Cell line 3M

09624299 ยท 2017-04-18

Assignee

Inventors

Cpc classification

International classification

Abstract

The present invention provides, inter alia, an isolated cell line, 3M as well as methods for making such a cell line and methods of using such a cell line, e.g., to produce a protein such as an immunoglobulin.

Claims

1. An isolated Chinese hamster ovary cell deposited at the American Type Culture Collection under deposit number PTA-10481 that comprises an immunoglobulin light chain or an immunoglobulin heavy chain or both.

2. The cell of claim 1 that comprises both an immunoglobulin light chain and an immunoglobulin heavy chain.

3. The cell of claim 1 in an aqueous liquid cell culture medium.

4. The cell of claim 1 in a vessel.

5. A master cell bank or working cell bank comprising the cell of claim 1.

6. The cell of claim 1 in a cell freezing medium.

7. The cell of claim 6 wherein the cell freezing medium comprises dimethylsulfoxide.

Description

BRIEF DESCRIPTION OF THE FIGURES

(1) FIG. 1. Evaluation of Cell Growth Potential for 3M and ISA Host Cells in batch mode.

(2) FIG. 2. Cell recovery efficiency after transfection for murine anti-IL17 project.

(3) FIG. 3. Antibody titers after cloning in 96-well for 19 days after transfection for anti-IL23, cyno-anti-TSLP, and anti-HGF projects.

(4) FIG. 4. Specific productivity of successful clones for anti-IL23 version 2 project.

DETAILED DESCRIPTION OF THE INVENTION

(5) The present invention provides an isolated Chinese Hamster Ovary (CHO-DXB11) cell for therapeutic antibody production, 3M. 3M cells were deposited, under the Budapest Treaty, on Nov. 17, 2009 with the American Type Culture Collection (ATCC); 10801 University Boulevard; Manassas, Va. 20110-2209. The cells were deposited at the ATCC under deposit number PTA-10481. All restrictions on access to the cells deposited in ATCC will be irrevocably removed upon grant of a patent.

(6) The present invention also includes derivatives of the cell lines of the present invention. Derivatives include mutants comprising the 3M genetic background for the for the presence of one or more additional genetic mutations, e.g., wherein such derivative cell lines retain the beneficial properties of the parental 3M cell line (e.g., protein production in serum free suspension culture, cell growth and/or clone recovery rate).

(7) The 3M cell line originated from the well known Chinese Hamster Ovary cell line, CHO-DXB11. CHO DXB11 cells are available from the American Type Culture Collection, e.g., under deposit no. CRL-11397. Briefly, CHO-DXB11 was suspension-adapted for three months followed by two rounds of subsequent cloning in a serum-free protein-free medium. Relative to previously developed and known cell lines, the 3M cell line is robust in cell growth, superior in clone recovery efficiency and produces high antibody titers in suspension mode in serum-free media. 3M has been used to generate highly productive clones for production of several antibodies.

(8) The present invention includes not only individual isolated 3M cells but also master cell banks (MCB) and working cell banks (WCB), e.g., comprising 3M cells that comprise one or more genes encoding therapeutic proteins to be expressed. Typically, when a cell line is to be used over many manufacturing cycles, a two-tiered cell banking system consisting of a master cell bank or master seed bank and a working cell bank can be established. A cell line is generally established from a single host cell clone and this cell line is used to make-up the MCB. Generally, this MCB must be characterized and extensively tested for contaminants such as bacteria, fungi, viruses and mycoplasma. A sample of cells from the MCB can be expanded to form the WCB, which is characterized for cell viability prior to use in a manufacturing process. The cells in a MCB or WCB can be stored in vials, for example, at low temperature (e.g., 0 C. or lower, 20 C. or 80 C., or in liquid nitrogen, e.g., at 110 C. to 180 C.). Typically, the working cell bank includes cells from one vial of the master bank which have been grown for several passages before storage. In general, when future cells are needed, they are taken from the working cell bank; whereas, the master cell bank is used only when necessary, ensuring a stock of cells with a low passage number to avoid genetic variation within the cell culture.

(9) Subcloning refers to a progressive dilution of cells in series, e.g., in wells of a 96 well microtiter plate, in predetermined ratios to produce single colonies.

Molecular Biology

(10) In accordance with the present invention there may be employed conventional molecular biology, microbiology, and recombinant DNA techniques within the skill of the art. Such techniques are explained fully in the literature. See, e.g., Sambrook, Fritsch & Maniatis, Molecular Cloning: A Laboratory Manual, Second Edition (1989) Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (herein Sambrook, et al., 1989); DNA Cloning: A Practical Approach, Volumes I and II (D. N. Glover ed. 1985); Oligonucleotide Synthesis (M. J. Gait ed. 1984); Nucleic Acid Hybridization (B. D. Hames & S. J. Higgins eds. (1985)); Transcription And Translation (B. D. Hames & S. J. Higgins, eds. (1984)); Animal Cell Culture (R. I. Freshney, ed. (1986)); Immobilized Cells And Enzymes (IRL Press, (1986)); B. Perbal, A Practical Guide To Molecular Cloning (1984); F. M. Ausubel, et al. (eds.), Current Protocols in Molecular Biology, John Wiley & Sons, Inc. (1994).

(11) A polynucleotide, nucleic acid or nucleic acid molecule DNA and RNA (e.g., mRNA), single or double stranded.

(12) A polynucleotide sequence, nucleic acid sequence or nucleotide sequence is a series of nucleotide bases (also called nucleotides) in a nucleic acid, such as DNA or RNA, and means any chain of two or more nucleotides.

(13) A coding sequence or a sequence encoding an expression product, such as a RNA, polypeptide, protein, or enzyme, is a nucleotide sequence that, when expressed, results in production of the product.

(14) The term gene means a DNA sequence that codes for or corresponds to a particular sequence of ribonucleotides or amino acids which comprise all or part of one or more RNA molecules, proteins or enzymes, and may or may not include regulatory DNA sequences, such as promoter sequences, which determine, for example, the conditions under which the gene is expressed. Genes may be transcribed from DNA to RNA which may or may not be translated into an amino acid sequence.

(15) A protein sequence, peptide sequence or polypeptide sequence or amino acid sequence refers to a series of two or more amino acids in a protein, peptide or polypeptide.

(16) Protein, peptide or polypeptide includes a contiguous string of two or more amino acids.

(17) The terms isolated polynucleotide or isolated polypeptide include a polynucleotide (e.g., RNA or DNA molecule, or a mixed polymer) or a polypeptide, respectively, which are partially (to any degree) or fully separated from other components that are normally found in cells or in recombinant DNA expression systems. These components include, but are not limited to, cell membranes, cell walls, ribosomes, polymerases, serum components and extraneous genomic sequences.

(18) An isolated polynucleotide or polypeptide will, in an embodiment of the invention, be an essentially homogeneous composition.

(19) Amplification of DNA as used herein includes the use of polymerase chain reaction (PCR) to increase the concentration of a particular DNA sequence within a mixture of DNA sequences. For a description of PCR see Saiki, et al., Science (1988) 239:487.

(20) The term host cell includes any cell of any organism (e.g., a CHO cell such as 3M) that is selected, modified, transfected, transformed, grown, or used or manipulated in any way, for the production of a substance by the cell, for example the expression or replication, by the cell, of a gene, a DNA or RNA sequence or a protein. Host cells also include bacterial cells (e.g., E. coli), murine macrophage J774 cells or any other macrophage cell line and human intestinal epithelial Caco2 cells.

(21) The nucleic acids herein may be flanked by natural regulatory (expression control) sequences, or may be associated with heterologous sequences, including promoters, internal ribosome entry sites (IRES) and other ribosome binding site sequences, enhancers, response elements, suppressors, signal sequences, polyadenylation sequences, introns, 5- and 3-non-coding regions, and the like.

(22) In general, a promoter or promoter sequence is a DNA regulatory region capable of binding an RNA polymerase in a cell (e.g., directly or through other promoter-bound proteins or substances) and initiating transcription of a coding sequence. A promoter sequence is, in general, bounded at its 3 terminus by the transcription initiation site and extends upstream (5 direction) to include the minimum number of bases or elements necessary to initiate transcription at any level. Within the promoter sequence may be found a transcription initiation site (conveniently defined, for example, by mapping with nuclease S1), as well as protein binding domains (consensus sequences) responsible for the binding of RNA polymerase. The promoter may be operably associated with other expression control sequences, including enhancer and repressor sequences or with a nucleic acid of the invention. Promoters which may be used to control gene expression include, but are not limited to, cytomegalovirus (CMV) promoter (U.S. Pat. Nos. 5,385,839 and 5,168,062), the SV40 early promoter region (Benoist, et al., (1981) Nature 290:304-310), the promoter contained in the 3 long terminal repeat of Rous sarcoma virus (Yamamoto, et al., (1980) Cell 22:787-797), the herpes thymidine kinase promoter (Wagner, et al., (1981) Proc. Natl. Acad. Sci. USA 78:1441-1445), the regulatory sequences of the metallothionein gene (Brinster, et al., (1982) Nature 296:39-42); prokaryotic expression vectors such as the -lactamase promoter (Villa-Komaroff, et al., (1978) Proc. Natl. Acad. Sci. USA 75:3727-3731), or the tac promoter (DeBoer, et al., (1983) Proc. Natl. Acad. Sci. USA 80:21-25); see also Useful proteins from recombinant bacteria in Scientific American (1980) 242:74-94; and promoter elements from yeast or other fungi such as the Gal 4 promoter, the ADC (alcohol dehydrogenase) promoter, PGK (phosphoglycerol kinase) promoter or the alkaline phosphatase promoter.

