRPRCAARRPRRARRRRCSRGRTPCRARRRRRPASSGRGRRRRRSSRTRTPR RGARGAAWRRRVGRRGGRRRGGAGVAGTLDALDLSSLPGLAALNLSLNSLTGSFPSNVSSPLLS LRSIDLSSNNLSGPIPAALPALMPNLEHLNLSSNQFSGEIPASLAKLTKLQSVVLGSNLLHGGV PPVIGNISGLRTLELSGNPLGGAIPTTLGKLRSLEHINVSLAGLESTIPDELSLCANLTVIGLA GNKLTGKLPVALARLTRVREFNVSKNMLSGEVLPDYFTAWTNLEVFQADGNRFTGEIPTAITMA SRLEFLSLATNNLSGAIPPVIGTLANLKLLDLAENKLAGAIPRTIGNLTSLETLRLYTNKLTGR LPDELGDMAALQRLSVSSNMLEGELPAGLARLPRLVGLVAFDNLLSGAIPPEFGRNGQLSIVSM ANNRFSGELPRGVCASAPRLRWLGLDDNQFSGTVPACYRNLTNLVRLRMARNKLAGDVSEILAS HPDLYYLDLSGNSFDGELPEHWAQFKSLSFLHLSGNKIAGAIPASYGAMSLQDLDLSSNRLAGE IPPELGSLPLTKLNLRRNALSGRVPATLGNAARMEMLDLSGNALDGGVPVELTKLAEMWYLNLS SNNLSGEVPPLLGKMRSLTTLDLSGNPGLCGHDIAGLNSCSSNTTTGDGHSGKTRLVLAVTLSV AAALLVSMVAVVCAVSRKARRAAVVVEKAETSASGGGGSSTAAAVQASIWSKDTTFSFGDILAA TEHFNDAYCIGKGSFGTVYRADLGGGRAVAVKRLDASETGDACWGVSERSFENEVRALTRVRHR NIVKLHGFCAMGGYMYLVYELAERGSLGAVLYGGGGGGGCRFDWPARMRAIRGVAHALAYLHHD CSPPMIHRDVSVNNVLLDPDYEPRVSDFGTARFLVPGRSTCDSIAGSYGYMAPELAYMRVTTKC DVYSFGVVAMEMLMGKYPGGLISSLQHSPQSLSAEGHDGSGGGGGEEASASASRRLLLKDVVDQ RLDAPAGKLAGQVVFAFVVALSCVRTSPDARPTMRAVAQELAARRRPILDRPFEMIKIGDLTNS HR* SEQIDNO:10: MSRRGTRRQRDGNGDRGAASSSSPSTSPSHGPAGGWASQIRCCGAWCGGRTSVAVMLGDGAPVL LGRRRRRRPPSSLLLMLFFFFFFHVQNACMPCSLAC* [Inallthecases,thecharacteristicmotifofthegrowthfactorof theinvention(Cys-Xaa.sub.1-Xaa.sub.2-Xaa.sub.3-Xaa.sub.4-Cys)isinboldprint,thetwo cysteinesformingthedisulfidebridgeareunderlinedandtheamino acidsequenceofthemotifGRRRRistwofoldunderlinedandinbold print]
Thalassiosira pseudonana (Diatom) Protein

(44) TABLE-US-00008 SEQIDNO:11: MAPALCGDLISTRRSFLALAWTLTTLLSFFSFVVAVFLAGRINQQYISMT SGDYAEWYTHEYGNDFYDRLLEEGSGECCRYLEGGEEGGGGEQQREGEDH DRQEGGSNDRNQLDAEFFQSLANANSRSLEFAGVYTTVLGIALSLYGSTV VVGFMSLKGEYIPPCFSFRSMSMIEEEGEVGVEDADTGPRNLWGEKIHRG VFLGCLVIFANLLLLCAVIFGELEVHDNYNNYDQQNNDNIFSYRIEKISS VFAITCIVLACVYVLFAVIYLSCGGMLDDDNDTVQHNTGNWMDHSHSQFE LSPRGNGRRRRRGRRDMPDKAEPLVSAVGGGITEIGCATRSDERAYVLDE GCIDETT* [Thecharacteristicmotifofthegrowthfactorof theinvention(Cys-Xaa.sub.1-Xaa.sub.2-Xaa.sub.3-Xaa.sub.4-Cys)isin boldprint,thetwocysteinesformingthe disulfidebridgeareunderlinedandtheamino acidsequenceofthemotifGRRRRistwofold underlinedandinboldprint]

