FUNCTIONAL AND THERAPEUTIC EFFECTS OF PAR4 CLEAVAGE BY CATHEPSIN G

20230126796 · 2023-04-27

    Inventors

    Cpc classification

    International classification

    Abstract

    Disclosed herein are a synthetic peptide mimetic and compositions comprising the synthetic peptide mimetic that induce activation of and signaling through PAR4. Also disclosed herein are methods of treating a bleeding disorder comprising administering the synthetic peptide.

    Claims

    1. A synthetic peptide mimetic comprising an amino acid sequence of SEQ ID NO: 1.

    2. The synthetic peptide mimetic of claim 1, wherein the synthetic peptide mimetic induces activation of and signaling through PAR4.

    3. The synthetic peptide mimetic of claim 1, wherein the synthetic peptide mimetic induces PAR4-dependent calcium flux.

    4. The synthetic peptide mimetic of claim 1, wherein the synthetic peptide mimetic induces platelet aggregation.

    5. The synthetic peptide mimetic of claim 1, wherein the synthetic peptide mimetic induces platelet activation.

    6. A composition comprising the synthetic peptide mimetic of claim 1.

    7. The composition of claim 6, wherein the composition further comprises a pharmaceutically acceptable carrier.

    8. A method of treating a bleeding disorder, the method comprising administering to a subject a therapeutically effective amount of a synthetic peptide mimetic comprising an amino acid sequence of SEQ ID NO: 1.

    9. The method of claim 8, wherein the synthetic peptide mimetic induces activation of and signaling through PAR4 in the subject.

    10. The method of claim 8, wherein the synthetic peptide mimetic induces PAR4-dependent calcium flux in the subject.

    11. The method of claim 8, wherein the synthetic peptide mimetic induces platelet aggregation in the subject.

    12. The method of claim 8, wherein the synthetic peptide mimetic induces platelet activation in the subject.

    13. The method of claim 8, wherein the bleeding disorder is hemophilia A (factor VIII deficiency), hemophilia B (factor IX deficiency), von Willebrand disease, thrombocytopenia, or bleeding due to qualitative platelet dysfunction.

    14. The method of claim 8, wherein the bleeding disorder is a result caused by cirrhosis of the liver, leukemia, vitamin K deficiency, administration of aspirin, administration of heparin, or administration of warfarin.

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0012] FIGS. 1A-1D shows that platelet aggregation is induced by different neutrophil proteases. FIG. 1A is a bar chart showing activation of washed platelets (n=4) that were treated with varying concentrations of cathepsin G (CatG), elastase, or proteinase 3 (PR3). Platelet activation was measured by PAC-1 binding (mean %±SEM). FIG. 1B is a graph showing representative tracing of washed platelets treated with 400 nM cathepsin G, elastase, or proteinase 3. FIG. 1C is a bar chart showing platelet aggregation data displayed as mean maximum (max)±SEM; n=3 independent experiments. P<0.001 indicates the differences between CatG and the other groups (elastase or proteinase 3). FIG. 1D is a bar chart showing activation of washed platelets (Plts) and neutrophils (PMNs) from healthy donors (n=14) that were suspended in the presence or absence of the neutrophil activating agonist N-formyl-methionyl-leucyl-phenylalanine (fMLP, 10 μM), cytochalasin B (CyB, 5 μg/mL), and/or cathepsin G inhibitor (CatG Inh), 1 μM). Platelet activation was measured by PAC-1 binding and displayed as mean fluorescence intensity (MFI; mean±SEM).

    [0013] FIGS. 2A-2I show that neutrophil cathepsin G cleaves PAR4 at Ser.sup.67-Arg.sup.68 to induce platelet aggregation. FIG. 2A is a bar chart showing the maximum platelet aggregation (percent±SEM) of washed platelets that were treated with varying concentrations of CatG in the presence or absence of the PAR4 inhibitor, BMS-986120 (400 nM BMS; n=5). The PAR1 activation peptide (SFLLRN; 10 μM) served as a negative control (n=5) for PAR4 inhibition. FIG. 2B is a graph showing platelet activation (measured by PAC-1 binding (Ala: n=7; Thr: n=7) and displayed as MFI (mean±SEM) of washed platelets that were stimulated with increasing concentrations of CatG. FIG. 2C is a schematic showing the PAR4 amino acid sequence targeted by RC3 monoclonal antibody (SEQ ID NO: 6), and a graph showing aggregation of platelets treated with thrombin or 200 nM CatG in the presence or absence of RC3. In the schematic, the underlined amino acids in the sequence represent the tethered ligand generated by thrombin, and the arrow represents the location of the canonical thrombin cleavage site. The aggregation studies depicted in the graph were performed with PAR1 blockade using 100 nM vorapaxar, with representative tracing of washed platelets treated with 0.25 U/mL thrombin or 200 nM CatG in the presence or absence of RC3. FIG. 2D is a bar chart showing quantification of maximum (max) platelet aggregation (mean percent±SEM) (n=3 different subjects). FIG. 2E is a schematic showing PAR4-B (SEQ ID NO: 7) and PAR4-C(SEQ ID NO: 8) peptide sequences used in CatG proteolysis analysis by LC-MS/MS. The grey sequence indicates the novel tethered ligand generated by CatG (SEQ ID NO: 1). FIG. 2F is a pair of spectra showing the results of LC-MS/MS performed on PAR4-C in the absence of CatG. Time of flight analysis showed an experimental peak with the correct mass (m) over charge (z) ratio. FIG. 2G is a series of spectra showing the results of LC-MS/MS analysis performed on PAR4-C after incubation with 400 nM CatG at 37° C. for 15 minutes, and the expected m/z ratio of DSDTLELPSS (SEQ ID NO: 9) shown below the experimental graph for reference. Time of flight analysis observed a peak with the correct m/z ratio of a fragment containing the amino acids DSDTLELPSS (the last residue is Ser67), indicating CatG cleaved PAR4-C between Ser67 and Arg.sup.68. FIG. 2H is a graph showing calcium mobilization of WT, mutated PAR4, or empty vector (mock) that were expressed in HEK293T/17 cells treated with or without CatG (2.5 μM) in the presence of PAR1 blockade with 100 nM vorapaxar. FIG. 2I is a graph showing calcium mobilization of WT, mutated PAR4, or empty vector (mock) that were expressed in HEK293T/17 cells and treated with thrombin (1.5 U/mL) in the presence of 100 nM vorapaxar. Solid thick lines and thin vertical lines are means and SEMs, respectively. n=4 independent experiments performed in duplicate in FIGS. 2H-I.

    [0014] FIG. 3 is a bar chart showing that CatG platelet aggregation is not dependent on PAR1. Washed platelets were treated with varying concentrations of CatG in the presence or absence of the PAR1 inhibitor, vorapaxar (100 nM VPX; n=7 no VPX, n=6+VPX) and maximum (max) platelet aggregation (%±SEM) recorded. The PAR1 activation peptide (SFLLRN; 10 μM) served as a as a positive control to indicate that the concentration of VPX efficiently ablated PAR1 activation. n=3 different subjects.

    [0015] FIG. 4 is a graph showing the effect of PAR4 Ala120Thr variant on CatG-induced platelet P-selectin expression. Washed platelets were stimulated with increasing concentrations of CatG and platelet activation was measured by P-selectin (Ala: n=9 different homozygous Ala.sup.120 subjects; Thr: n=9 different homozygous Thr.sup.120 subjects) and displayed as MFI (mean±SEM).

    [0016] FIG. 5 is a graph showing PAR activation induced by different concentrations of thrombin. Representative tracing (of independent experiments) of washed platelets treated with the indicated concentrations of thrombin in the presence or absence of PAR1 inhibitor vorapaxar (100 nM VPX) or PAR4-blocking antibody (RC3). Note 100 nM VPX abolished 0.1 U/mL thrombin-induced platelet aggregation.

    [0017] FIGS. 6A-6B show that cathepsin G has minimal proteolytic effects on a PAR4-B peptide containing the canonical thrombin cleavage site. FIG. 6A is a schematic showing PAR4-B (SEQ ID NO: 7) and PAR4-C(SEQ ID NO: 8) peptide sequences used in mass spectrometry analysis to determine thrombin and cathepsin G cleavage sites. The grey sequence indicates the tethered ligand generated by CatG. FIG. 6B is a series of spectra showing results from Orbitrap liquid chromatography-mass spectrometry (LC-MS/MS) that was performed on PAR4-B in the absence or presence of thrombin (100 U/mL) or cathepsin G (400 nM). Thrombin proteolyzed virtually all of the PAR4-B peptide, whereas CatG left the PAR4-B peptide largely intact.