(23) A coding sequence is under the control of, functionally associated with or operably associated with transcriptional and translational control sequences in a cell when the sequences direct RNA polymerase mediated transcription of the coding sequence into RNA, preferably mRNA, which then may be RNA spliced (if it contains introns) and, optionally, translated into a protein encoded by the coding sequence.

(24) The terms express and expression mean allowing or causing the information in a gene, RNA or DNA sequence to become manifest; for example, producing a protein by activating the cellular functions involved in transcription and translation of a corresponding gene. A DNA sequence is expressed in or by a cell to form an expression product such as an RNA (e.g., mRNA) or a protein. The expression product itself may also be said to be expressed by the cell.

(25) The term transformation means the introduction of a nucleic acid into a cell. The introduced gene or sequence may be called a clone. A host cell that receives the introduced DNA or RNA has been transformed and is a transformant or a clone. The DNA or RNA introduced to a host cell can come from any source, including cells of the same genus or species as the host cell, or from cells of a different genus or species.

(26) The term vector includes a vehicle (e.g., a plasmid) by which a DNA or RNA sequence can be introduced into a host cell, so as to transform the host and, optionally, promote expression and/or replication of the introduced sequence.

(27) Vectors that can be used in this invention include plasmids, viruses, bacteriophage, integratable DNA fragments, and other vehicles that may facilitate introduction of the nucleic acids into the genome of the host. Plasmids are the most commonly used form of vector but all other forms of vectors which serve a similar function and which are, or become, known in the art are suitable for use herein. See, e.g., Pouwels, et al., Cloning Vectors: A Laboratory Manual, 1985 and Supplements, Elsevier, N.Y., and Rodriguez et al. (eds.), Vectors: A Survey of Molecular Cloning Vectors and Their Uses, 1988, Buttersworth, Boston, Mass.

(28) The term expression system means a host cell (e.g., a 3M cell) and compatible vector which, under suitable conditions, can express a protein or nucleic acid which is carried by the vector and introduced to the host cell.

(29) Mutant CHO cells comprising the 3M cell genetic background are also within the scope of the present invention. Such mutant cells are identical to a 3M cell of the present invention but for the presence of one or more additional genetic mutations. Genetic mutations can take the form of gene knock-outs, deletions, point mutations, etc. Accordingly, the present invention includes methods for generating a 3M cell line mutant comprising adapting CHO-DXB11 cells into animal-component free medium in suspension for 83 days; then subcloning the cells into said medium twice, then introducing one or more genetic mutations into such cells. Cells produced by such a method are also within the scope of the present invention. Methods for introducing genetic mutations into CHO cells are within the ability of any practitioner of ordinary skill in the art. For example, mutations may be introduced by way of chemical or radiation mutagenesis (e.g., using ethyl methanesulfonate (EMS) treatment, N-methyl-N-nitro-N-nitrosoguanidine (NG) treatment, ultraviolet (UV) light treatment, gamma irradiation, X-ray irradiation, fast neutron irradiation) or homologous recombination based methods for introducing mutations (e.g., site-directed mutagenesis, for example PCR-based introduction of a specific point mutation or recombinant knock out or knock-in of a given gene or locus). Chromosomal locations into which mutations may be introduced may be selected from those appearing in the public sequence databases.

3M Cell

(30) The present invention includes an isolated Chinese hamster ovary cell, the 3M cell, the exhibits superior properties allowing efficient production of various polypeptides. An embodiment of the 3M cells of the present invention were deposited, under the Budapest Treaty, on Nov. 17, 2009 with the American Type Culture Collection (ATCC); 10801 University Boulevard; Manassas, Va. 20110-2209. The cells were deposited at the ATCC under deposit number PTA-10481. All restrictions on access to the cells deposited in ATCC will be irrevocably removed upon grant of a patent. 3M cells may be produced by method comprising adapting CHO-DXB11 cells into animal-component free medium in suspension for about 3 months (e.g., about 83 days or about 80-90 days or about 90 days); then subcloning the cells into said medium twice.

(31) Subcloning can be performed by a method comprising the steps of

(32) (a) serially diluting the adapted cells in serum-free growth medium (e.g., any of those discussed herein), for example, animal component-free medium;

(33) e.g., wherein the cells are diluted by 1/2 each time.

(34) e.g., wherein the serial dilutions are done in a low volume of about 100 microliters.

(35) e.g., wherein the serial dilutions are done in the wells of a 96 well microtiter plate.

(36) (b) allowing the cells of each dilution to grow;

(37) e.g., wherein the cells are allowed to grow for about 2 weeks

(38) e.g., wherein the cells are allowed to grow in high humidity and/or 7.5% CO.sub.2.

(39) e.g., wherein the cells are allowed to grow at 37 C.

(40) (c) selecting the cells in the highest dilution (i.e., lowest concentration of cells) containing viable cells;

(41) e.g., wherein the cells in a dilution are determined to be viable upon visual inspection e.g., using a microscope wherein cellular colonies are observed.

(42) e.g., wherein the highest dilution is about 1/64.

(43) e.g., wherein cells that are selected are transferred into a higher volume (e.g., about 2 ml of medium, e.g., in a T-25 flask) of serum free growth medium and allowed to grow (e.g., shaking at about 70 rpm e.g., for about 1 week, e.g., at about 37 C., e.g., at about 7.5% CO.sub.2) before proceeding to step (d) and then re-serially diluting the cells.
and
(d) repeating steps (a), (b) and (c) once more.

Proteins

(44) The present invention includes embodiments comprising methods for recombinantly producing proteins, such as immunoglobulin chains or therapeutic proteins, in the 3M cells. Such immunoglobulin chains include the light and/or heavy immunoglobulin chains for the following antibodies: anti-IL23 (e.g., anti-p19), anti-PD1, anti-TSLP, anti-HGF, anti-IL17, anti-IL23 Receptor, anti-BTLA, cyno-anti-TSLP (cynomolgus frameworks and Ig constant domain, specific for cynomolgus monkey TSLP) as well as sB4-HSA (HAS is human serum albumin), mouse Embrel (soluble mouse TNF receptor linked to a mouse Fc portion of an IgG1), and cTLA4-IgG. Such methods are discussed in detail herein. In an embodiment of the invention, the immunoglobulin forms part of an antibody (e.g., human antibody, humanized antibody, chimeric antibody) or antigen-binding fragment thereof, e.g., including an immunoglobulin light and/or heavy chain variable region, optionally linked with an immunoglobulin constant region.

(45) For example, the present invention includes methods wherein a protein to be expressed in a 3M cell (e.g., a light chain and/or heavy chain immunoglobulin) is encoded by a polynucleotide in a plasmid vector, e.g., wherein the polynucleotide is operably linked to a promoter such as a CMV promoter. In an embodiment of the invention, the light and heavy chains are included in a single plasmid vector or in two separate plasmid vectors.

(46) In an embodiment of the invention, the immunoglobulin chain encodes any of those set forth below; for example, any of the following immunoglobulin light and/or heavy chains and/or any of the CDRs thereof (e.g., all 3 from a single light or heavy chain). Dotted, underscored type encodes the signal peptide. Solid underscored type encodes the CDRs. Plain type encodes the framework regions. In an embodiment of the invention, the chains are expressed with the signal peptide which is cleaved upon secretion from the host cell to generate a mature fragment of the chain.

(47) The present invention also comprises compositions including 3M cells in the presence of heavy and/or light immunoglobulin chains and/or antibodies comprising the chain(s) or antigen-binding fragments thereof, e.g., which are in a liquid cell growth culture medium, e.g., wherein such chains were secreted from a host cell (e.g., 3M).

(48) Processes for producing any of the following immunoglobulin polypeptide chains comprising any of the following amino acid sequences or mature fragments thereof or antibodies or antigen-binding fragments thereof comprising such chains or fragments in 3M cells form part of the present invention along with 3M cells themselves comprising the polypeptides and/or polynucleotides encoding said polypeptides (e.g., in a vector). In an embodiment of the invention, the protein is a light or heavy chain immunoglobulin variable chain (either mature (lacking the secretion signal) or unprocessed), optionally linked to an immunoglobulin heavy or light constant chain immunoglobulin, e.g., wherein the variable region comprises an amino acid sequence set forth below, or a mature fragment thereof or wherein the immunoglobulin comprises one or more CDRs (e.g., 3 light chain CDRs or 3 heavy chain CDRs) from those set forth herein:

(49) TABLE-US-00005 19D12/15H12LightChain (SEQIDNO:1) embedded image QSPKLLIKYASQSLSGVPSRFSGSGSGTDFTLTINSLEAEDAAAYYCHQSSRLPHTFGGG TKVEIKRT 19D12/15H12HeavyChain (SEQIDNO:2) embedded image GKGLEWISVIDTRGATYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDMAVYYCARLGNF YYGMDVWGQGTTVTVSS 19D12/15H12LightChain-C(LCC) (SEQIDNO:3) embedded image embedded image GERVTITCRASQSIGSS LHWYQQKPGQSPKLLIK YASQSLSGVP5RFSGSG SGTDFTLTISSLEAEDA AAYYCHQSSRLPHTFGQ GTKVEIKRT 19D12/15H12LightChain-D(LCD) (SEQIDNO:4) embedded image embedded image GERVTITCRASQSIGSS LHWYQQKPGQSPKLLIK YASQSLSGVPSRFSGSG SGTDFTLTISSLEAEDF AVYYCHQSSRLPHTFGQ GTKVEIKRT 19D12/15H12LightChain-E(LCE) (SEQIDNO:5) embedded image embedded image GERATLSCRASQSIGSS LHWYQQKPGQAPRLLIK YASQSLSGIPDRFSGSG SGTDFTLTISRLEPEDA AAYYCHQSSRLPHTFGQ GTKVEIKRT 19D12/15H12LightChain-F(LCF) (SEQIDNO:6) embedded image 0embedded image GERATLSCRASQSIGSS LHWYQQKPGQAPRLLIK YASQSLSGIPDRFSGSG SGTDFTLTISRLEPEDF AVYYCHQSSRLPHTFGQ GTKVEIKRT 19D12/15H12heavychain-A(HCA) (SEQIDNO:7) embedded image embedded image GlySerLeuArgLeuSerCysAlaAlaSerGlyPheThrPheSerSerPhe AlaMetHisTrpValArgGlnAlaProGlyLysGlyLeuGluTrpIleSer ValIleAspThrArgGlyAlaThrTyrTyrAlaAspSerValLysGlyArg PheThrIleSerArgAspAsnAlaLysAsnSerLeuTyrLeuGlnMetAsn SerLeuArgAlaGluAspThrAlaValTyrTyrCysAlaArgLeuGlyAsn PheTyrTyrGlyMetAspValTrpGlyGlnGlyThrThrValThrValSer Ser 19D12/15H12heavychain-B(HCB) (SEQIDNO:8) embedded image embedded image GlySerLeuArgLeuSerCysAlaAlaSerGlyPheThrPheSerSerPhe AlaMetHisTrpValArgGlnAlaProGlyLysGlyLeuGluTrpIleSer ValIleAspThrArgGlyAlaThrTyrTyrAlaAspSerValLysGlyArg PheThrIleSerArgAspAsnAlaLysAsnSerLeuTyrLeuGlnMetAsn SerLeuArgAlaGluAspThrAlaValTyrTyrCysAlaArgLeuGlyAsn PheTyrTyrGlyMetAspValTrpGlyGlnGlyThrThrValThrValSer Ser

(50) See international application publication no. WO2003/100008 which is incorporated herein by reference in its entirety.

(51) Other variable heavy and light chain immunoglobulins that can form part of an anti-IGF1R antibody and antigen-binding fragment thereof are as follows:

(52) TABLE-US-00006 V.sub.Hdomains (1)EVQLVQSGGGLVHPGGSLRLSCAGSGFTFRNYAMYWVRQAPGKGLEWVSAIG-SGGGTYYADSVKG (2)QVELVESGGGVVQPGRSQRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAIIWFDGSSTYYADSVRG (3)EVQLLESGGGLVQPGGSLRLSCTASGFTFSSYAMNWVRQAPGKGLEWVSAISGSGGTTFYADSVKG (4)EVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPIFGTANYAQKFQG (5)QVQLQESGPGLVKPSGTLSLTCAVSGGSISSSNWWSWVRQPPGKGLEWIGEIY-HSGSTNYNPSLKS (6)QVQLQESGPGLVKPSETLSLTCTVSGYSISGGYLWNWIRQPPGKGLEWIGYIS-YDGTNNYKPSLKD (1)RFTISRDNAKNSLYLQMNSLRAEDMAVYYCARAPNWGSDA----------FDIWGQGTMVTVSS (2)RFTISRDNSKNTLYLQMNSLRAEDTAVYFCARELGRR------------YFDLWGRGTLVSVSS (3)RFTISRDNSRTTLYLQMNSLRAEDTAVYYCAKDLGWSDS-----YYYYYGMDVWGQGTTVTVSS (4)RVTITADKSTSTAYMELSSLRSEDTAVYYCARAPLRFLEWSTQDHYYYYYMDVWGKGTTVTVSS (5)RVTISVDKSKNQFSLKLSSVTAADTAVYYCARWTGRTD-----------AFDIWGQGTWVTVSS (6)RVTISVDTSKNQFSLKLSSVTAADTAVYYCARYGRV-------------FFDYWGQGTLVTVSS 1= SEQIDNO:58 2= SEQIDNO:60 3= SEQIDNO:62 4= SEQIDNO:64 5= SEQIDNO:66 6= SEQIDNO:68 V.sub.LDomains (a)DIQMTQSPSSLSASVGDRVTITCRASQGISSWLAWYQQKPEKAPKSLIYAASSLQS (b)EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASKRAT (c)DIQMTQFPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYAASRLHR (d)SSELTQDP-AVSVALGQTVRITCQGDSLRSYYATWYQQKPGQAPILVIYGENKRPS (e)DIVMTQSPLSLPVTPGEPASISCRSSQSLLHSNGYNYLDWYLQKPGQSPQLLIYLGSNRAS (f)DIVMTQSPLSLPVTPGEPASISCRSSQSIVHSNGNTYLQWYLQKPGQSPQLLIYKVSNRLY (a)GVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYNSYPPTFGPGTKVDIK (b)GIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQRSKWPPWTFGQGTKVESK (c)GVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPCSFGQGTKLEIKRT (d)GIPDRFSGSSSGNTASLTITGAQAEDEADYYCKSRDGSGQHLVFGGGTKLTVLG (e)GVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWPLTFGQGTKVEIK (f)GVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPWTFGQGTKVEIK a= SEQIDNO:59 b= SEQIDNO:61 c= SEQIDNO:63 d= SEQIDNO:65 e= SEQIDNO:67 f= SEQIDNO:69

(53) In an embodiment of the invention, V.sub.H1 is paired, in an antibody or antigen-binding fragment thereof, with V.sub.La; V.sub.H2 is paired, in an antibody or antigen-binding fragment thereof, with V.sub.Lb; V.sub.H3 is paired, in an antibody or antigen-binding fragment thereof, with V.sub.Lc; V.sub.H4 is paired, in an antibody or antigen-binding fragment thereof, with V.sub.Ld; V.sub.H5 is paired, in an antibody or antigen-binding fragment thereof, with V.sub.Le; and/or V.sub.H6 is paired, in an antibody or antigen-binding fragment thereof, with V.sub.Lf.

(54) Embodiments of the invention include those wherein the immunoglobulin is expressed in 3M cells, for example, in combination of any of those set forth herein (e.g., LCC and HCA; or LCF and HCA; or LCC and HCB). Pairing of the light and heavy chains can result in generation of an antibody or antigen-binding fragment thereof.

(55) In an embodiment of the invention, the polypeptide is one or more immunoglobulin chains that can form an anti-IGF1R antibody or antigen-binding fragment thereof that comprises the light and/or heavy chain immunoglobulins set forth below, or variable regions thereof, or chains that comprise the 3 light chain CDRs and/or 3 heavy chain CDRs that, in an embodiment of the invention, are underscored in the sequences set forth below, e.g., wherein the antibody or fragment comprises the two light and two heavy chain immunoglobulins set forth below:

(56) TABLE-US-00007 LIGHTCHAIN(1) (SEQIDNO:79) 1DIVMTQSPLSLPVTPGEPASISCRSSQSIVHSNGNTYLQWYLQKPGQSPQ 51LLIYKVSNRLYGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVP 101WTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAK 151VQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACE 201VTHQGLSSPVTKSFNRGEC HEAVYCHAIN(2) (SEQIDNO:80) 1QVQLQESGPGLVKPSETLSLTCTVSGYSITGGYLWNWIRQPPGKGLEWIG 51YISYDGTNNYKPSLKDRVTISRDTSKNQFSLKLSSVTAADTAVYYCARYG 101RVFFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYF 151PEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYIC 201NVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDT 251LMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTY 301RVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYT 351LPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS 401DGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK HEAVYCHAIN(3) 1QVQLQESGPGLVKPSETLSLTCTVSGYSITGGYLWNWIRQPPGKGLEWIG 51YISYDGTNNYKPSLKDRVTISRDTSKNQFSLKLSSVTAADTAVYYCARYG 101RVFFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYF 151PEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYIC 201NVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDT 251LMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTY 301RVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYT 351LPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS 401DGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK LIGHTCHAIN(4) 1DIVMTQSPLSLPVTPGEPASISCRSSQSIVHSNGNTYLQWYLQKPGQSPQ 51LLIYKVSNRLYGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVP 101WTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAK 151VQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACE 201VTHQGLSSPVTKSFNRGEC

(57) In an embodiment of the invention, the light and heavy chains of the anti-IGF1R antibody or antigen-binding fragment thereof comprise one or more disulfide bridges arranged as follows:

(58) TABLE-US-00008 DISULFIDE BRIDGES (CHAIN NUMBER:AMINO ACID NUMBER) 1:23 to 1:93 1:139 to 1:199 1:219 to 2:220 2:22 to 2:96 2:144 to 2:200 2:261 to 2:321 2:367 to 2:425 2:226 to 3:226 2:229 to 3:229 3:22 to 3:96 3:144 to 3:200 3:261 to 3:321 3:367 to 3:425 3:220 to 4:219 4:23 to 4:93 4:139 to 4:199

(59) In an embodiment of the invention, an immunoglobulin chain that can form anti-IL-23 antibody or antigen-binding fragment thereof that comprises 3 light and/or 3 heavy chain CDRs is selected from:

(60) TABLE-US-00009 CDR-L1: (SEQIDNO:9) KASKKVTIFGSISALH; CDR-L2: (SEQIDNO:10) NGAKLES; and CDR-L3: (SEQIDNO:11) LQNKEVPYT; or CDR-H1: (SEQIDNO:12) SYGIT; CDR-H2: (SEQIDNO:13) ENYPRSGNTYYNEKFKG; and CDR-H3: (SEQIDNO:14) CEFISTVVAPYYYALDY or (SEQIDNO:15) SEFISTVVAPYYYALDY or (SEQIDNO:16) AEFISTVVAPYYYALDY or (SEQIDNO:17) VEFISTVVAPYYYALDY or (SEQIDNO:18) SEFISTVMAPYYYALDY or (SEQIDNO:19) SEFTSTVVAPYYYALDY

(61) In an embodiment of the invention, an immunoglobulin chain that can form part of an anti-IL-23 p19 antibody or antigen-binding fragment thereof comprises an amino acid sequence selected from:

(62) TABLE-US-00010 Lightchain: (SEQIDNO:20) DIQMTQSPSSLSASVGDRVTITCRTSENIYSYLAWYQQKPGKAPKLLIYN AKTLAEGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQHHYGIPFTFGQ GTKVEIKR; Heavychain: (SEQIDNO:21) QVQLVQSGAEVKKPGASVKVSCKASGYIFITYWMTWVRQAPGQGLEWMGQ IFPASGSADYNEMFEGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARGG GGFAYWGQGTLVTVSS; and Heavychain: (SEQIDNO:22) QVQLVQSGAEVKKPGASVKVSCKASGYIFITYWMTWVRQAPGQGLEWMGQ IFPASGSADYAQKLQGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARGG GGFAYWGQGTLVTVSS.
In an embodiment of the invention, the immunoglobulin comprises 3 heavy and/or 3 light chain CDRs taken from the immunoglobulin chains discussed above.

(63) In an embodiment of the invention, an immunoglobulin that can form part of an anti-IL23 p19 antibody or antigen-binding fragment thereof comprises the following CDRs:

(64) TABLE-US-00011 CDRH1: (SEQIDNO:23) GlyPheThrPheSerSerTyrThrMetSer; CDRH2: (SEQIDNO:24) ThrIleSerSerGlyGlyThrTyrThrTyrTyrPro AspSerValLysGly; and CDRH3: (SEQIDNO:25) AspAsnHisAlaTyrAspArgGlyProPhePheAsp Tyr; or CDRL1: (SEQIDNO:26) LysSerSerGlnAsnLeuPheTyrArgSerAsnGln LysAsnHisLeuAla; CDRL2: (SEQIDNO:27) TrpThrSerThrArgGluSer; and CDRL3: (SEQIDNO:28) GlnGlnTyrTyrSerTyrProProThr.

(65) In an embodiment of the invention, an immunoglobulin that can form part of an anti-IL23 p19 antibody or antigen-binding fragment thereof comprises the following CDRs:

(66) TABLE-US-00012 CDRH1: (SEQIDNO:29) AlaTyrGlyMetAsp; CDRH2: (SEQIDNO:30) SerIleSerProSerGlyGlyArgThrLysTyrAla AspSerValLysGly; and CDRH3: (SEQIDNO:31) AspLeuGlyGlyGlyTyrTyrTyrTyrTyrGlyMet AspVal; or CDRL1: (SEQIDNO:32) ThrGlyThrSerSerAspValGlyGlyTyrAsnTyr ValSer; CDRL2: (SEQIDNO:33) GluValSerAsnArgProSer; and CDRL3: (SEQIDNO:34) SerSerTyrThrSerSerSerThrLeuPheTyrVal.

(67) In an embodiment of the invention, an immunoglobulin that can form part of an anti-IL23 p19 antibody or antigen-binding fragment thereof comprises the following CDRs:

(68) TABLE-US-00013 CDRH1: (SEQIDNO:35) GKTFWSWGIN; CDRH2: (SEQIDNO:36) YIYIGTGYTEPNPKYKG; and CDRH3: (SEQIDNO:37) IGGYYGNFAD or (SEQIDNO:38) IGGYYGNFDQ; or CDRL1: (SEQIDNO:39) RSSQSLLISGGNTYLN; CDRL2: (SEQIDNO:40) LVSKLDQ; and CDRL3: (SEQIDNO:41) WQGTYFPLT.

(69) In an embodiment of the invention, an immunoglobulin can form part of an anti-IL23 p19 antibody or antigen-binding fragment thereof comprises any of the immunoglobulins, variable regions thereof or CDRs thereof which are set forth in any of U.S. Pat. Nos. 7,247,711 or 7,491,391; published U.S. application no. US 2007/0218064; or US 2008/0095775; or published PCT application no. WO 2007/024846.

(70) For example, in an embodiment of the invention, an immunoglobulin that can form part of an anti-IL-17 antibody or antigen-binding fragment thereof comprises a heavy and/or light chain immunoglobulin that is selected from those below; or an immunoglobulin chain that can form part of an anti-IL-17 antibody or antigen-binding fragment thereof comprises 3 light and/or 3 heavy chain CDRs from any of the chains set forth below:

(71) TABLE-US-00014 Lightchain: (SEQIDNO:42) DIVMTQSPLSLPVTPGEPASISCKSSQSLLFSENQKNYLAWYLQKPGQSP QLLIYWTSTRQSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCQQSYYT PYTEGQGTKVEIKR; and Heavychain: (SEQIDNO:43) QVQLQESGPGLVKPSETLSLTCTVSGFSLPSHSVSWIRQPPGKGLEWIGI IWNQGGTDYNSAFKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARNAY ITDYYYENYFMDAWGQGTLVTVSS.

(72) In an embodiment of the invention, an immunoglobulin that can form part of an anti-HGF antibody or antigen-binding fragment thereof comprises the following 3 light and/or 3 heavy chain CDRs

(73) TABLE-US-00015 HeavyChainCDR1 a (SEQIDNO:44) TYWMH bandc (SEQIDNO:45) TYWMH; HeavyChainCDR2 a (SEQIDNO:46) EINPTNGHTNYNEKFKS b (SEQIDNO:47) EINPTNGHTNYNPSFQG c (SEQIDNO:48) EINPTNGHTNYNQKFQG; and HeavyChainCDR3 a (SEQIDNO:49) NYVGSIFDY bandc (SEQIDNO:50) NYVGSIFDY; or Light(Kappa)ChainCDR1 a (SEQIDNO:51) KASENVVSYVS bandc (SEQIDNO:52) KASENVVSYVS; Light(Kappa)ChainCDR2 a (SEQIDNO:53) GASNRNT b (SEQIDNO:54) GASNRNT c (SEQIDNO:55) GASNRES; and Light(Kappa)ChainCDR3 a (SEQIDNO:56) GQSYNYPYT bandc (SEQIDNO:57) GQSYNYPYT.

(74) In an embodiment of the invention, the protein is a light or heavy chain immunoglobulin variable chain (either mature (lacking the secretion signal) or unprocessed), optionally linked to an immunoglobulin heavy or light constant chain immunoglobulin, e.g., wherein the variable region comprises an amino acid sequence set forth below, or a mature fragment thereof or wherein the immunoglobulin comprises one or more CDRs (e.g., 3 light chain CDRs or 3 heavy chain CDRs) from those set forth herein (CDRs are underscored):

(75) TABLE-US-00016 XPA.10.064lightchain (SEQIDNO:70) SYVLTQPPSASGTPGQRVTISCSGSSSNIGINYVYWYQQLPGTAPKLLIY RNDQRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCATWDDSLSGVV FGGGTKVTVL; XPA.10.064.03heavychain (SEQIDNO:71) EVQLVQSGAEVRKPGASVKVSCKASGYSFTGHYIHWVRQAPGQGLEWMGW INPYSGGTNFPREFQGRVTMTRDTSVNTVYMELTRLTSDDTSVYYCARDQ MVHGGLDYWGQGTLVTVSS; XPA.10.064.04heavychain (SEQIDNO:72) EVQLVQSGAEVRKPGASVKVSCKASGYSFTGHYIHWVRQAPGQGLEWMGW INPYSGGTNFPREFQGRVTMTRDTSVNTVYMELTRLTSDDTSVYYCARDE MQNGGLDYWGQGTLVTVSS; XPA.10.064.06heavychain (SEQIDNO:73) EVQLVQSGAEVRKPGASVKVSCKASGYSFTGHYIHWVRQAPGQGLEWMGW INPYSGGTNFPREFQGRVTMTRDTSVNTVYMELTRLTSDDTSVYYCARDE MTRGGLDYWGQGTLVTVSS; XPA.10.064.07heavychain (SEQIDNO:74) EVQLVQSGAEVRKPGASVKVSCKASGYSFTGHYIHWVRQAPGQGLEWMGW INPYSGGTNFPREFQGRVTMTRDTSVNTVYMELTRLTSDDTSVYYCARDE MHVGGLDYWGQGTLVTVSS; XPA.10.064.10heavychain (SEQIDNO:75) EVQLVQSGAEVRKPGASVKVSCKASGYSFTGHYIHWVRQAPGQGLEWMGW INPYSGGTNFPREFQGRVTMTRDTSVNTVYMELTRLTSDDTSVYYCARDE MVWGGLDYWGQGTLVTVSS.

(76) In an embodiment of the invention, the light chain immunoglobulin is fused to an immunoglobulin constant chain, e.g., a kappa chain or a lambda chain. In an embodiment of the invention, the heavy chain immunoglobulin is fused to an immunoglobulin constant chain, e.g., a gamma-1, gamma-2, gamma-3 or gamma-4 chain.