(45) In order for the growth factor of the invention to have the desired effect, i.e., increasing the biomass of a photosynthetic organism, it is necessary to contact said growth factor with said photosynthetic organism. In the state of the art there are a number of processes which allow administering active ingredients (in the present invention, the growth factor of the invention) to photosynthetic organism, specially plants. Likewise, the active ingredient will be formulated in a manner suited to the method of administration to be used.

(46) Usually for its administration to photosynthetic organism, the growth factor of the invention will be part of a composition that can be used either in solid form or in liquid form, for example, in the form of a wettable powder or of an emulsifiable concentrate incorporating conventional diluents. Said compositions can be obtained in the traditional manner, for example, by mixing the growth factor of the invention with a diluent and optionally with other ingredients or constituents. In a particular embodiment, the photosynthetic organism is a plant and then the composition composition comprising the growth factor of the invention can be obtained, by conventional means, by mixing the growth factor of the invention with a diluent and optionally with other ingredients or constituents which are usually used in agricultural compositions and which are known by the person skilled in the art, such as, but not limited to, solvents, active agents or pH regulators, fertilizers, etc. In a particular embodiment, the growth factor of the invention is administered as an additive to supplement the nutritive solution fed to the plant in a hydroponic system or, in another particular embodiment, it is administered to the irrigation water of said plant.

(47) The concentration of the growth factor of the invention in the composition can vary within a broad range, typically from at least 10.sup.2 to 10.sup.16 M, usually from at least 10.sup.4 to 10.sup.12 M, more usually from at least 10.sup.6 to 10.sup.11 M, still more usually from at least 10.sup.8 to 10.sup.10 M. Additional technical features of said composition are, for example, the agriculturally acceptable carriers that can be used, the additional components that can be incorporated, its presentation form, the process for obtaining it, etc.

(48) In the sense used in this description, the term agriculturally acceptable carrier includes any substance or combination of substances that can be used in the agricultural sector, and it includes any agriculturally acceptable liquid or solid material that can be added and/or mixed with the growth factor of the invention in order to make it a simpler or improved application form, or with an applicable or desirable activation intensity.

(49) The composition herein described can furthermore contain, if desired, other ingredients or constituents usually used in agricultural compositions, such as, but not limited to, solvents, active agents or pH regulators, fertilizers, etc., provided they all allow or do not jeopardize or compromise the capacity of the growth factor of the invention to increase the plant biomass of a plant. Said ingredients or constituents usually used in agricultural compositions are generally known by the persons skilled in the art.

(50) The composition provided by this invention can be obtained by conventional methods generally based on the mixture of the different components of the composition in the suitable amounts.

(51) As indicated above, the method of the invention can be used on any photosynthetic organism. In a particular embodiment, the method of the invention will be applied to those photosynthetic organisms in which an increase of the biomass is particularly desirable, such as, for example, plants and algae which can be industrially used in any kind of industry. Thus, in a particular embodiment, the photosynthetic organism is a plant, for example, a plant for use in the production of energy, e.g., renewable energies, for human or animal nutrition, wood species, ornamental plants, etc.

(52) Examples of plants the biomass of which is used in the production of fuels or renewable energies include but are not limited to:

(53) (i) plants for use in the production of electric energy: obtained mainly from fast-growing wood energy crops, such as poplar, willow, eucalyptus, locust, coniferous trees, acacia, banana tree, etc., and herbaceous plants, such as thistle, miscanthus, giant reed, euphorbia, prickly pear cacti, etc.; and

(54) (ii) plants for use in the production of biofuels: production of bioalcohols obtained from beet, corn, sweet sorghum, sugar cane, potato, topinambur, etc., and bio-oils obtained from rape seed, sunflower, soy, etc.