    [0018] FIGS. 7A-7L show that CatG-generated PAR4 tethered ligand RALLLGWPTR (SEQ ID NO: 1) induces platelet activation and aggregation. FIG. 7A is a graph showing calcium mobilization for WT human PAR4 (hPAR4) or empty vector (mock) that was expressed in HEK293T/17 cells and treated with 1.5 mM RALLLGWPTR (RA-11 mer, solid line) or tyrodes (dash lines). Thick lines and thin vertical lines are means and SEMs, respectively. n=3 independent experiments performed in duplicate. FIGS. 7B and 7C are bar charts showing platelet activation for washed platelets (n=6) that were treated with buffer or 1 mM RA-11 mer, where platelet activation was measured by (FIG. 7B) PAC-1 binding (mean percent±SEM) and (FIG. 7C) P-selectin expression (mean percent±SEM). FIG. 7D is a graph showing representative aggregation tracing of washed platelets treated with 1 mM GYPGQV (GYP; SEQ ID NO: 5), ALLLGVPTR (AL-1 Omer; SEQ ID NO: 2), or RA-11 mer. FIG. 7E is a bar chart showing maximum (max) aggregation of platelets treated with buffer or 1 mM of each indicated peptide (mean percent±SEM; n=5). FIG. 7F is a graph showing representative tracing of platelet calcium flux induced by RA-11 mer (2 mM). Tyrodes buffer served as a negative control. n=4 independent experiments performed in duplicate. FIG. 7G is a graph showing representative tracing of washed platelets treated with 1 mM or 10 mM RA-6mer or 1 mM RA-11 mer. FIG. 7H is a bar chart showing quantification of maximum (max) aggregation (percent±SEM) elicited by treatment of same subjects' platelets with RA-11 mer or RA-6mer (1 mM, n=3). FIG. 7I is a schematic showing dog (SEQ ID NO: 12), human (SEQ ID NO: 11), mouse (SEQ ID NO: 13), and rat (SEQ ID NO: 14) PAR4 sequence alignment of the 12 amino acids adjacent to the plasma membrane of the first (N-terminal) PAR4 extracellular domain. Arrow indicates Arg.sup.68 in humans where CatG cleaves PAR4. FIGS. 7J-7L are graphs showing representative aggregation tracing of dog, human, mouse, and rat washed platelets treated with 1 U/mL human thrombin (FIG. 7J), 1 μM human CatG (FIG. 7K), or 1 mM RA-11 mer (FIG. 7L). n>3 for human and mouse (FIGS. 7J-7L); n=2 for dog and rat (FIGS. 7J-7K); n=2 for rat (FIG. 7L); n=1 for dog (FIG. 7L).

    [0019] FIG. 8 is a graph showing that platelet calcium is induced by RA-11 mer and CatG. Washed platelets were loaded with FURA2-AM for 1 hour. Platelets were washed, resuspended in Tyrodes buffer at 4×10.sup.8 platelets/mL, treated with RALLLGWVPTR (RA-11 mer, 2 mM), CatG (500 nM), ALLLGWVPTR (AL-mer, 2 mM), or Tyrodes buffer, and calcium flux was measured. The mean±SEM is shown. n=3-4 per group.

    [0020] FIG. 9 is a graph showing that platelet aggregation is induced by different concentrations of PAR4 peptides. Washed platelets were treated with the indicated concentrations of GYPGQV (GYP), RALLLGWVPTR (RA-11 mer), or ALLLGWVPTR (AL-10mer) and maximum (max) aggregation measured (%±SEM). n=5 per group.

    DETAILED DESCRIPTION

    [0021] Described herein are a synthetic peptide mimetic and compositions comprising the synthetic peptide mimetic that induce activation of and signaling through PAR4. Also described herein are methods of treating a bleeding disorder comprising administering the synthetic peptide.

    1. DEFINITIONS

    [0022] Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art. In case of conflict, the present document, including definitions, will control. Preferred methods and materials are described below, although methods and materials similar or equivalent to those described herein can be used in practice or testing of the present invention. All publications, patent applications, patents and other references mentioned herein are incorporated by reference in their entirety. The materials, methods, and examples disclosed herein are illustrative only and not intended to be limiting.

    [0023] The terms “comprise(s),” “include(s),” “having,” “has,” “can,” “contain(s),” and variants thereof, as used herein, are intended to be open-ended transitional phrases, terms, or words that do not preclude the possibility of additional acts or structures. The singular forms “a,” “and,” and “the” include plural references unless the context clearly dictates otherwise. The present disclosure also contemplates other embodiments “comprising,” “consisting of,” and “consisting essentially of,” the embodiments or elements presented herein, whether explicitly set forth or not.

    [0024] For the recitation of numeric ranges herein, each intervening number there between with the same degree of precision is explicitly contemplated. For example, for the range of 6-9, the numbers 7 and 8 are contemplated in addition to 6 and 9, and for the range 6.0-7.0, the number 6.0, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, and 7.0 are explicitly contemplated.

    [0025] The term “about” or “approximately” as used herein as applied to one or more values of interest, refers to a value that is similar to a stated reference value, or within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, such as the limitations of the measurement system. In certain aspects, the term “about” refers to a range of values that fall within 20%, 19%, 18%, 17%, 16%, 15%, 14%, 13%, 12%, 11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, or less in either direction (greater than or less than) of the stated reference value unless otherwise stated or otherwise evident from the context (except where such number would exceed 100% of a possible value). Alternatively, “about” can mean within 3 or more than 3 standard deviations, per the practice in the art. Alternatively, such as with respect to biological systems or processes, the term “about” can mean within an order of magnitude, preferably within 5-fold, and more preferably within 2-fold, of a value.

    [0026] “Amino acid” as used herein refers to naturally occurring and non-natural synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids. Naturally occurring amino acids are those encoded by the genetic code. Amino acids can be referred to herein by either their commonly known three-letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Amino acids include the side chain and polypeptide backbone portions.

    [0027] “Binding region” as used herein refers to the region within a target region that is recognized and bound by the synthetic peptide mimetic.

    [0028] As used herein, “bleeding disorder” refers to a group of conditions in which there is a problem with the body's blood clotting process. These disorders can lead to heavy and prolonged bleeding after an injury. Bleeding can also begin on its own.

    [0029] “Coding sequence” or “encoding nucleic acid” as used herein means the nucleic acids (RNA or DNA molecule) that comprise a nucleotide sequence which encodes a protein. The coding sequence can further include initiation and termination signals operably linked to regulatory elements including a promoter and polyadenylation signal capable of directing expression in the cells of an individual or mammal to which the nucleic acid is administered. The coding sequence may be codon optimized.

    [0030] The terms “control,” “reference level,” and “reference” are used herein interchangeably. The reference level may be a predetermined value or range, which is employed as a benchmark against which to assess the measured result. “Control group” as used herein refers to a group of control subjects or cells. A control may be a subject or cell without a synthetic peptide mimetic as detailed herein. A control may be a subject, or a sample therefrom, whose disease state is known. The subject, or sample therefrom, may be healthy, diseased, diseased prior to treatment, diseased during treatment, or diseased after treatment, or a combination thereof.

    [0031] “Nucleic acid” or “oligonucleotide” or “polynucleotide” as used herein means at least two nucleotides covalently linked together. The depiction of a single strand also defines the sequence of the complementary strand. Thus, a polynucleotide also encompasses the complementary strand of a depicted single strand. Many variants of a polynucleotide may be used for the same purpose as a given polynucleotide. Thus, a polynucleotide also encompasses substantially identical polynucleotides and complements thereof. A single strand provides a probe that may hybridize to a target sequence under stringent hybridization conditions. Thus, a polynucleotide also encompasses a probe that hybridizes under stringent hybridization conditions. Polynucleotides may be single stranded or double stranded or may contain portions of both double stranded and single stranded sequence. The polynucleotide can be nucleic acid, natural or synthetic, DNA, genomic DNA, cDNA, RNA, or a hybrid, where the polynucleotide can contain combinations of deoxyribo- and ribo-nucleotides, and combinations of bases including, for example, uracil, adenine, thymine, cytosine, guanine, inosine, xanthine hypoxanthine, isocytosine, and isoguanine. Polynucleotides can be obtained by chemical synthesis methods or by recombinant methods.

    [0032] The term “PAR4 agonist peptide” as used herein refers to a peptide that can fully or partially activate the PAR4 receptor and elicit signaling events and or functional responses associated with PAR4 receptor activation. A PAR4 agonist peptide may be a synthetic peptide mimetic as described herein.