(77) Other proteins of interest that may be expressed using the methods and 3M cells of the present invention include receptors, ligands, cytokines, chemokines, growth factors, hormones and enzymes.

(78) For example, in a embodiment of the invention, the 3M cell is used to express mature processed or immature, unprocessed MCP1 (e.g., human MCP1) fused to an immunoglobulin gene (e.g., gamma-1, 2, 3 or 4). In an embodiment of the invention, MCP1 is fused to the immunoglobulin by a peptide linker. In an embodiment of the invention, an unprocessed polypeptide sequence of human MCP1 comprises the following amino acid sequence:

(79) TABLE-US-00017 (SEQIDNO:76) MKVSAALLCLLLIAATFIPQGLAQPDAINAPVTCCYNFTNRKISVQRLAS YRRITSSKCPKEAVIFKTIVAKEICADPKQKWVQDSMDHLDKQTQTPKT.
In an embodiment of the invention, a mature polypeptide sequence of human MCP1 comprises the following amino acid sequence:

(80) TABLE-US-00018 (SEQIDNO:77) QPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCPKEAVIFKTIVAKE ICADPKQKWVQDSMDHLDKQTQTPKT.
In an embodiment of the invention, the immunoglobulin is mature polypeptide sequence of human immunoglobulin heavy chain constant region (hinge to CH3 only), isotype 1 monomeric variant (C to S mutations in the hinge underscored)

(81) TABLE-US-00019 (SEQIDNO:78) VEPKSSDKTHTSPPSPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVV DVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL NGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVS LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK.

(82) For example, in an embodiment of the invention, an immunoglobulin that can form part of an anti-PCSK9 antibody (e.g., AX132, AX189 or 1462/1282) or antigen-binding fragment thereof comprises a heavy and/or light chain immunoglobulin that is selected from those below; or an immunoglobulin chain that can form part of an anti-PCSK9 antibody or antigen-binding fragment thereof comprises 3 light and/or 3 heavy chain CDRs from any of the chains set forth below:

(83) AX132 VH amino acid sequence:

(84) TABLE-US-00020 (SEQIDNO:81) EVQLLESGGGLVQPGGSLRLSCKASGYTFSSYGMYWVRQAPGKGLEWIGW IDPGSGGTKYNEKFKGKATISRDNSKNTLYLQMNSLRAEDTAVYYCARER YGYYFDYWGQGTLVTVSS

(85) TABLE-US-00021 e.g.,whereintheheavychaincomprisestheCDRs: AX132HCDR1 (SEQIDNO:82) GYTFSSYGMY AX132HCDR2 (SEQIDNO:83) WIDPGSGGTKYNEKFKG AX132HCDR3 (SEQIDNO:84) ERYGYYFDY AX132VLaminoacidsequence: (SEQIDNO:85) EIVLTQSPATLSLSPGERATITCRASQYVGSYLNWYQQKPGQAPRLLIYD ASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQVWDSSPPVVEG GGTKVEIK e.g.,whereinthelightchaincomprisestheCDRs: AX132LCDR1 (SEQIDNO:86) RASQYVGSYLN AX132LCDR2 (SEQIDNO:87) DASNRAT AX132LCDR3 (SEQIDNO:88) QVWDSSPPVV AX189VLaminoacidsequence: (SEQIDNO:89) DIQMTQSPSSLSASVGDRVTITCRASQDVSRYLTWYQQKPGKAPKLLIYA ASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQAYDYSLSGYVF GGGTKVEIK e.g.,whereinthelightchaincomprisestheCDRs: AX189LCDR1 (SEQIDNO:90) RASQDVSRYLT AX189LCDR2 (SEQIDNO:91) AASSLQS AX189LCDR3 (SEQIDNO:92) QAYDYSLSGYV AX189VHaminoacidsequence: (SEQIDNO:93) EVQLLESGGGLVQPGGSLRLSCKASGYTFSSYWMHWVRQAPGKGLEWIGR IDPYNGGTKYNEKFKGKATISRDNSKNTLYLQMNSLRAEDTAVYYCARYG YYLGSYAMDYWGQGTLVTVSS e.g.,whereintheheavychaincomprisestheCDRs: AX189HCDR1 (SEQIDNO:94) GYTFSSYWMH AX189HCDR2 (SEQIDNO:95) RIDPYNGGTKYNEKFKG AX189HCDR3 (SEQIDNO:96) YGYYLGSYAMDY 1462/1282heavychainaminoacidsequence: (SEQIDNO:97) QVQLVQSGAEVKKPGASVKVSCKVSGYTFTDYYMNWVRQAPGQGLEWI GDINPNNGGAIYNQKFKGRATLTVDKSTSTAYMELRSLRSDDTAVYYCT SGIITEIAEDFWGQGTLVTVSS e.g.,whereintheheavychaincomprisestheCDRs: 1462/1282HCDR1 (SEQIDNO:98) GYTFTDYYMN, 1462/1282HCDR2 (SEQIDNO:99) DINPNNGGAIYNQKFKG 1462/1282HCDR3 (SEQIDNO:100) GIITEIAEDF; 1462/1282lightchainaminoacidsequence: (SEQIDNO:101) DIQMTQSPSSLSASVGDRVTITCKASQNVGTNVVWYQQKPGKAPKALIHS ASYRYSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYKTYPYTFGQ GTKVEIKR e.g.,whereinthelightchaincomprisestheCDRs: 1462/1282LCDR1 (SEQIDNO:102) KASQNVGTNVV, 1462/1282LCDR2 (SEQIDNO:103) SASYRYS 1462/1282LCDR3 (SEQIDNO:104) QQYKTYPYT.

(86) For example, in a embodiment of the invention, the 3M cell is used to express one or both chains of etanercept (CAS No. 185243-69-0; Drug Bank No. DB00005).

Protein Expression

(87) The processes of the present invention include methods for expressing a polypeptide comprising steps wherein various feeds are added to an initial mammalian 3M cell growth medium. These feeds include hydrolysate feed, vitamin/salt feed, amino acid feed and nutrient feed. The present invention also includes compositions comprising a 3M cell in any of the mediums discussed herein.

(88) The initial mammalian cell growth medium can be any of several types of aqueous mediums known in the art; and the meaning of this term would be readily known by any practitioner of ordinary skill in the art. Examples include EX-CELL ACF CHO medium (Sigma-Aldrich (St. Louis, Mo.)). EX-CELL ACF CHO medium is a commercial medium that is animal-component free, with HEPES, without L-glutamine. The medium contains inorganic salts, HEPES and sodium bicarbonate buffers, essential and non-essential amino acids, vitamins, recombinant human insulin, plant hydrolysates, other organic compounds, trace elements, and surfactants. The medium does not contain antibiotics, antimycotics, L-glutamine, or transferring and also contains no animal-derived proteins or other components.

(89) Other examples of initial mammalian cell growth medium include DMEM, DMEM/F-12, F-10 Nutrient Mixture, RPMI Medium 1640, F-12 Nutrient Mixture, Medium 199, Eagle's MEM, RPMI, 293 media, and Iscove's Media. For example, Eagle's minimal essential medium (MEM) comprises L-Arginine hydrochloride (126 mg/l), L-Cystine 2HCl (31 mg/l), L-Histidine hydrochloride-H.sub.2O (42 mg/l), L-Isoleucine (52 mg/l), L-Leucine (52 mg/l), L-Lysine hydrochloride (73 mg/l), L-Methionine (15 mg/l), L-Phenylalanine (32 mg/l), L-Threonine (48 mg/I), L-Tryptophan (10 mg/l), L-Tyrosine disodium salt dehydrate (52 mg/l), L-Valine (46 mg/I), Choline chloride (1 mg/l), D-Calcium pantothenate (1 mg/l), Folic Acid (1 mg/l), Niacinamide (1 mg/l), Pyridoxal hydrochloride (1 mg/l), Riboflavin (0.1 mg/l), Thiamine hydrochloride (1 mg/l), i-Inositol (2 mg/l), Calcium Chloride (CaCl.sub.2) (anhyd.) (200 mg/l), Magnesium Sulfate (MgSO.sub.4) (anhyd.) (97.67 mg/l), Potassium Chloride (KCl) (400 mg/l), Sodium Bicarbonate (NaHCO.sub.3) (2200 mg/l), Sodium Chloride (NaCl) (6800 mg/l), Sodium Phosphate monobasic (NaH.sub.2PO.sub.4H.sub.2O) (140 mg/l), D-Glucose (Dextrose) (1000 mg/l) and Phenol Red (10 mg/l).

(90) Modified Eagle Medium (MEM) (2) comprises L-Arginine hydrochloride (504 mg/l), L-Cystine (96 mg/l), L-Glutamine (870 mg/l), L-Histidine hydrochloride-H.sub.2O (168 mg/l), L-Isoleucine (208 mg/l), L-Leucine (208 mg/l), L-Lysine hydrochloride (290 mg/l), L-Methionine (60 mg/l), L-Phenylalanine (128 mg/l), L-Threonine (192 mg/l), L-Tryptophan (40 mg/I), L-Tyrosine disodium salt dehydrate (208 mg/l), L-Valine (155 mg/l), Choline chloride (4 mg/l), D-Calcium pantothenate (4 mg/l), Folic Acid (4 mg/l), Niacinamide (4 mg/l), Pyridoxal hydrochloride (4 mg/l), Riboflavin (0.4 mg/l), Thiamine hydrochloride (4 mg/l), i-Inositol (8 mg/l), Calcium Chloride (CaCl.sub.2) (anhyd.) (285 mg/l), Ferric Nitrate (Fe(NO.sub.3).sub.39H.sub.2O) (1 mg/l), Magnesium Sulfate (MgSO.sub.4) (anhyd.) (195 mg/l), Potassium Chloride (KCl) (800 mg/l), Sodium Bicarbonate (NaHCO.sub.3) (8400 mg/l), Sodium Chloride (NaCl) (12800 mg/l), Sodium Phosphate monobasic (NaH.sub.2PO4-H.sub.2O) (250 mg/l) and D-Glucose (Dextrose) (9000 mg/l).