(55) As the person skilled in the art will understand, it is also possible to use plant biomass in obtaining thermal energy and producing fuel gases. However, due to the characteristics of these processes (thermal energy consists of applying direct combustion systems to obtain heat, and the production of fuel gases consists of breaking down the biomass in a digester to obtain a gas), the biomass used in the production of said energy can come from any plant.

(56) Examples of wood plants include but are not limited to pine, eucalyptus, cork oak, cedar, oak, holm oak, etc.

(57) Illustrative non-limiting examples of ornamental plants of interest include plants belonging to the Aeschynanthus; Canna; Columnea; Anemone; Azalea; Begonia; Calceolaria; Camelia; Dianthus; Freesia; Gerbera; Hibiscus; Hypoestes; Kalanchoe; Nicotiana; Pelargonium; Petunia; Primula; Ranunculus; Rhipsalidopsis; Rosa; Saintpaulia; Sinningia-gloxinia; Streptocarpus; Tigridia; Verbena; or Zinnia genus. Other ornamental plants include orchids (Orchidaceae family) and ornamental shrubs, which include bay laurel (Laurus nobilis), honeysuckle (Lonicera fragrantissima), star magnolia (Magnolia stellata), hydrangea (Hydrangea macrophylla), Laburnum (Laburnumwatereri), Japanese rose or kerria (Kerria japonica), etc.

(58) Illustrative non-limiting examples of plants used in human or animal nutrition include fruit trees, which include but are not limited to the cherry tree, plum tree, peach tree, apricot tree, olive tree, mango tree, pear tree, apple tree, loquat tree, quince tree, orange tree, lemon tree, fig tree, papaya tree, chestnut tree, oak tree, holm oak tree, kermes oak tree, hazelnut tree, almond tree, walnut tree, etc.; forage plants, which include but are not limited to legumes (for example, clovers, alfalfas, clitorias, arachis, leucaena, bellflowers, etc.), grasses (for example, rye grass, fescue, orchard grass, blue grama grass, rhodes grass, buffel grass, andropogons, brachiarias, Bermuda grass considered grazing grass, and elephant grass, merkeron, sugar cane, Taiwan grass and corn grass, which are harvesting grass, etc.), grains (for example, sorghum, wheat, rye, barley, etc.); plants for human consumption (lettuce, cabbage, spinach, Swiss chard, green beans, tomato plants, etc.), etc.

(59) In another particular embodiment, the photosynthetic organism is an alga, for example, a microalga such as a microalga from the Chlorella, Botryococcus, Nannochloropsis, Haematococcus, Neochloris or Tetraselmis genus; further, illustrative, non-limitative, examples of algae within the context of the present invention include Aonori (Enteromorpha intestinalis) (several species of the green alga Monostroma) (Japan), Arame (Eisenia bicyclis), Badderlocks, jap. Sarumen (Alaria esculenta), Carola (Callophyllis variegata) (South America), Carrageen moss (Mastocarpus stellatus), Chlorella, Laminaria saccharina, Durvillea antarctica, Palmaria palmata, Euchema cottonii, Caulerpa lentillifera, Gulaman, Gulaman-Dagat (Agardhiella tenera), Hijiki o Hiziki (Sargassum fusiforme), Hondawara (Sargassum enerve), Chondrus crispus, Porphyra laciniata/Porphyra umbilicalis, Ulva lactuca, Sargassum echinocarpum, Saccharina japonica, Miru (Codium sp.), Mozuku (Cladosiphon okamuranus), Nori (several species of the red alga Porphyra), Oarweed (Laminaria digitata), Ogonori (several species of the red alga Gracilaria), Fucus vesiculosus, Seatron (Nereocystis luetkeana), Slack (Porphyra purpurea, syn. Porphyra laciniata), Arthrospira platensis, Arthrospira maxima, Thongweed (Himanthalia elongata), Tsunomato (several species of the red alga Chondrus), Wakame (Undaria pinnatifida), etc.