    [0033] A “peptide” or “polypeptide” is a linked sequence of two or more amino acids linked by peptide bonds. The polypeptide can be natural, synthetic, or a modification or combination of natural and synthetic. Peptides and polypeptides include proteins such as binding proteins, receptors, and antibodies. The terms “polypeptide”, “protein,” and “peptide” are used interchangeably herein. “Primary structure” refers to the amino acid sequence of a particular peptide. “Secondary structure” refers to locally ordered, three dimensional structures within a polypeptide. These structures are commonly known as domains, for example, enzymatic domains, extracellular domains, transmembrane domains, pore domains, and cytoplasmic tail domains. “Domains” are portions of a polypeptide that form a compact unit of the polypeptide and are typically 15 to 350 amino acids long. Exemplary domains include domains with enzymatic activity or ligand binding activity. Typical domains are made up of sections of lesser organization such as stretches of beta-sheet and alpha-helices. “Tertiary structure” refers to the complete three-dimensional structure of a polypeptide monomer. “Quaternary structure” refers to the three-dimensional structure formed by the noncovalent association of independent tertiary units. A “motif” is a portion of a polypeptide sequence and includes at least two amino acids. A motif may be 2 to 20, 2 to 15, or 2 to 10 amino acids in length. A motif may include 3, 4, 5, 6, or 7 sequential amino acids. A domain may be comprised of a series of the same type of motif.

    [0034] The term “recombinant” when used with reference to, for example, a cell, nucleic acid, protein, or vector, indicates that the cell, nucleic acid, protein, or vector, has been modified by the introduction of a heterologous nucleic acid or protein or the alteration of a native nucleic acid or protein, or that the cell is derived from a cell so modified. Thus, for example, recombinant cells express genes that are not found within the native (naturally occurring) form of the cell or express a second copy of a native gene that is otherwise normally or abnormally expressed, underexpressed, or not expressed at all.

    [0035] “Sample” or “test sample” as used herein can mean any sample in which the presence and/or level of a target is to be detected or determined or any sample comprising a synthetic peptide mimetic or component thereof as detailed herein. Samples may include liquids, solutions, emulsions, or suspensions. Samples may include a medical sample. Samples may include any biological fluid or tissue, such as blood, whole blood, fractions of blood such as plasma and serum, muscle, interstitial fluid, sweat, saliva, urine, tears, synovial fluid, bone marrow, cerebrospinal fluid, nasal secretions, sputum, amniotic fluid, bronchoalveolar lavage fluid, gastric lavage, emesis, fecal matter, lung tissue, peripheral blood mononuclear cells, total white blood cells, lymph node cells, spleen cells, tonsil cells, cancer cells, tumor cells, bile, digestive fluid, skin, or combinations thereof. In some embodiments, the sample comprises an aliquot. In other embodiments, the sample comprises a biological fluid. Samples can be obtained by any means known in the art. The sample can be used directly as obtained from a patient or can be pre-treated, such as by filtration, distillation, extraction, concentration, centrifugation, inactivation of interfering components, addition of reagents, and the like, to modify the character of the sample in some manner as discussed herein or otherwise as is known in the art.

    [0036] “Subject” and “patient” as used herein interchangeably refers to any vertebrate, including, but not limited to, a mammal that wants or is in need of the herein described compositions or methods. The subject may be a human or a non-human. The subject may be a vertebrate. The subject may be a mammal. The mammal may be a primate or a non-primate. The mammal can be a non-primate such as, for example, cow, pig, camel, llama, hedgehog, anteater, platypus, elephant, alpaca, horse, goat, rabbit, sheep, hamsters, guinea pig, cat, dog, rat, and mouse. The mammal can be a primate such as a human. The mammal can be a non-human primate such as, for example, monkey, cynomolgous monkey, rhesus monkey, chimpanzee, gorilla, orangutan, and gibbon. The subject may be of any age or stage of development, such as, for example, an adult, an adolescent, or an infant. The subject may be male. The subject may be female. In some embodiments, the subject has a specific genetic marker. The subject may be undergoing other forms of treatment.

    [0037] “Synthetic peptide” as used herein refers to chemically synthesized small polymers of amino acids. For example, a synthesis reaction to produce a synthetic peptide may consist of joining the carboxyl group of an amino acid to the amino group of the previous amino acid in the peptide chain. Various reactive groups on the side chains and termini may be chemically protected to prevent undesired reactions from occurring.

    [0038] “Target region” as used herein refers to the region of the target receptor to which the synthetic peptide mimetic is designed to bind.

    [0039] “Treatment” or “treating” or “treatment” when referring to protection of a subject from a disease, means suppressing, repressing, reversing, alleviating, ameliorating, or inhibiting the progress of disease, or completely eliminating a disease. A treatment may be either performed in an acute or chronic way. The term also refers to reducing the severity of a disease or symptoms associated with such disease prior to affliction with the disease. Preventing the disease involves administering a composition of the present invention to a subject prior to onset of the disease. Suppressing the disease involves administering a composition of the present invention to a subject after induction of the disease but before its clinical appearance. Repressing or ameliorating the disease involves administering a composition of the present invention to a subject after clinical appearance of the disease.

    [0040] “Variant” with respect to a peptide or polypeptide that differs in amino acid sequence by the insertion, deletion, or conservative substitution of amino acids, but retain at least one biological activity. Variant may also mean a protein with an amino acid sequence that is substantially identical to a referenced protein with an amino acid sequence that retains at least one biological activity. Representative examples of “biological activity” include the ability to be bound by a specific antibody or polypeptide or to promote a clotting response. Variant can mean a functional fragment thereof. Variant can also mean multiple copies of a polypeptide. The multiple copies can be in tandem or separated by a linker. A conservative substitution of an amino acid, for example, replacing an amino acid with a different amino acid of similar properties (for example, hydrophilicity, degree and distribution of charged regions) is recognized in the art as typically involving a minor change. These minor changes may be identified, in part, by considering the hydropathic index of amino acids, as understood in the art (Kyte et al., J. Mol. Biol. 1982, 157, 105-132). The hydropathic index of an amino acid is based on a consideration of its hydrophobicity and charge. It is known in the art that amino acids of similar hydropathic indexes may be substituted and still retain protein function. In one aspect, amino acids having hydropathic indexes of ±2 are substituted. The hydrophilicity of amino acids may also be used to reveal substitutions that would result in proteins retaining biological function. A consideration of the hydrophilicity of amino acids in the context of a peptide permits calculation of the greatest local average hydrophilicity of that peptide. Substitutions may be performed with amino acids having hydrophilicity values within ±2 of each other. Both the hydrophobicity index and the hydrophilicity value of amino acids are influenced by the particular side chain of that amino acid. Consistent with that observation, amino acid substitutions that are compatible with biological function are understood to depend on the relative similarity of the amino acids, and particularly the side chains of those amino acids, as revealed by the hydrophobicity, hydrophilicity, charge, size, and other properties.

    [0041] Unless otherwise defined herein, scientific and technical terms used in connection with the present disclosure shall have the meanings that are commonly understood by those of ordinary skill in the art. For example, any nomenclatures used in connection with, and techniques of, cell and tissue culture, molecular biology, immunology, microbiology, genetics, and protein and nucleic acid chemistry and hybridization described herein are those that are well known and commonly used in the art. The meaning and scope of the terms should be clear, in the event however of any latent ambiguity, definitions provided herein take precedent over any dictionary or extrinsic definition. Further, unless otherwise required by context, singular terms shall include pluralities and plural terms shall include the singular.

    2. SYNTHETIC PEPTIDE MIMETIC

    [0042] Provided herein are synthetic peptide mimetics. The synthetic peptide mimetic may induce activation of and signaling through Protease-Activated Receptor 4 (PAR4). PARs are integral membrane proteins that are coupled to G-proteins and are activated by specific cleavage of the amino terminal (N-terminal) sequence that exposes a new N-terminal sequence that functions as a tethered ligand, which binds a conserved region on extracellular loop 2 (ECL2) of a PAR. This binding causes a specific conformational change in the PAR and alters the affinity for an intracellular G-protein. PARs can act through G-proteins i (cAMP inhibitory), 12/13 (Rho and Ras activation), and q (calcium signalling). Four types of PARs have been identified and it has been shown that a large group of proteases cleave and activate PARs, including various endogenous proteases such as proteases involved in the coagulation cascade, inflammatory cells, and the digestive tract. In particular, PARs may be activated by serine proteases such as thrombin that acts on PARs 1, 3, and 4, and trypsin that acts on PAR2. PARs can also be specifically cleaved and irreversibly activated by exogenous proteases originated from insects, bacteria, plants, and fungi. An embodiment of the present disclosure provides an 11mer PAR4 agonist peptide or synthetic peptide mimetic (SEQ ID NO: 1) having improvement in potency relative to 10-mer (SEQ ID NO: 2), 8-mer (SEQ ID NO: 3), and two 6-mer (SEQ ID NOs: 4 and 5) agonist peptides or synthetic peptide mimetics.