(91) RPMI Medium 1640 (1) comprises Glycine (10 mg/l), L-Arginine (200 mg/l), L-Asparagine (50 mg/l), L-Aspartic acid (20 mg/l), L-Cystine 2HCl (65 mg/l), L-Glutamic Acid (20 mg/l), L-Glutamine (300 mg/l), L-Histidine (15 mg/l), L-Hydroxyproline (20 mg/l), L-Isoleucine (50 mg/l), L-Leucine (50 mg/l), L-Lysine hydrochloride (40 mg/l), L-Methionine (15 mg/l), L-Phenylalanine (15 mg/l), L-Proline (20 mg/l), L-Serine (30 mg/l), L-Threonine (20 mg/l), L-Tryptophan (5 mg/l), L-Tyrosine disodium salt dehydrate (29 mg/l), L-Valine (20), Biotin (0.2 mg/l), Choline chloride (3 mg/l), D-Calcium pantothenate (0.25 mg/l), Folic Acid (1 mg/l), Niacinamide (1 mg/l), Para-Aminobenzoic Acid (1 mg/l), Pyridoxine hydrochloride (1 mg/l), Riboflavin (0.2 mg/l), Thiamine hydrochloride (1 mg/l), Vitamin B12 (0.005 mg/l), i-Inositol (35 mg/l), Calcium nitrate (Ca(NO.sub.3).sub.2 4H2O) (100 mg/l), Magnesium Sulfate (MgSO.sub.4) (anhyd.) (48.84 mg/l), Potassium Chloride (KCl) (400 mg/l), Sodium Bicarbonate (NaHCO3) (2000 mg/l), Sodium Chloride (NaCl) (6000 mg/l), Sodium Phosphate dibasic (Na.sub.2HPO.sub.4) anhydrous (800 mg/l), D-Glucose (Dextrose) (2000 mg/l) and Glutathione (reduced) (1 mg/l).

(92) Generally, for the purposes of the present invention, a hydrolysate feed includes wheat and/or soy hydrolysates. Generally, a soy or wheat hydrolysate is the product of an enzymatic digest of soy or wheat and can be purchased commercially. Typically, the hydrolysate is in cell culture grade water and is sterile. In an embodiment of the invention, the hydrolysate is a stock solution at 200 g/liter. In an embodiment of the invention, the hydrolysate is added to the culture medium to reach a final concentration of about 10 g/liter. In an embodiment of the invention, when using either the level 3 process or the enhanced process, the hydrolysate is added to the culture medium either initially, before, with or immediately after inoculation or at about 3 days after inoculation or when viable cell density reaches over about 110.sup.6 cells/ml.

(93) Viable cell density refers to the concentration of cells in the medium being analyzed (e.g., cells/ml) which are viable, e.g., capable of growth and replication (e.g., when used to inoculate a liquid culture or a solid culture medium) or capable of excluding a dye such as tryptan blue, eosin or propidium in a dye exclusion assay. Such assays are commonly known in the art.

(94) Generally, for the purposes of the present invention, a vitamin/salt feed includes:

(95) TABLE-US-00022 Sodium selenite e.g., at a concentration of about 7.13 10.sup.4 g/liter Adenine sulfate e.g., at a concentration of about 0.0816 g/liter Adenosine e.g., at a concentration of about 0.88 g/liter Cytidine e.g., at a concentration of about 0.88 g/liter Guanosine e.g., at a concentration of about 0.88 g/liter Uridine e.g., at a concentration of about 0.88 g/liter Hypoxanthine e.g., at a concentration of about 0.59 g/liter L-citrulline e.g., at a concentration of about 0.63 g/liter L-ornithine-HCl e.g., at a concentration of about 1.28 g/liter Biotin e.g., at a concentration of about 0.014 g/liter Flavin Adenine e.g., at a concentration of about 0.0025 g/liter Dinucleotide Folic Acid e.g., at a concentration of about 0.23 g/liter Lipoic Acid e.g., at a concentration of about 0.026 g/liter Niacin e.g., at a concentration of about 1.57 g/liter Pyridoxine HCl e.g., at a concentration of about 0.15 g/liter Riboflavin e.g., at a concentration of about 0.093 g/liter Thiamine HCl e.g., at a concentration of about 0.8 g/liter Vitamin E e.g., at a concentration of about 0.0188 g/liter Vitamin B12 e.g., at a concentration of about 0.17 g/liter Choline Chloride e.g., at a concentration of about 2.51 g/liter Ethanolamine HCl e.g., at a concentration of about 0.22 g/liter i-Inositol e.g., at a concentration of about 3.66 g/liter Thymidine e.g., at a concentration of about 0.39 g/liter Putrescine 2HCl e.g., at a concentration of about 0.02 g/liter Progesterone e.g., at a concentration of about 0.00075 g/liter; and D-Calcium e.g., at a concentration of about 1.19 g/liter Pantothenate

(96) In an embodiment of the invention, the vitamin/salt feed is a 50 stock solution. In an embodiment of the invention, the vitamin/salt feed is added to the culture medium to reach a final concentration of about 20 ml/liter. In an embodiment of the invention, the vitamin/salt feed is added to the culture between days 3 and 5, post-inoculation, or when viable cell density reaches over about 1.210.sup.6 cells/ml.

(97) Generally, for the purposes of the present invention, an amino acid feed includes:

(98) TABLE-US-00023 L-arginine e.g., at a concentration of about 6.32 g/liter L-cystine e.g., at a concentration of about 1.7 g/liter L-histidine e.g., at a concentration of about 2.1 g/liter L-isoleucine e.g., at a concentration of about 2.6 g/liter L-leucine e.g., at a concentration of about 2.6 g/liter L-lysine e.g., at a concentration of about 3.6 g/liter L-Methionine e.g., at a concentration of about 0.76 g/liter L-phenylalanine e.g., at a concentration of about 1.65 g/liter L-threonine e.g., at a concentration of about 2.38 g/liter L-tryptophan e.g., at a concentration of about 0.51 g/liter L-tyrosine e.g., at a concentration of about 1.8 g/liter L-valine e.g., at a concentration of about 2.34 g/liter L-alanine e.g., at a concentration of about 0.89 g/liter L-asparagine e.g., at a concentration of about 1.5 g/liter L-aspartic acid e.g., at a concentration of about 1.33 g/liter L-glutamic acid e.g., at a concentration of about 1.47 g/liter Glycine e.g., at a concentration of about 0.75 g/liter L-proline e.g., at a concentration of about 1.15 g/liter; and L-serine e.g., at a concentration of about 1.05 g/liter

(99) In an embodiment of the invention, two separate amino acid feed stock solutions are prepared: a 100 stock solution including L-alanine, L-asparagine, L-aspartic acid, L-glutamic acid, glycine, L-proline and L-serine at the concentrations set forth above; and and a 50 solution including L-arginine, L-cystine, L-histidine, L-isoleucine, L-leucine, L-lysine, L-Methionine, L-phenylalanine, L-threonine, L-tryptophan, L-tyrosine, and L-valine at the concentrations set forth above. These stocks can be made and added separately to the culture medium. In an embodiment of the invention, the amino acid stock solution is added to the initial medium at day 0, before, with or immediately after cell inoculation.

(100) Generally, for the purposes of the present invention, a nutrient feed includes:

(101) TABLE-US-00024 L-asparagine: e.g., at a concentration of about 40.6 g/liter L-proline e.g., at a concentration of about 10.81 g/liter L-isoleucine e.g., at a concentration of about 18.53 g/liter L-cysteine-HCl e.g., at a concentration of about 11.19 g/liter L-leucine e.g., at a concentration of about 16.58 g/liter L-threonine e.g., at a concentration of about 8.2 g/liter L-tyrosine e.g., at a concentration of about 9.9 g/liter L-arginine e.g., at a concentration of about 9.29 g/liter L-aspartic acid e.g., at a concentration of about 3.56 g/liter L-glutamic acid e.g., at a concentration of about 6.28 g/liter Glycine e.g., at a concentration of about 2.83 g/liter L-histidine e.g., at a concentration of about 6.23 g/liter L-methionine e.g., at a concentration of about 6.58 g/liter L-tryptophan e.g., at a concentration of about 4.93 g/liter L-lysine e.g., at a concentration of about 14.66 g/liter L-phenylalanine e.g., at a concentration of about 8.64 g/liter L-valine e.g., at a concentration of about 13.08 g/liter L-serine: e.g., at a concentration of about 13 g/liter Sodium phosphate e.g., at a concentration of about 14.41 g/liter monobasic: Zinc sulfate: e.g., at a concentration of about 0.054 g/liter Cupric sulfate: e.g., at a concentration of about 0.00016 g/liter Ammonium e.g., at a concentration of about 0.000039 g/liter vanadate: Cobalt chloride: e.g., at a concentration of about 0.000125 g/liter Nickel dichloride e.g., at a concentration of about 0.00002 g/liter hexahydrate: Sodium molybdate e.g., at a concentration of about 0.000008 g/liter dehydrate: Tin chloride e.g., at a concentration of about 0.000004 g/liter dehydrate: Manganese chloride: e.g., at a concentration of about 0.000015 g/liter tetrahydrate:

(102) In an embodiment of the invention, the nutrient feed is a 50 stock solution. In an embodiment of the invention, the nutrient feed is added to the culture medium to reach a final concentration of about 20 ml/liter. In an embodiment of the invention, the nutrient feed is added to the culture between days 3 and 5, post-inoculation, or when viable cell density reaches about 1.210.sup.6 cells/ml.