(60) Gene Construct of the Invention

(61) Another possibility contemplated by the present invention to achieve that the growth factor of the invention increases the biomass of a photosynthetic organism consists of inserting in the genome of said photosynthetic organism the nucleotide sequence encoding said growth factor such that when said nucleotide sequence is expressed it has the desired effect in the photosynthetic organism.

(62) Therefore, in another aspect the invention relates to a gene construct, hereinafter, gene construct of the invention, comprising (a) a nucleic acid encoding a peptide which comprises (i) the amino acid sequence

(63) TABLE-US-00009 [SEQIDNO:1] Cys-Xaa.sub.1-Xaa.sub.2-Xaa.sub.3-Xaa.sub.4-Cys wherein Xaa.sub.1, Xaa.sub.2, Xaa.sub.3 and Xaa.sub.4 independently represent an amino acid, and (ii) the cysteine residues of the amino acid sequence shown in (i) form a disulfide bridge between them, and (b) regulating elements for regulating its expression in a photosynthetic organism.

(64) In a particular embodiment, said regulating elements are suitable for regulating the expression of the nucleic acid sequence encoding said peptide in an alga; said elements are known by those skilled in the art.

(65) In another particular embodiment, said regulating elements are suitable for regulating the expression of the nucleic acid sequence encoding said peptide in a plant; said elements are also known by those skilled in the art.

(66) In a particular embodiment, the regulating elements for regulating the expression of the nucleic acid sequence encoding said peptide are heterologous with respect to said nucleic acid sequence, i.e., in the event that said nucleic acid sequence encodes an Arabidopsis protein (e.g., SEQ ID NO: 4, SEQ ID NO: 5 or SEQ ID NO: 6), said nucleic acid sequence is under the control of regulating elements for regulating its expression in a plant different from the regulating elements that naturally regulate the expression of said Arabidopsis proteins in said plant, or in the event that said nucleic acid sequence encodes an Oryza sativa protein (e.g., SEQ ID NO: 8, SEQ ID NO: 9 or SEQ ID NO: 10),said nucleic acid sequence is under the control of regulating elements for regulating its expression in a plant different from the regulating elements that naturally regulate the expression of said Oryza sativa proteins in said plant; or in the event that said nucleic acid sequence encodes an Thalassiosira pseudonana (e.g., SEQ ID NO: 11), said nucleic acid sequence is under the control of regulating elements for regulating its expression in an alga different from the regulating elements that naturally regulate the expression of said Thalassiosira protein in said alga.

(67) The amino acids Xaa.sub.1, Xaa.sub.2, Xaa.sub.3 and Xaa.sub.4 can be identical to or different from one another. In a particular embodiment, Xaa.sub.1, Xaa.sub.2, Xaa.sub.3 and/or Xaa.sub.4 is an amino acid different from Cys.

(68) Therefore, in a particular embodiment, said gene construct of the invention comprises (a) a nucleic acid encoding a peptide which comprises (i) the amino acid sequence

(69) TABLE-US-00010 [SEQIDNO:1] Cys-Xaa.sub.1-Xaa.sub.2-Xaa.sub.3-Xaa.sub.4-Cys wherein Xaa.sub.1, Xaa.sub.2, Xaa.sub.3 and Xaa.sub.4 independently represent an amino acid, and (ii) the cysteine residues of the amino acid sequence shown in (i) form a disulfide bridge between them, and (b) regulating elements for regulating its expression in a photosynthetic organism,
with the proviso that when said nucleic acid sequence (a) encodes a protein selected from the group consisting of the proteins the amino acid sequences of which are shown in SEQ ID NO: 4, SEQ ID NO: 5 and SEQ ID NO: 6, said nucleic acid sequence (a) is under the control of regulating elements for regulating its expression in a plant different from the regulating elements that naturally regulate the expression of said proteins in Arabidopsis sp.;
with the proviso that when said nucleic acid sequence (a) encodes a protein selected from the group consisting of the proteins the amino acid sequences of which are shown in SEQ ID NO: 8, SEQ ID NO: 9 and SEQ ID NO: 10, said nucleic acid sequence (a) is under the control of regulating elements for regulating its expression in a plant different from the regulating elements that naturally regulate the expression of said proteins in Oryza sativa sp.; and
with the proviso that when said nucleic acid sequence (a) encodes a protein whose amino acid sequence is shown in SEQ ID NO: 11, said nucleic acid sequence (a) is under the control of regulating elements for regulating its expression in an alga different from the regulating elements that naturally regulate the expression of said proteins in Thalassiosira pseudonana (diatom).