    [0043] The synthetic peptide mimetic disclosed herein may have an amino acid sequence comprising SEQ ID NO: 1. The synthetic peptide mimetic disclosed herein may have the amino acid sequence of SEQ ID NO: 1. The synthetic peptide mimetic disclosed herein may have an amino acid sequence that is a variant of SEQ ID NO: 1 but that retains the biological function of a peptide having the amino acid sequence of SEQ ID NO: 1. For example, the synthetic peptide mimetic may have a sequence with greater than 80% homology to SEQ ID NO: 1, such as a sequence with greater than 90% homology to SEQ ID NO:1, while still retaining the biological function of the peptide having the amino acid sequence of SEQ ID NO: 1. The synthetic peptide mimetic disclosed herein may be used as an agonist to activate PAR4. The synthetic peptide mimetic described herein may induce PAR4-dependent calcium flux. The synthetic peptide mimetic described herein may induce platelet aggregation, platelet activation, or a combination thereof.

    [0044] The syntheses of the synthetic peptide mimetics described herein can be carried out by any method known in the art. For example, the peptides described herein may be produced by chemical synthesis using various solid-phase techniques such as those described in Barany et al., The Peptides: Analysis, Synthesis, Biology, Volume 2: “Special Methods in Peptide Synthesis, Part A”, pp. 3-284, Gross et al., eds., Academic Press, New York, publ. (1980); and in Stewart et al., Solid-Phase Peptide Synthesis, 2nd Edition, Pierce Chemical Co., Rockford, Ill., publ. (1984). The peptide synthesis may be based on the Fmoc (9-Fluorenylmethyl methyl-oxycarbonyl) group for temporary protection of the α-amino group, in combination with the tert-butyl group for temporary protection of the amino acid side chains (see, for example, Atherton et al., “The Fluorenylmethoxycarbonyl Amino Protecting Group”, in The Peptides: Analysis, Synthesis, Biology, Volume 9: “Special Methods in Peptide Synthesis, Part C”, pp. 1-38, Undenfriend, S. et al., eds., Academic Press, San Diego, publ. (1987).

    [0045] In some embodiments, the peptides can be synthesized in a stepwise manner on an insoluble polymer support (also referred to as “resin”) starting from the C-terminus of the peptide. A synthesis may be begun by appending the C-terminal amino acid of the peptide to the resin through formation of an amide or ester linkage. This allows the eventual release of the resulting peptide as a C-terminal amide or carboxylic acid, respectively. Alternatively, in cases where a C-terminal amino alcohol is present, the C-terminal residue may be attached to 2-Methoxy-4-alkoxybenzyl alcohol resin (SASRIN™, Bachem Bioscience, Inc., King of Prussia, Pa.) and, after completion of the peptide sequence assembly, the resulting peptide alcohol may be released with LiBH4 in THE (see Stewart et al., supra, p. 92).

    [0046] The peptide mimetic may also be synthesized by recombinant methods where the peptide may be produced through recombinant DNA technology. This may involve inserting DNA encoding the peptide into bacterial or mammalian cells, expressing the peptide in the cells, and then purifying the peptide mimetic from the cells using methods known in the art.

    3. COMPOSITIONS

    [0047] Further provided herein are compositions comprising the above-described peptide mimetics. In some embodiments, the composition may comprise from about 0.1 mM to about 30 mM, from about 1 mM to about 30 mM, from about 5 mM to about 30 mM, from about 10 mM to about 30 mM, from about 15 mM to about 30 mM, from about 20 mM to about 30 mM, from about 25 mM to about 30 mM, from about 0.1 mM to about 25 mM, from about 0.1 mM to about 20 mM, from about 0.1 mM to about 15 mM, from about 0.1 mM to about 10 mM, from about 0.1 mM to about 5 mM, or from about 0.1 mM to about 1 mM of the peptide mimetic. The peptide mimetics as detailed herein may be formulated into compositions in accordance with standard techniques well known to those skilled in the pharmaceutical art. The compositions can be formulated according to the mode of administration to be used. In cases where compositions are injectable compositions, the compositions may be sterile, pyrogen free, and particulate free. An isotonic formulation may also be used. Generally, additives for isotonicity may include sodium chloride, dextrose, mannitol, sorbitol, and lactose. In some cases, isotonic solutions such as phosphate buffered saline may be preferred. Stabilizers may include gelatin and albumin. In some embodiments, a vasoconstriction agent may be added to the formulation.

    [0048] The composition may further comprise a pharmaceutically acceptable excipient. The pharmaceutically acceptable excipient may include functional molecules as vehicles, adjuvants, carriers, or diluents. The term “pharmaceutically acceptable carrier,” may be a non-toxic, inert solid, semi-solid or liquid filler, diluent, encapsulating material, or formulation auxiliary of any type. Pharmaceutically acceptable carriers may include, for example, diluents, lubricants, binders, disintegrants, colorants, flavors, sweeteners, antioxidants, preservatives, glidants, solvents, suspending agents, wetting agents, surfactants, emollients, propellants, humectants, powders, pH adjusting agents, and combinations thereof. The pharmaceutically acceptable excipient may be an electroporation or microinjection facilitating agent.

    [0049] The composition may further comprise one or more additional therapeutic agent(s). The additional therapeutic agent(s) may be agent(s) that induce clotting or platelet aggregation such as clotting factor products, ACE 910 or emicizumab, desmopressin acetate, epsilon amino caproic acid, cryoprecipitate, and the like.

    4. ADMINISTRATION

    [0050] The peptide mimetics disclosed herein or compositions comprising the same may be administered or delivered to a cell. The cell may be a platelet. The cell may be in a subject. Methods of introducing a peptide into a host cell are known in the art, and any known method can be used to introduce a peptide into a cell. Suitable methods may include, for example, electroporation, direct micro injection, and the like. The peptide mimetic or composition comprising the same may be electroporated using BioRad Gene Pulser Xcell or Amaxa Nucleofector IIb devices or other electroporation device.

    [0051] The peptide mimetics as detailed herein or the pharmaceutical compositions comprising the same may be administered to a subject. Such compositions can be administered in dosages and by techniques well known to those skilled in the medical arts taking into consideration such factors as the age, sex, weight, and condition of the particular subject, and the route of administration. The presently disclosed peptide mimetics or compositions comprising the same may be administered to a subject by different routes including orally, parenterally, sublingually, transdermally, rectally, transmucosally, topically, intranasal, intravaginal, via inhalation, via buccal administration, intrapleurally, intravenous, intraarterial, intraperitoneal, subcutaneous, intradermally, epidermally, intramuscular, intranasal, intrathecal, intracranial, intraarticular, or combinations thereof. In certain embodiments, the peptide mimetic or composition comprising the same may be administered to a subject intravenously. The peptide mimetics or compositions comprising the same may be delivered to a subject by several technologies including liposome mediated, nanoparticle facilitated, recombinant vectors such as recombinant lentivirus, recombinant adenovirus, and recombinant adenovirus associated virus. For veterinary use, the peptide mimetics or compositions comprising the same may be administered as a suitably acceptable formulation in accordance with normal veterinary practice. The veterinarian may readily determine the dosing regimen and route of administration that is most appropriate for a particular animal. The peptide mimetics or compositions comprising the same may be administered by traditional syringes, or other physical methods such as electroporation (“EP”), “hydrodynamic method”, or ultrasound.

    5. METHODS

    [0052] a. Methods of Treating a Bleeding Disorder

    [0053] Provided herein are methods of treating a bleeding disorder. The methods may include administering to a subject a therapeutically effective amount of a synthetic peptide mimetic as detailed herein or a composition comprising the same. After administration, the synthetic peptide mimetic may induce activation of and signaling through PAR4 in the subject. After administration, the synthetic peptide mimetic may induce PAR4-dependent calcium flux in the subject. After administration, the synthetic peptide mimetic may induce platelet aggregation in the subject. After administration, the synthetic peptide mimetic may induce platelet activation in the subject.

    [0054] The bleeding disorder may be hemophilia A (factor VIII deficiency), hemophilia B (factor IX deficiency), von Willebrand disease, thrombocytopenia, or bleeding due to qualitative platelet dysfunction. The bleeding disordermay be a result caused by cirrhosis of the liver, leukemia, vitamin K deficiency, administration of aspirin, administration of heparin, or administration of warfarin.