(103) Furthermore, in an embodiment of the invention, glucose (from a 2.5 M stock solution) and L-glutamine (from a 0.2 M stock solution) are added to the culture medium at any point, e.g., when the concentration of the nutrients fall below 1.5 g/liter glucose and/or 150 mg/liter L-glutamine.

(104) The present invention also includes processes wherein the osmolality and/or the temperature of the culture is optionally shifted. The osmolality or temperature shift may be done at any point in-process.

(105) The osmolality shift has been shown to increase culture specific productivity as well as cell viability. Typically, the initial mammalian cell growth medium has a starting osmolality of about 300 mOsm. The osmolality shift of the present invention, however, includes shifting the culture osmolality to from about 400 mOsM to about 500 mOsm.

(106) Osmolality is a measure of the osmoles of solute per kilogram of solvent. Osmolality can be measured using an osmometer which measures colligative properties, such as freezing-point depression, vapor pressure, or boiling-point elevation.

(107) Osmolality of a cell culture may be shifted by any of several means. For example, a concentrated salt solution (e.g., including 5M NaCl salts stock, 8-12 mL/L added), soy hydrolysate solution (200 g/L stock, 50-80 mL/L added), sodium carbonate or sodium bicarbonate or carbon dioxide may be added. In an embodiment of the invention, adding the nutrient feed to the medium shifts the osmolality.

(108) In an embodiment of the invention, the temperature of the culture is optionally shifted, e.g., in a step change, from about 36.5 C. (0.5 C.) to between about 33 C. and 35 C.

(109) Vectors, such as plasmids, including a gene to be expressed by a process of the present invention, e.g., an immunoglobulin chain such as any of those discussed herein, may be introduced into a 3M host cell by any of several methods known in the art. Transformation can be carried out, e.g., by the calcium phosphate precipitation method as described by Graham and Van der Eb, Virology, 52: 546 (1978). Other methods for introducing DNA into 3M cells such as by nuclear injection or by protoplast fusion may also be used. Methods for transformation also include electroporation, liposomal transformation and DEAE-Dextran transformation.

(110) Host 3M cells comprising a gene to be expressed using a process of the present invention may be further selected and screened to identify the clone with the requisite characteristics for expression of a target gene. One common approach, to achieve maximal expression, involves the use of mutant cell lines and a gradual increase in the selection pressure over several months for a co-transfected selection marker such as dihydrofolate reductase (DHFR) (Kaufman et al. (1982) J. Mol. Biol. 159: 601-621; Schimke et al. (1982) Natl. Cancer Inst. Monogr. 60: 79-86). In order to achieve high production rates, a dihydrofolate reductase (DHFR) negative cell line (e.g., a CHO cell line) (Urlaub et al. (1980) Proc. Natl. Acad. Sci. USA 77: 4216-4220) is transformed with an expression vector containing a functional DHFR gene in combination with the target gene to be expressed. Amplification of the vector-inserted target genes occurs in response to addition of increasing amounts of the DHFR antagonist methotrexate (MTX) to the culture medium and clones or subpopulations carrying multiple copies of the recombinant genes are generated and can be selected (Wurm (1990) Biologicals 18:159-164). The gene amplification process typically takes several months until stable cell lines are obtained which show high target gene copy numbers and high production rates of the desired protein. 3M cells comprising a DHFR gene, as well as cells that have undergone amplification of DHFR and a target gene (e.g., an immunoglobulin gene) form part of the invention. In an embodiment of the invention, 3M cells have not undergone any amplification (e.g., DHFR amplification). In an embodiment of the invention, target genes to be expressed from the 3M cells exist in only about one copy per cell.

(111) In an embodiment of the invention, a polynucleotide, e.g., encoding an immunoglobulin chain and/or a DHFR gene, is integrated into 3M host cell chromosomal DNA or is in a vector that is ectopic and autonomously replicating. In an embodiment of the invention, the polynucleotide of the present invention is present in the 3M cell at several copies per cell (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20). Where an expression vector has been integrated into the genomic DNA of the host 3M cell to improve stability, the copy number of the vector DNA, and, concomitantly, the amount of product which could be expressed, can be increased by selecting for cell lines in which the vector sequences have been amplified after integration into the DNA of the host cell. Integrated genes may be screened for the presence and relative amount of chromosomally incorporated DNA and corresponding mRNA and polypeptide synthesis by standard methods. For example, the presence of the desired integrate may be detected by standard procedures such as DNA sequencing, Southern blotting, Northern blotting and/or Western blotting.

(112) A 3M cell line may also be stored in a master cell bank (MCB) and/or working cell bank (WCB). Typically, when a cell line is to be used over many manufacturing cycles, a two-tiered cell banking system consisting of a master cell bank or master seed bank (MSB) and a working cell bank can be established. A cell line is established from a single host cell clone and this cell line is used to make-up the MCB. Generally, this MCB must be characterized and extensively tested for contaminants such as bacteria, fungi, viruses and mycoplasma. A sample of cells from the MCB can be expanded to form the WCB, which is characterized for cell viability prior to use in a manufacturing process. The cells in a MCB or WCB can be stored in vials, for example, at low temperature (e.g., 0 C. or lower, 20 C. or 80 C.).

(113) Methods for expressing a polypeptide, e.g., an immunoglobulin, using a 3M cell of the present invention comprises, in an embodiment of the present invention:

(114) 1Expanding 3M Cells Expressing the Polypeptide in a Standard Initial Mammalian Growth Medium.

(115) This expansion can be done, for example, in shake flasks. In an embodiment of the invention, expansion occurs by growth to about 1-210.sup.6 cells/ml, dilution of a sample of those cells (e.g., to a density of about 2.5-510.sup.5 cells/ml) and, then, regrowth to about 1-210.sup.6 cells/ml, for about 10-30 cycles.

(116) 2inoculating an initial mammalian cell growth medium with the expanded 3M cells, to a cell density of about 2.5-510.sup.5 cells/ml, and adding supplements to the medium. The supplements are soy and/or wheat hydrolysate, amino acid feed, vitamin/salt feed, nutrient feed, glucose and L-glutamine.

(117) The day of inoculation is day 0, the following day is day 1, the following day is day 2, and so on.

(118) Soy and/or wheat hydrolysates are added, for example, either on day 0 or after viable cell density has reached over about 10.sup.6 cells/ml. In an embodiment of the invention, the hydrolysate(s) are simply added on day 3.

(119) Amino acid feeds (discussed herein) are added, for example, at day 0, e.g., to reach approximate final culture concentrations as set forth below (not including the concentration of any indicated component from other sources such as from the initial mammalian cell growth medium):

(120) TABLE-US-00025 Component Final concentration in culture (mg/liter) L-arginine 126.4 L-cystine 34 L-histidine 42 L-isoleucine 52 L-leucine 52 L-lysine 72 L-Methionine 15.2 L-phenylalanine 33 L-threonine 47.6 L-tryptophan 10.2 L-tyrosine 36 L-valine 46.8 L-alanine 8.9 L-asparagine 30 L-aspartic acid 26.6 L-glutamic acid 29.4 Glycine 15 L-proline 23 L-serine 21

(121) In an embodiment of the invention, amino acid feeds are not added to the medium.

(122) Vitamin/salt feed solution (discussed above) is added, for example, between days 3 and 5 or when viable cell density reaches about 1.210.sup.6 cells/ml, e.g., to reach approximate final culture concentrations set forth below (not including the concentration of any indicated component from other sources such as from the initial mammalian cell growth medium):

(123) TABLE-US-00026 Component Final culture concentrations (mg/liter) Sodium selenite 0.01426 Adenine sulfate 1.632 Adenosine 17.6 Cytidine 17.6 Guanosine 17.6 Uridine 17.6 Hypoxanthine 11.8 L-citrulline 12.6 L-ornithine-HCl 25.6 Biotin 0.28 Flavin Adenine Dinucleotide 0.05 Folic Acid 4.6 Lipoic Acid 0.52 Niacin 31.4 Pyridoxine HCl 3 Riboflavin 1.86 Thiamine HCl 16 Vitamin E 0.376 Vitamin B12 3.4 Choline Chloride 50.2 Ethanolamine HCl 4.4 i-Inositol 73.2 Thymidine 7.8 Putrescine 2HCl 0.4 Progesterone 0.015 D-Calcium Pantothenate 23.8

(124) Some components of the vitamin/salt feed are also in other feeds such as the amino acid feed. These final culture concentrations are of the components from the vitamin/salt feed and do not reflect the cumulative concentrations of the indicated components from both the amino acid feed and the vitamin/salt feed.