(70) In a particular embodiment of the gene construct of the invention, said peptide comprises the amino acid sequence

(71) TABLE-US-00011 X.sub.1-Cys-Xaa.sub.1-Xaa.sub.2-Xaa.sub.3-Xaa.sub.4-Cys-X.sub.2
wherein: X.sub.1 represents the amino acid sequence of the amino-terminal end of the peptide, and X.sub.2 represents the amino acid sequence of the carboxyl-terminal end of the peptide.

(72) Although the length of the amino acid sequence of the amino-terminal end of the peptide (X.sub.1) can vary within a broad range, in a particular embodiment X.sub.1 has a length comprised between 1 and 250 amino acids, or even more typically between 1 and 175 amino acids, usually between 1 and 100 amino acids, more usually between 1 and 50 amino acids, even more usually between 2 and 40 amino acids, and yet even more usually between 5 and 35 amino acids.

(73) Likewise, although the length of the amino acid sequence of the C-terminal end of the peptide (X.sub.2) can vary within a broad range, in a particular embodiment, X.sub.2 has a length comprised between 1 and 250 amino acids, or even more typically between 1 and 175 amino acids, usually between 1 and 100 amino acids, more usually between 1 and 50 amino acids, even more usually between 2 and 40 amino acids.

(74) In a particular embodiment, the amino acid sequence of the C-terminal end of the peptide (X2) comprises the amino acid sequence GRRRR (SEQ ID NO: 7), which, in a further particular embodiment, is located at a distance of 10 to 50 amino acids from the last Cys of the sequence Cys-Xaa.sub.1-Xaa.sub.2-Xaa.sub.3-Xaa.sub.4-Cys.

(75) In a particular embodiment, the C-terminal end of X.sub.2 is amidated.

(76) In another particular embodiment, said peptide is selected from the group consisting of adrenomedullin and the proteins the amino acid sequences of which are shown in sequences SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, and SEQ ID NO: 11, as well as their functionally equivalent variants and fragments.

(77) The gene construct of the invention can be obtained by means of using techniques well known in the state of the art [Sambrook et al., 2001. Molecular cloning: a Laboratory Manual, 3.sup.rd ed., Cold Spring Harbor Laboratory Press, N.Y., Vol. 1-3]. Said gene construct of the invention incorporates, operatively bound thereto, regulating elements for regulating its expression in a photosynthetic organism. As it is used in this description, the expression operatively bound means that the nucleic acid encoding the growth factor of the invention [i.e., the peptide comprising the amino acid sequence Cys-Xaa.sub.1-Xaa.sub.2-Xaa.sub.3-Xaa.sub.4-Cys] is expressed in the correct reading frame under the control of the control regulating elements or the expression regulating sequences. The control regulating elements are sequences which control and regulate the transcription and, where appropriate, the translation of the protein, and include promoter sequences, encoding sequences for transcriptional regulators, ribosome-binding sequences (RBS) and/or transcription termination sequences.

(78) The gene construct of the invention can be inserted in the genome of a photosynthetic organism cell, e.g., a plant cell or tissue, or an algal cell, by any suitable method to obtain transformed photosynthetic organisms. Said methods can involve, for example, the use of liposomes, electroporation, diffusion, particle bombardment, microinjection, gene guns, chemical compounds which increase free DNA uptake, for example, co-precipitation with calcium phosphate, viral vectors, etc.

(79) Thus, in another aspect, the invention relates to a vector comprising the gene construct of the invention.