    [0055] b. Methods of Inducing Platelet Activation or Aggregation

    [0056] Provided herein are methods of inducing platelet activation or aggregation. The methods may include administering to a cell or a subject a therapeutically effective amount of a synthetic peptide mimetic as detailed herein or a composition comprising the same.

    6. EXAMPLES

    [0057] The foregoing may be better understood by reference to the following examples, which are presented for purposes of illustration and are not intended to limit the scope of the invention. The present disclosure has multiple aspects and embodiments, illustrated by the appended non-limiting examples.

    Example 1

    Materials and Methods

    [0058] Subject recruitment and genotyping. Venous blood was drawn into acid citrate dextrose (BD, Franklin Lakes, N.Y., USA) following written consent obtained with approval from the Institutional Review Board of the University of Utah (IRB 00095539). Healthy donors over the age of 18 were genotyped for rs773902 F2RL3 (Ala120Thr) using the TaqMan SNP Genotyping Assay (Life Technologies, Carlsbad, Calif., USA). Donors were excluded based on the following criteria: pregnancy, diagnosed bleeding disorder, use of more than one prescription medication, or daily use of antiplatelet, anticoagulants, or non-steroidal anti-inflammatory (NSAID) medications. Prior to donation, donors must have abstained from any use of NSAIDs for greater than 72 hours. Samples were excluded from analysis if platelets failed to aggregate to arachidonic acid or blood displayed abnormal closure time to epinephrine/collagen cartridges (Siemens) while maintaining normal ADP/collagen closure (Siemens) time assessed using the PFA-100 (Siemens), suggesting use of NSAIDs prior to donation.

    [0059] Animal studies. Mouse platelets were isolated as previously described from C57BL/6 mice (Denorme et al., Blood. 2020; 135(6):429-440). Dog platelets were isolated from whole blood drawn into ACD using a similar isolation procedure as for human platelets. All animal studies were approved by the University of Utah Institutional Animal Care and Use Committee (18-10012).

    [0060] Platelet and neutrophil isolation. Platelets and neutrophils were isolated as previously described (Yost et al., J Clin Invest. 2016; 126(10):3783-3798). Platelet isolation from dogs, rats and mice was approved by the IACUC. Platelet activation and aggregation were performed as previously described (Manne et al., Blood. 2020; 136(11):1317-1329).

    [0061] Platelet isolation, aggregation, and activation. Human washed platelets were prepared and resuspended in Tyrode's Buffer at 2×10.sup.8/mL as described (Edelstein et al., Nat Med. 2013; 19(12):1609-1616). For human and dog platelet comparisons, platelets were prepared using a modified human platelet protocol with final concentrations of 1 μM PGE1 (Cayman Chemical, Ann Arbor, Mich., USA) used during centrifugation steps. Centrifugations after Tyrode's washes was decreased to 1,250×g as described in Cremer et al., PLoS One. 2019; 14(11):e0224891. Platelet aggregation was measured under stirring conditions at 37° C. using a PAP-8E aggregometer after treatment with the following agonists: arachidonic acid (Bio/Data Corporation, Horsham, Pa., USA), cathepsin G, elastase, proteinase 3 (Athens Research Group), α-thrombin (Sigma, St. Louis, Mo., USA), PAR-1 peptide (SFLLRN) (GL Biochem, China). P-selectin and PAC-1 were measured as previously described (Yee et al., J Thromb Haemost. 2006; 4(9):2043-2050; Tourdot et al., Arterioscler Thromb Vasc Biol. 2014; 34(12):2644-2650).

    [0062] Neutrophil-Platelet Activation Assays. Neutrophils were isolated from whole blood using positive selection with CD15 microbeads as previously described (Middleton et al., Blood. 2020; 136(10):1169-1179). Neutrophils were resuspended in PBS+10% BSA at 4×10.sup.6 neutrophils/mL. Platelets from the same donor (5×10.sup.7/mL) were incubated with FITC conjugated PAC1 antibody for 10 mins at 37° C. prior to addition of neutrophils. Neutrophils were activated with 10 μm N-formylmethionine-leucyl-phenylalanine (fMLP) and 10 μg/mL cytochalasin B (Sigma, St. Louis, Mo., USA) and incubated at 37° C. for 60 minutes followed by fixation with 4% paraformaldehyde. In some experiments, a specific CatG inhibitor (Cathepsin G Inhibitor I, Sigma, St. Louis, Mo., USA) was added. Platelet activation was measured by flow cytometric analysis using the Cytoflexflow cytometer (Beckman Coulter, Pasadena, Calif., USA).

    [0063] Antagonist Studies. Washed platelets were incubated for 15 minutes at 37° C. with PAR-4 blocking antibody RC3 (100 μg/mL) (generous gift from Regeneron Pharmaceuticals; French et al., Blood Adv. 2018; 2(11):1283-1293), PAR-1 inhibitor vorapaxar (100 nM), and/or PAR-4 inhibitor BMS-986120 (400 nM) (Cayman Chemical, Ann Arbor, Mich., USA).

    [0064] PAR4 calcium flux assays. PAR4-dependent calcium flux was measured using Fura2-QBT in platelets and HEK293T/17 cells with wild-type (WT) and mutant PAR4 (Tourdot et al., Arterioscler Thromb VascBiol. 2014; 34(12):2644-2650).

    [0065] PAR4 mutant calcium flux assays. Using Quikchange Lightning Site-Directed mutagenesis (Agilent) per manufacturing instructions, pCMV-Flag-PAR4-S66E, pCMV-Flag-PAR4-S67E, and pCMV-Flag-PAR4-R68E were generated from mutation of pCMV-Flag-PAR4 and confirmed by sequencing (University of Utah DNA Sequencing Core). Prior to transfection, HEK293T/17 cells (ATCC CRL-11268) were seeded at 4.5×10.sup.4/mL. The following day, cells were transfected with the plasmid of interest using Lipofectamine 2000 (Invitrogen, Carlsbad, Calif., USA). Twenty-four hours after transfection, media was removed and replaced with Optimem w/Glutamax (Gibco, Carlsbad, Calif., USA) containing vorapaxar (100 nM) (Cayman Chemical, Ann Arbor, Mich., USA) and Fura2-QBT (Molecular Devices). Following incubation for 1 hour at 37° C., plate was placed in the Flexstation 3 (Molecular Devices) where agonists, Tyrode's Buffer, cathepsin G (2.5 μM), or α-thrombin (1.5 U/mL), were injected onto cells and calcium mobilization was monitored and recorded.

    [0066] Platelet calcium flux assay. Washed platelets were incubated at 37° C. for 1 hour in Tyrode's buffer (supplemented with pgel and heparin) with Fura-2AM (final concentration 2 μM). Platelets were washed and resuspended to a final concentration of 4×10.sup.8/mL. Platelets were dispensed into a Costar 96-well half area clear bottom plate and placed in the Flexstation 3 (Molecular Devices) where cathepsin G (500 nM), buffer, or peptides (2 mM) were injected onto cells and calcium flux monitored.

    [0067] PAR-4 Peptide and Cleavage Analysis. PAR4 synthetic peptides were incubated with protease, snapped frozen, and sent for mass spectrometry analysis. PAR-4B (DDSTPSILPAPRGYPGQVCANDS; SEQ ID NO: 7) and PAR-4C (DSDTLELPDSSRALLLGWPTR; SEQ ID NO: 8) were synthesized by BIOMATIK (Wilmington, Del., USA). PAR4-B and PAR4-C were incubated with vehicle, thrombin (100 nM) or cathepsin G (400 nM) at 37° C. for 15 minutes to an hour depending on the experimental condition. After digestion with the indicated protease, reactions were snapped frozen and sent to the University of Arizona, Analytical and Biological Mass Spectrometry Core Facility (Tucson, Ariz.) for analysis. LC-MS/MS analysis was done on a Q Exactive Plus mass spectrometer (Thermo Fisher Scientific, San Jose, Calif.) equipped with an EASY-Spray nanoESI source. Peptides (500 ng) were injected onto an Acclaim Pepmap 100 trap column (75 micron ID×2 cm, Thermo Scientific), washed for 10 min at 3% mobile phase B (acetonitrile, 0.1% formic acid, mobile phase A consisting of water and 0.1% formic acid) then eluted onto an Acclaim PepMap RSLC analytical column (75 micron ID×25 cm, Thermo Scientific using a 3-20% gradient of B over 40 min, 20-50% solvent B over 5 min, 50-95% of solvent B over 5 min, then a hold of solvent 95% B for 10 min, and finally a return to 3% solvent B for 1 min, then a hold at 3% B for 10 min. Flow rates were 300 nL/min using a Dionex Ultimate 3000 RSLCnano System (Thermo Scientific). Data dependent scanning was performed by the Xcalibur v 4.1.31.9 software (Andon et al., Proteomics. 2002; 2(9):1156-1168) using a survey scan at 70,000 resolution scanning mass/charge (m/z) 350-1600 at an automatic gain control (AGC) target of 1e6 and a maximum injection time (IT) of 65 msec, followed by higher-energy collisional dissociation (HCD) tandem mass spectrometry (MS/MS) at 27nce (normalized collision energy), of the 11 most intense ions at a resolution of 17,500, an isolation width of 1.5 m/z, an AGC of 1e5 and a maximum IT of 65 msec. Dynamic exclusion was set to place any selected m/z on an exclusion list for 30 seconds after a single MS/MS. Ions of charge state+7, 8, >8, unassigned, and isotopes were excluded from MS/MS. MS and MS/MS data were searched against the N-terminal amidated PAR4 sequence using Proteome Discoverer v. 2.4.0.305 (Thermo Scientific). The peptide identification results were further analyzed with Scaffold Q+S v 4.8.7 (Proteome Software Inc., Portland Oreg.), a program that relies on various search engine results (i.e.: Sequest, X!Tandem, MASCOT) and which uses Bayesian statistics to reliably identify more spectra9.