(80) In a particular embodiment, said vector is a vector suitable for the transformation of algae; said vectors are known by the skilled person in the art (e.g., WO 2009149470 discloses methods and compositions for vector-transformed algal cells, wherein the vector comprises a Vcp promoter driving expression of an antibiotic resistance gene in an algal cell.

(81) In another particular embodiment, said vector is a vector suitable for the transformation of plants; said vectors are also known by the skilled person in the art. In a more particular embodiment, vectors suitable for the transformation of plants include those derived from the Agrobacterium tumefaciens Ti plasmid, such as those described in EP 120516. In addition to the transformation vectors derived from the Agrobacterium Ti or Ri plasmids, alternative methods can be used to insert the gene construct in plant cells and tissues, such as, for example, but not limited to, by means of the vacuum infiltration protocol.

(82) On the other hand, both the nucleic acid encoding a peptide which comprises (i) the amino acid sequence Cys-Xaa.sub.1-Xaa.sub.2-Xaa.sub.3-Xaa.sub.4-Cys [SEQ ID NO: 1] wherein Xaa.sub.1, Xaa.sub.2, Xaa.sub.3 and Xaa.sub.4 independently represent an amino acid, and (ii) the cysteine residues of the amino acid sequence shown in (i) form a disulfide bridge between them, [hereinafter, nucleic acid (a)] and the gene construct of the invention can also be incorporated in a vector which includes a prokaryotic replicon, i.e., a DNA sequence capable of directing autonomous replication and keeping the recombinant DNA molecule extrachromosomal when it is introduced in a prokaryotic host cell, such as a bacterium. Said replicons are known in the art. The vectors including a prokaryotic replicon furthermore generally include restriction sites for the insertion of the gene construct. These vectors are known of the state of the art, as is described, for example, in patent U.S. Pat. No. 6,268,552.

(83) Likewise, the vectors can also include markers to check for the presence of heterologous DNA in the photosynthetic organisms, e.g., plant cells and/or tissues, or algal cells, which have been transformed. The genetic markers that allow selecting heterologous DNA in said photosynthetic organisms, e.g., plant cells, include the genes which confer resistance to antibiotics, for example, ampicillin, tetracycline, kanamycin, hygromycin, gentamicin, etc. The neomycin phosphotransferase gene has the advantage of being expressed both in eukaryotic and prokaryotic cells. The marker allows selecting the satisfactorily transformed photosynthetic organisms, e.g., plants, grown in a medium containing the corresponding antibiotic because they incorporate the suitable resistance gene.

(84) The introduction of said nucleic acid (a) as well as the introduction of said gene construct to transform a photosynthetic organism, e.g., a plant cell or tissue, or an algal cell, and generate a transgenic photosynthetic organism, e.g., a transgenic plant or a transgenic alga, can be carried out, as has been mentioned above, by any means known in the state of the art, including but not limited to DNA transfer mediated by A. tumefaciens, preferably with an unarmed T-DNA vector, electroporation, direct DNA transfer, particle bombardment, etc. (for a revision on these topics, see, for example, Marta Izquierdo Rojo in Ingenieria Gentica y Transferencia Gnica, 1999, Ediciones Pirmide, S. A, Madrid).

(85) In another aspect, the invention relates to a host cell comprising said nucleic acid (a), a gene construct according to the invention or a vector as has been described above. Suitable host cells for containing a gene construct according to the invention or a vector as has been described above include but are not limited to prokaryotic cells, yeasts or eukaryotic cells, such as insect cells for example. As the person skilled in the art will understand, depending on the host cell to be transformed, the gene construct of the invention or the vector containing it can contain expression control sequences which can be functional in prokaryotic cells and organisms, for example, bacteria, etc., or functional in eukaryotic cells and organisms, for example, insect cells, mammal cells, etc.

(86) In another aspect, the invention relates to a transgenic plant cell or alga comprising, integrated in its genome, said nucleic acid (a) or said gene construct of the invention. The techniques for culturing transformed plant cells and tissues, or algae, and regenerating transgenic plants or algae are well known in the state of the art, as are the cultivation and growth conditions of said plants or algae (see, for example, Marta Izquierdo (1999) cited above).

(87) Thus, the transgenic plant obtained from a plant cell transformed with the gene construct of the invention, or the alga transformed with the gene construct of the invention, constitutes an additional inventive aspect of the present invention.

(88) Use of the Growth Factor of the Invention

(89) The capacity of the growth factor of the invention to increase the biomass of photosynthetic organism has applications in different industries depending on the photosynthetic organism. Thus, as indicated in previous inventive aspects, the growth factor of the invention can be used in increasing the biomass of algae or plants that are going to be used in the production of energy, in obtaining wood, in human or animal nutrition, or in the floriculture as a way to improve the appearance of ornamental plants.

(90) The following examples illustrate the present invention and must not be considered as being limiting of the scope thereof.

EXAMPLE 1

Increase of Plant Biomass in Carrot and Tobacco Plants

Material and Methods

(91) Carrot (Daucus carota) and tobacco (Nicotiana tabacum) calli were supplied by Carolina Biological Supply Company (Burlington, N.C., USA) and kept under sterile conditions in solid callus initiation medium for carrots or for tobacco respectively (also acquired from Carolina Biological). The specific composition thereof is available in the company's catalog.

(92) A single callus was split into small fragments and these fragments were weighed under sterile conditions and seeded on fresh medium (solid callus initiation medium acquired from Carolina Biologicals) which contained different concentrations of the synthetic peptide human adrenomedullin (AM) (Phoenix Pharmaceuticals, Burlingame, Calif., USA). After 30 days of growth in the dark, the calli were weighed again and the growth rate was calculated as the quotient of the final weight divided by the initial weight.

(93) The dry weight of each sample was calculated by subjecting the calli to an oven drying process at 250 C. for 24 hours.

Results

(94) A growth increase in the calli following a dose-dependent response was observed both in the carrot and in the tobacco (FIG. 1). The most effective concentration of AM for stimulating cell growth was 10.sup.10 M. A more moderate growth increase occurred at lower or higher concentrations. A 60% increase in the biomass when compared with the control was obtained at the optimal dose of AM.

(95) In order to verify that this increase of mass was not due to an increase of tissue hydration, the dry weight of the tissue was measured and it was found that the differences were maintained, indicating that the increase of biomass corresponded to a net growth of the tissues involved.

(96) The effect observed in the callus cells, consisting in an increase of growth (cell proliferation) in callus cells, is perfectly transferred to whole plants. Sometimes the increase in the cell proliferation will affect the organoleptic or physical properties of the plants. However, the biomass increase will be produced in the plants as it is produced in the callus cells.

EXAMPLE 2

Increase of Algal Biomass in Microalgae of the Chlorella genus

Material and Methods

(97) Two identical cultures of Chlorella in Guillard F/2 medium [Guillard, R. R. L. 1975. Culture of phytoplankton for feeding marine invertebrates. pp 26-60. In Smith W. L. and Chanley M. H (Eds.) Culture of Marine Invertebrate Animals. Plenum Press, New York, USA.; Guillard, R. R. L. and Ryther, J. H. 1962. Studies of marine planktonic diatoms. I. Cyclotella nana Hustedt and Detonula confervacea Cleve. Can. J. Microbiol. 8: 229-239] (250 ml each) were prepared in two separate glass flasks. Then, 100 l of said Guillard F/2 medium were added to a flask and 100 l of said Guillard F/2 medium containing the synthetic peptide human adrenomedullin (AM) (Phoenix Pharmaceuticals, Burlingame, Calif., USA) in a sufficient amount to achieve a final concentration of 10.sup.8 M to the other flask.

(98) Air containing 5% CO.sub.2 was continuously bubbled in the culture. The flasks were illuminated with a photoperiod of 12 hours light/12 hours dark.

(99) Aliquots from the medium were periodically collected in order to assess the microalgae growth. Absorbance was measured at 680 nm with a Perkin Elmer Lambda 35 UV/Visible spectrofotometer.

Results

(100) AM-treated microalgae grow up faster and reach the stationary phase sooner than the non-treated microalgae.