    [0068] GYPGQV-NH.sub.2 (SEQ ID NO: 5), RALLLGWVPTR-NH.sub.2 (SEQ ID NO: 1), ALLLGWVPTR-NH.sub.2 (SEQ ID NO: 2), RALLLG-NH.sub.2 (SEQ ID NO: 4). Peptides were synthesized by BIOMATIK (Wilmington, Del., USA) at similar purities. All peptides were suspended in 50% DMSO and 50% ethanol. To measure platelet activation, washed platelets were stimulated with various concentrations of the peptide in the presence of CD41-APC, P-selectin (PE) and PAC-1 (FITC) for 15 minutes at 37° C. and then fixed with FACS Lysis Buffer. Samples were immediately run on a Cytoflex flow cytometer. In some experiments, platelets were stimulated with peptides and platelet aggregation performed as described above. Platelet calcium flux was induced by RALLLGWVPTR (2 mM; SEQ ID NO: 1), CatG (500 nM), ALLLGWVPTR (2 mM; SEQ ID NO: 2) or tyrodes buffer and monitored as described above.

    [0069] Statistical Analysis. All statistical analyses were performed using GraphPad Prism (v9.0.0; San Diego, Calif.). Data comparison of two normally distributed groups was conducted using a two-tailed Student's or paired t-test. Comparison of three or more normally distributed groups with equal variances was done using a repeated measures or independent one-way analysis of variance with post-hoc Tukey's or Bonferroni's multiple comparisons test. Brown-Forsythe and Welch ANOVA test with post-hoc Dunnett's T3 multiple comparisons test was used for comparisons of groups with unequal variances. Comparison of two or more normally distributed groups under the influence of two independent variables was assessed using repeated measures, mixed effects, or independent two-way analysis of variance with post-hoc Bonferroni's multiple comparisons test. A P-value of <0.05 was considered statistically significant.

    Example 2

    CatG Elicits Platelet Activation and Aggregation Through PAR4 Signaling

    [0070] Of the major serine proteases released from neutrophils, CatG was the only protease to induce platelet aggregation and αIIbβ3 activation (FIGS. 1A-1D). FIG. 1A shows the effect of neutrophil activation on platelet activation is mediated in large part by CatG. Using PAR-specific inhibitors, it was observed that CatG-dependent platelet activation was mediated by PAR4 and not PAR1 (FIG. 2A; FIG. 3). Because platelet-neutrophil interactions are critical in stroke pathophysiology and a common PAR4 Ala.sup.120Thr variant has been associated with human stroke risk, the effect of this variant on CatG-induced platelet activation was studied. Compared with platelets from homozygous Ala.sup.120 individuals, CatG stimulation of platelets homozygous for the racially divergent and hyperreactive PAR4 Thr.sup.120 variant demonstrated modest but significantly greater αIIbβ3 activation and P-selectin expression (FIG. 2B; FIG. 4). Thus, neutrophil-released CatG may contribute to the increased stroke risk associated with the PAR4Thr.sup.120 variant.

    [0071] Thrombin cleavage of PAR4 at Arg.sup.47-Gly.sup.48 is blocked by the monoclonal antibody RC3.6 RC3 had little effect on CatG-induced platelet aggregation despite largely abolishing thrombin-induced aggregation (FIGS. 2C-2D; FIG. 5) (note thrombin activation of PAR1 was blocked in FIGS. 2C-2D, as determined by FIG. 5). These results suggest CatG cleaves PAR4 at a site different than thrombin. It is not clear why this data apparently differ from previous observations using a polyclonal antibody to PAR4 (French et al., Blood Adv. 2018; 2(11):1283-1293; Sambrano et al., J Biol Chem. 2000; 275(10):6819-6823) since the antibodies were raised against the same sequence, but perhaps the polyclonal antibody also blocked the CatG cleavage site while monoclonal RC3 does not.

    Example 3

    CatG Proteolysis of PAR4 N-Terminal Extracellular Sequence

    [0072] To examine the possible cleavage fragments generated by CatG, two portions of the PAR4 extracellular N-terminus were synthesized and analyzed by LC-MS/MS: PAR4-B (SEQ ID NO: 7) containing the thrombin cleavage site, and PAR4-C(SEQ ID NO: 8), downstream of the thrombin cleavage site (FIG. 2E). As expected, PAR4-B was cleaved by thrombin between amino acids Arg47 and Gly48, while little cleavage was observed with CatG (FIG. 6). In contrast, thrombin failed to cleave PAR4-C, while CatG cleavage generated several fragments, including DSDTLELPSS (FIG. 2G; SEQ ID NO: 9). Identification of the DSDTLELPSS fragment (amino-terminal sequence of PAR4-C) indicated CatG cleavage between Ser67 (S67)-Arg68 (R68). As a control, in the absence of thrombin or CatG, PAR4-B and PAR4-C remained intact in these analyses (FIG. 2F; FIG. 6).

    Example 4

    Mutations of Amino Acids Ser.SUP.67 .and Arg.SUP.68 .Decrease CatG-Stimulated PAR4-Mediated Calcium Signaling

    [0073] To specifically examine if CatG induces PAR4 activation and signaling by cleaving Ser.sup.67-Arg.sup.68, calcium flux was assessed using various PAR4 mutants. HEK cells transfected with WT PAR4 demonstrated increased calcium flux when treated with CatG compared with mock transfection (FIG. 2H). CatG activation of HEK cells expressing either PAR4 mutated Ser.sup.67 to Glu (S67E) or Arg.sup.68 to Glu (R68E) resulted in significantly less calcium flux than WT (P<0.001) (FIG. 2H). Notably, the PAR4 S67E and R68E mutants induced minimal calcium flux above baseline, such that we cannot exclude other minor CatG cleavage sites indicated by the mass spectrometry data (FIG. 2H; FIG. 6) could induce receptor activation, as has been shown with elastase-cleavage of PAR2. Since neighboring amino acids can be critical in protease cleavage, a Ser.sup.66 (S66E) mutant was generated that showed a slight decrease in CatG-induced calcium flux compared with WT and a significantly greater calcium flux than mock transfection (FIG. 2H). None of the PAR4 mutants were significantly different than WT when stimulated by thrombin in the presence of a PAR1 inhibitor (FIG. 2I). Taken together, these data support CatG, but not thrombin, cleavage of PAR4 between Ser.sup.67-Arg.sup.68.

    Example 5

    Functional Characterization of CatG-Generated PAR4 Tethered Ligand

    [0074] A synthetic peptide RALLLGWVPTR (SEQ ID NO: 1) representing the CatG-generated PAR4 tethered ligand was synthesized to assess its potential functionality. RALLLGWVPTR induced calcium flux in HEK cells transfected with WT PAR4 compared with mock, indicating the tethered ligand induces signaling through PAR4 (FIG. 7A). Platelets treated with RALLLGWVPTR demonstrated increased integrin activation, a granule release, and platelet aggregation (FIGS. 7B-7E). In addition, RALLLGWVPTR induced a significant and sustained calcium flux in platelets similar to other peptide-tethered ligands (FIG. 7F). Peak calcium flux was similar between CatG and RALLLGWVPTR, and consistent with previous literature, CatG-induced platelet calcium flux decreased overtime (FIG. 8).

    [0075] LC-MS/MS analysis also indicated a minor CatG cleavage between Arg.sup.68 and Ala.sup.69 under the conditions of the experiment, so an ALLLGWVPTR 10mer was also synthesized (SEQ ID NO: 2). However, platelets exposed to ALLLGWVPTR displayed no discernable platelet aggregation or calcium flux (FIGS. 7D-7E; FIG. 8) independent of peptide concentration (FIG. 8 and FIG. 9). Notably, 1 mM RALLLGWVPTR produced maximal platelet aggregation, while 6 mM GYPGQV (the thrombin-generated PAR4 tethered ligand; SEQ ID NO: 5) was necessary to induce maximal platelet aggregation consistent with previous literature, demonstrating high concentrations of GYPGQV are needed to induce receptor activation (FIGS. 7D-7E; FIG. 9). The CatG-generated tethered ligand appears to be a more potent activator of PAR4 than the thrombin-generated tethered ligand, but the CatG enzyme is much less potent than the thrombin enzyme. Perhaps thrombin has greater affinity for the PAR4 extracellular domain than does CatG.

    [0076] PAR4 signaling can be induced by the thrombin-tethered ligand with as few as 6 amino acids (GYPGQV), but a 6mer from the CatG tethered ligand (RALLLG; SEQ ID NO: 4) was not able to induce platelet aggregation (FIGS. 7G-7H). We also synthesized an intermediate length peptide, RALLLGWV 8mer (SEQ ID NO: 3), but were unable to test its activating potential due to its inability to go into solution despite numerous attempts with different solvents. Having said that, perhaps the hydrophobic portion of the C-terminus of RALLLGWVPTR stabilizes the tethered ligand on the platelet plasma membrane.

    Example 6

    Genetics of PAR4 Variants

    [0077] Conservation of amino acid sequence across species can be supportive and informative of sequence function. Table 1 shows the sequence alignments of PAR4 N-terminal from 12 animals (extracellular membrane is underlined), 4 of which are shown in FIG. 7I. Human thrombin induced platelet aggregation in humans, dogs, mice, and rats (FIG. 7J), whereas human CatG only induced platelet aggregation in humans and dogs (FIG. 7K). Similar to CatG, the RA-11 mer induced aggregation only in humans and dogs (FIG. 7L). Dog platelets were not as responsive to human CatG, perhaps due to inefficient binding of human CatG to dog PAR4 or the substitution of an alanine for a proline in the dog PAR4 sequence. Furthermore, the human RA-11 mer could be less effective binding to the dog PAR4 extracellular domain that mediates the signaling response to the dog tethered ligand. This genetic data lends support to the mutagenesis and functional peptide data regarding the importance of Arg.sup.68 in mediating CatG-mediated PAR4 cleavage and activation. Perhaps the positive charge of Arg.sup.68 is important for the activity of the tethered ligand (mouse Gln is uncharged while rat Glu is negatively charged).

    TABLE-US-00001 TABLE 1 Sequence alignments of PAR4 across species thromb cleav RG Hsap SR is novel CatG cleavage site (S67/R68) SEQ ID NO: human Hsap 37- 15 DSTPSILPAPRGYPGQVCANDSDTLELPDSSRALLLGWVPT RLVPALYGLVLVVGLPANGLALWVLATQ gorilla Ggor DSTPSILPAPRSYPGQVCANDSDTLELPDSSRALLLGWVPT 16 RLVPALYGLVLVVGLPANGLALWVLATQ human Hsap 37- 15 DSTPSILPAPRGYPGQVCANDSDTLELPDSSRALLLGWVPT RLVPALYGLVLVVGLPANGLALWVLATQ Olive Panu DSTPSILPAPRGYPGQVCANDSDILELPDSSRALLLGWVPT 17 baboon RLVPALYGLVLAVGLPANGLALWVLATR human Hsap 37- 15 DSTPSILPAPRGYPGQVCANDSDTLELPDSSRALLLGWVPT RLVPALYGLVLVVGLPANGLALWVLATQ green Csab ESTPSILPAPRGYPGQVCANDSDILELPDSSRALLLGWVPT 18 monkey RLVPALYGLVLAVGLPANSLALWVLATR human Hsap 37- 15 DSTPSILPAPRGYPGQVCANDSDTLELPDSSRALLLGWVPT RLVPALYGLVLVVGLPANGLALWVLATQ North Ogar EATLLFPQQPRSFPGCVFTNNSDILEIPDSSRALLLGWVPT 19 greater RLVPTLYGLVLVVGLPANGLALWVLATQ galago human Hsap 37- 15 DSTPSILPAPRGYPGQVCANDSDTLELPDSSRALLLGWVPT RLVPALYGLVLVVGLPANGLALWVLATQ Lemur Pcoq ATAPPFPGRPLSFPGQVCANDSDTLELPDRSRALLLGWVPT 20 RLVPALYGLVLAVGLPANALALWVLAAK human Hsap 37- 15 DSTPSILPAPRGYPGQVCANDSDTLELPDSSRALLLGWVPT RLVPALYGLVLVVGLPANGLALWVLATQ goat Chir GDDSTPRPHPRSFPGCPCANDSNTLELPPNSRALLLGWVPT 21 KLVPALYGLVLAVGLPANSLALWVLATQ human Hsap 37- 15 DSTPSILPAPRGYPGQVCANDSDTLELPDSSRALLLGWVPT RLVPALYGLVLVVGLPANGLALWVLATQ cat Fcat REGSPLPPKLRSFPGRPWANSSDEVEISDGSRALLLGWVPT 22 RLVPALYGLTLLVGLPANGLALWVLATR human Hsap 37- 15 DSTPSILPAPRGYPGQVCANDSDTLELPDSSRALLLGWVPT RLVPALYGLVLVVGLPANGLALWVLATQ dog Clfa QEGTPHSPHLRSFPGQPWANNSEILEIPESSRALLLGWVAT 23 RLVPAVYGLALLVGLPANGLALWVLATR human Hsap 37- 15 DSTPSILPAPRGYPGQVCANDSDTLELPDSSRALLLGWVPT RLVPALYGLVLVVGLPANGLALWVLATQ mouse Mmus EPKSSDKPNPRGYPGKFCANDSDTLELPASSQALLLGWVPT 24 RLVPALYGLVVAVGLPANGLALWVLATR human Hsap 37- 15 DSTPSILPAPRGYPGQVCANDSDTLELPDSSRALLLGWVPT RLVPALYGLVLVVGLPANGLALWVLATQ rat Rnor ESKSPDKPNPRGFPGKPCANNSDTLELPASSEALLLGWVPT 25 RLVPAIYGLVVVVGLPANGLALWVLATR human Hsap 37- 15 DSTPSILPAPRGYPGQVCANDSDTLELPDSSRALLLGWVPT RLVPALYGLVLVVGLPANGLALWVLATQ Collared Falb PCPRAIPGDQARVNNVTYLLVPAYLLVPAGTRAQLGSAVTV 26 flycatcher RLIPGLYSLVLALGLPANALALRALAA- (bird) human Hsap 37- 15 DSTPSILPAPRGYPGQVCANDSDTLELPDSSRALLLGWVPT RLVPALYGLVLVVGLPANGLALWVLATQ common Ccar RRGPL-------------------P- 27 carp SPTTLTLVVPLLYFLAFFIGLPTNLLALWVLLLQTKKLP

    [0078] There are a relatively small number of serine protease-generated functional PAR tethered ligands. Identifying the potentially diverse array of PAR tethered ligands may be important if they activate different cellular signaling pathways or vary by pathophysiologic conditions. In certain clinical settings, such as those with extensive platelet-neutrophil interactions or leukocytosis in malignancy, CatG may dampen or eliminate thrombin signaling through PAR1 and PAR4, while the CatG tethered ligand could induce persistent PAR4 signaling. PAR4 is also expressed in non platelet tissues, where inflammation alters function and expression levels, and CatG could affect activation. Lastly, in hemorrhagic conditions, the RALLLGWVPTR peptide could be therapeutic for rescuing or enhancing platelet reactivity.

    [0079] The foregoing description of the specific aspects will so fully reveal the general nature of the invention that others can, by applying knowledge within the skill of the art, readily modify and/or adapt for various applications such specific aspects, without undue experimentation, without departing from the general concept of the present disclosure. Therefore, such adaptations and modifications are intended to be within the meaning and range of equivalents of the disclosed aspects, based on the teaching and guidance presented herein. It is to be understood that the phraseology or terminology herein is for the purpose of description and not of limitation, such that the terminology or phraseology of the present specification is to be interpreted by the skilled artisan in light of the teachings and guidance.

    [0080] The breadth and scope of the present disclosure should not be limited by any of the above-described exemplary aspects, but should be defined only in accordance with the following claims and their equivalents.

    [0081] All publications, patents, patent applications, and/or other documents cited in this application are incorporated by reference in their entirety for all purposes to the same extent as if each individual publication, patent, patent application, and/or other document were individually indicated to be incorporated by reference for all purposes.

    [0082] For reasons of completeness, various aspects of the invention are set out in the following numbered clauses:

    [0083] Clause 1. A synthetic peptide mimetic comprising an amino acid sequence of SEQ ID NO: 1.

    [0084] Clause 2. The synthetic peptide mimetic of clause 1, wherein the synthetic peptide mimetic induces activation of and signaling through PAR4.

    [0085] Clause 3. The synthetic peptide mimetic of clause 1 or clause 2, wherein the synthetic peptide mimetic induces PAR4-dependent calcium flux.

    [0086] Clause 4. The synthetic peptide mimetic of any one of clauses 1-3, wherein the synthetic peptide mimetic induces platelet aggregation.

    [0087] Clause 5. The synthetic peptide mimetic of any one of clauses 1-4, wherein the synthetic peptide mimetic induces platelet activation.

    [0088] Clause 6. A composition comprising the synthetic peptide mimetic of any one of clauses 1-5.

    [0089] Clause 7. The composition of clause 6, wherein the composition further comprises a pharmaceutically acceptable carrier.

    [0090] Clause 8. A method of treating a bleeding disorder, the method comprising administering to a subject a therapeutically effective amount of a synthetic peptide mimetic comprising an amino acid sequence of SEQ ID NO: 1.

    [0091] Clause 9. The method of clause 8, wherein the synthetic peptide mimetic induces activation of and signaling through PAR4 in the subject.

    [0092] Clause 10. The method of clause 8 or clause 9, wherein the synthetic peptide mimetic induces PAR4-dependent calcium flux in the subject.

    [0093] Clause 11. The method of any one of clauses 8-10, wherein the synthetic peptide mimetic induces platelet aggregation in the subject.

    [0094] Clause 12. The method of any one of clauses 8-11, wherein the synthetic peptide mimetic induces platelet activation in the subject.

    [0095] Clause 13. The method of any one of clauses 8-12, wherein the bleeding disorder is hemophilia A (factor VIII deficiency), hemophilia B (factor IX deficiency), von Willebrand disease, thrombocytopenia, or bleeding due to qualitative platelet dysfunction.

    [0096] Clause 14. The method of any one of clauses 8-13, wherein the bleeding disorder is a result caused by cirrhosis of the liver, leukemia, vitamin K deficiency, administration of aspirin, administration of heparin, or administration of warfarin.

    TABLE-US-00002 SEQUENCES SEQ ID NO: 1 11-mer PAR4 Tethered Ligand Fragment Amino Acid Sequence RALLLGWVPTR SEQ ID NO: 2 10-mer PAR4 Tethered Ligand Fragment Amino Acid Sequence ALLLGWVPTR SEQ ID NO: 3 8-mer PAR4 Tethered Ligand Fragment Amino Acid Sequence RALLLGWV SEQ ID NO: 4 6-mer PAR4 Tethered Ligand Fragment Amino Acid Sequence RALLLG SEQ ID NO: 5 6-mer Thrombin-Generated PAR4 Tethered Ligand Amino Acid Sequence GYPGQV SEQ ID NO: 6 RC3 Monoclonal Antibody Target Amino Acid Sequence of PAR4 GDDSTPSILPAPRGYPGQVC SEQ ID NO: 7 PAR4-B Amino Acid Sequence DDSTPSILPAPRGYPGQVCANDS SEQ ID NO: 8 PAR4-C Amino Acid Sequence DSDTLELPDSSRALLLGWVPTR SEQ ID NO: 9 PAR4-C Fragment Amino Acid Sequence DSDTLELPSS SEQ ID NO: 10 Full Length Human PAR4 Amino Acid Sequence MWGRLLLWPL VLGFSLSGGT QTPSVYDESG STGGGDDSTP SILPAPRGYP GQVCANDSDT LELPDSSRAL LLGWVPTRLV PALYGLVLVV GLPANGLALW VLATQAPRLP STMLLMNLAT ADLLLALALP PRIAYHLRGQ RWPFGEAACR LATAALYGHM YGSVLLLAAV SLDRYLALVH PLRARALRGR RLALGLCMAA WLMAAALALP LTLQRQTFRL ARSDRVLCHD ALPLDAQASH WQPAFTCLAL LGCFLPLLAM LLCYGATLHT LAASGRRYGH ALRLTAVVLA SAVAFFVPSN LLLLLHYSDP SPSAWGNLYG AYVPSLALST LNSCVDPFIY YYVSAEFRDK VRAGLFQRSP GDTVASKASA EGGSRGMGTH SSLLQ SEQ ID NO: 11 12 Amino Acids Adjacent to Plasma Membrane of N-Terminal Human PAR4 Extracellular Domain SRALLLGWVPTR SEQ ID NO: 12 12 Amino Acids Adjacent to Plasma Membrane of N-Terminal Dog PAR4 Extracellular Domain SRALLLGWVATR SEQ ID NO: 13 12 Amino Acids Adjacent to Plasma Membrane of N-Terminal Mouse PAR4 Extracellular Domain SQALLLGWVPTR SEQ ID NO: 14 12 Amino Acids Adjacent to Plasma Membrane of N-Terminal Rat PAR4 Extracellular Domain SEALLLGWVPTR SEQ ID NO: 15 Human PAR4 Fragment Amino Acid Sequence DSTPSILPAPRGYPGQVCANDSDTLELPDSSRALLLGWVPTRLVPALYGLVLVVGLPANGLAL WVLATQ SEQ ID NO: 16 Gorilla PAR4 Fragment Amino Acid Sequence DSTPSILPAPRSYPGQVCANDSDTLELPDSSRALLLGWVPTRLVPALYGLVLVVGLPANGLALW VLATQ SEQ ID NO: 17 Olive Baboon PAR4 Fragment Amino Acid Sequence DSTPSILPAPRGYPGQVCANDSDILELPDSSRALLLGWVPTRLVPALYGLVLAVGLPANGLALW VLATR SEQ ID NO: 18 Green Monkey PAR4 Fragment Amino Acid Sequence ESTPSILPAPRGYPGQVCANDSDILELPDSSRALLLGWVPTRLVPALYGLVLAVGLPANSLALW VLATR SEQ ID NO: 19 North Greater Galago PAR4 Fragment Amino Acid Sequence EATLLFPQQPRSFPGCVFTNNSDILEIPDSSRALLLGWVPTRLVPTLYGLVLVVGLPANGLALW VLATQ SEQ ID NO: 20 Lemur PAR4 Fragment Amino Acid Sequence ATAPPFPGRPLSFPGQVCANDSDTLELPDRSRALLLGWVPTRLVPALYGLVLAVGLPANALAL WVLAAK SEQ ID NO: 21 Goat PAR4 Fragment Amino Acid Sequence GDDSTPRPHPRSFPGCPCANDSNTLELPPNSRALLLGWVPTKLVPALYGLVLAVGLPANSLAL WVLATQ SEQ ID NO: 22 Cat PAR4 Fragment Amino Acid Sequence REGSPLPPKLRSFPGRPWANSSDEVEISDGSRALLLGWVPTRLVPALYGLTLLVGLPANGLAL WVLATR SEQ ID NO: 23 Dog PAR4 Fragment Amino Acid Sequence QEGTPHSPHLRSFPGQPWANNSEILEIPESSRALLLGWVATRLVPAVYGLALLVGLPANGLAL WVLATR SEQ ID NO: 24 Mouse PAR4 Fragment Amino Acid Sequence EPKSSDKPNPRGYPGKFCANDSDTLELPASSQALLLGWVPTRLVPALYGLVVAVGLPANGLAL WVLATR SEQ ID NO: 25 Rat PAR4 Fragment Amino Acid Sequence ESKSPDKPNPRGFPGKPCANNSDTLELPASSEALLLGWVPTRLVPAIYGLVVVVGLPANGLAL WVLATR SEQ ID NO: 26 Collared Flycatcher (Bird) PAR4 Fragment Amino Acid Sequence PCPRAIPGDQARVNNVTYLLVPAYLLVPAGTRAQLGSAVTVRLIPGLYSLVLALGLPANALALRA LAAX (X can be any amino acid residue, e.g., A, R, N, D, C, E, Q, G, H, I, L, K, M, F, P, S, T, W, Y, or V) SEQ ID NO: 27 Common Carp PAR4 Fragment Amino Acid Sequence RRGPLXXXXXXXXXXXXXXXXXXXPXSPTTLTLVVPLLYFLAFFIGLPTNLLALWVLLLQTKKLP (X can be any amino acid residue, e.g., A, R, N, D, C, E, Q, G, H, I, L, K, M, F, P, S, T, W, Y, or V)