(125) Nutrient feed (discussed herein) is added, for example, between days 3 and 5 or when viable cell density reaches about 1.210.sup.6 cells/ml, e.g., to reach approximate final culture concentrations set forth below (not including the concentration of any indicated component from other sources such as from the initial mammalian cell growth medium or amino acid feed):

(126) TABLE-US-00027 Final culture concentration Component (mg/liter) L-asparagine: 812 mg/liter L-proline 216 mg/liter L-isoleucine 370 mg/liter L-cysteine-HCl 224 mg/liter L-leucine 332 mg/liter L-threonine 164 mg/liter L-tyrosine 198 mg/liter L-arginine 186 mg/liter L-aspartic acid 71 mg/liter L-glutamic acid 126 mg/liter Glycine 57 mg/liter L-histidine 125 mg/liter L-methionine 132 mg/liter L-tryptophan 99 mg/liter L-lysine 293 mg/liter L-phenylalanine 174 mg/liter L-valine 262 mg/liter L-serine: 260 mg/liter Sodium phosphate monobasic: 288.2 mg/liter Zinc sulfate: 1.08 mg/liter Cupric sulfate: 0.0032 mg/liter Ammonium vanadate: 0.00078 mg/liter Cobalt chloride: 0.0025 mg/liter Nickel dichloride hexahydrate: 0.0004 mg/liter Sodium molybdate dehydrate: 0.00016 mg/liter Tin chloride dehydrate: 0.00008 mg/liter Manganese chloride tetrahydrate: 0.0003 mg/liter

(127) Some components of the nutrient feed are also in other feeds such as the amino acid feed. These final culture concentrations are of the components from the nutrient feed and do not reflect the cumulative concentrations of the indicated components from both the amino acid feed and the nutrient feed.

(128) Glucose is added, for example, when the glucose concentration in the culture medium falls below about 1.5 g/liter and L-glutamine is added, for example, when the glutamine concentration in the culture medium falls below about 150 mg/liter.

(129) 3Optionally, harvesting the 3M cells from the production cell culture medium, e.g., when viability is below about 60%, by removing the cells from the culture medium (e.g., by lowering the temperature of the cells to about 15 C., adding sodium-phosphate buffer to stabilize the pH at about 6.8 and centrifuging the culture medium to clarify it of cells). If the protein is secreted, the medium can be retained for further processing, if the protein is not secreted, the 3M cells can be retained for further processing.

(130) Any of several methods can be used to remove the 3M cells from the medium, e.g., by centrifugation. For example, using a continuous disk-stack centrifuge, e.g., with a flow rate/sigma (cm/sec) of about 9.2710.sup.7.

(131) Furthermore, the medium can be filtered to remove 3M cells, e.g., by depth filtration with or without a centrifuge. For example, with a centrifuge, the process can, in an embodiment of the invention, comprise use of an 82 L broth/ft.sup.2 filter (e.g., charged cellulose filter); without a centrifuge, the process can, in an embodiment of the invention, comprise use of a 203 L broth/ft.sup.2 filter.

(132) In addition, the medium can be filtered through a fine filter, for example, with a 0.2 micron pore size (e.g., a PVDF filter).

(133) and;

(134) 4Optionally Further Purifying the Protein, e.g., Antibody, for Example, Chromatographically.

(135) Optionally, the osmolality of the culture is shifted to about 400 mOsm to about 500 mOsm (discussed herein). In an embodiment of the invention, this shift occurs when the cells are at a density of at or above 110.sup.6 cells/ml.

(136) Optionally, the temperature of the 3M cell culture temperature is shifted to 33 C. to about 35 C. (discussed herein). In an embodiment of the invention, this shift occurs, between days 4 and 8, e.g., when the change in viable cell density over a 24 hour period is less than 10%.

(137) In an embodiment of the invention, the 3M cell culture O.sub.2 concentration, pH and temperature conditions are continuously monitored and adjusted during cell growth. In an embodiment of the invention, O.sub.2 concentration is monitored and maintained at about 60% during cell growth; and/or pH is continuously monitored and maintained at about 6.8 (e.g., 0.02) during cell growth; and/or temperature is continuously monitored and maintained at about 36.5 C. (e.g., about 0.5 C.) during cell growth

(138) 3M cell growth can be performed in any of several systems. For example, cell growth can be done in a simple flask, e.g., a glass shake flask. Other systems include tank bioreactors, bag bioreactors and disposable bioreactors. A tank bioreactor includes, typically, a metal vessel (e.g., a stainless steel jacketed vessel) in which cells are grown in a liquid medium. Tank bioreactors can be used for a wide range of culture volumes (e.g., 100 l, 150 l, 10000 l, 15000 l). Tank bioreactors often have additional features for controlling cell growth conditions, including means for temperature control, medium agitation, controlling sparge gas concentrations, controlling pH, controlling O.sub.2 concentration, removing samples from the medium, reactor weight indication and control, cleaning hardware, sterilizing the hardware, piping or tubing to deliver all services, adding media, control pH, control solutions, and control gases, pumping sterile fluids into the growth vessel and, supervisory control and a data acquisition. Classifications of tank bioreactor include stirred tank reactors wherein mechanical stirrers (e.g., impellers) are used to mix the reactor to distribute heat and materials (such as oxygen and substrates). Bubble column reactors are tall reactors which use air alone to mix the contents. Air lift reactors are similar to bubble column reactors, but differ by the fact that they contain a draft tube. The draft tube is typically an inner tube which improves circulation and oxygen transfer and equalizes shear forces in the reactor. In fluidized bed reactors, cells are immobilized on small particles which move with the fluid. The small particles create a large surface area for cells to stick to and enable a high rate of transfer of oxygen and nutrients to the cells. In packed bed reactors cells are immobilized on large particles. These particles do not move with the liquid. Packed bed reactors are simple to construct and operate but can suffer from blockages and from poor oxygen transfer. A disposable bioreactor is a disposable, one-time use bioreactor. Often, disposable bioreactors possess features similar to non-disposable bioreactors (e.g., agitation system, sparge, probes, ports, etc.).

(139) The present invention includes any liquid culture medium, comprising one or more 3M cells, generated by any of the processes set forth herein, including 3M containing culture mediums generated as intermediates during practice of any of the cell culture methods discussed herein; for example, produced by a process comprising inoculating an initial mammalian cell growth medium, pre-warmed to about 37 C.; which medium comprises HEPES, sodium bicarbonate buffers, inorganic salts, non-essential amino acids, recombinant human insulin, trace elements and surfactants; and which does not comprise L-glutamine, antibiotics, antimycotics or animal-derived components; with 3M cells expressing an antibody light chain immunoglobulin and heavy chain immunoglobulin, to a cell density of about 2.5-510.sup.5 cells/ml; and, adding the following supplements to the medium before, simultaneously with or immediately after said inoculation:

(140) soy hydrolysate to a final concentration of about 10 g/liter;

(141) and, optionally, an amino acid feed wherein the concentration of the components added by said amino acid feed are approximately those set forth below:

(142) TABLE-US-00028 L-arginine: 126.4 mg/liter L-cystine: 34 mg/liter L-histidine: 42 mg/liter L-isoleucine: 52 mg/liter L-leucine: 52 mg/liter L-lysine: 72 mg/liter L-Methionine: 15.2 mg/liter L-phenylalanine: 33 mg/liter L-threonine: 47.6 mg/liter L-tryptophan: 10.2 mg/liter L-tyrosine: 36 mg/liter L-valine: 46.8 mg/liter L-alanine: 8.9 mg/liter L-asparagine: 30 mg/liter L-aspartic acid: 26.6 mg/liter L-glutamic acid: 29.4 mg/liter glycine: 15 mg/liter L-proline: 23 mg/liter L-serine: 21 mg/liter;
and, when viable cell density reaches over about 1.210.sup.6 cells/ml, adding supplement feeds wherein the concentration of the components added by said supplement feeds are approximately those set forth below:

(143) TABLE-US-00029 Sodium selenite: 0.01426 mg/liter Adenine sulfate: 1.632 mg/liter Adenosine: 17.6 mg/liter Cytidine: 17.6 mg/liter Guanosine: 17.6 mg/liter Uridine: 17.6 mg/liter Hypoxanthine: 11.8 mg/liter L-citrulline: 12.6 mg/liter L-ornithine-HCl: 25.6 mg/liter Biotin: 0.28 mg/liter Flavin Adenine Dinucleotide: 0.05 mg/liter Folic Acid: 4.6 mg/liter Lipoic Acid: 0.52 mg/liter Niacin: 31.4 mg/liter Pyridoxine HCl: 3 mg/liter Riboflavin: 1.86 mg/liter Thiamine HCl: 16 mg/liter Vitamin E: 0.376 mg/liter Vitamin B12: 3.4 mg/liter Choline Chloride: 50.2 mg/liter Ethanolamine HCl: 4.4 mg/liter i-Inositol: 73.2 mg/liter Thymidine: 7.8 mg/liter Putrescine 2HCl: 0.4 mg/liter Progesterone: 0.015 mg/liter D-Calcium Pantothenate: 23.8 mg/liter L-asparagine: 812 mg/liter L-proline 216 mg/liter L-isoleucine 370 mg/liter L-cysteine-HCl 224 mg/liter L-leucine 332 mg/liter L-threonine 164 mg/liter L-tyrosine 198 mg/liter L-arginine 186 mg/liter L-aspartic acid 71 mg/liter L-glutamic acid 126 mg/liter Glycine 57 mg/liter L-histidine 125 mg/liter L-methionine 132 mg/liter L-tryptophan 99 mg/liter L-lysine 293 mg/liter L-phenylalanine 174 mg/liter L-valine 262 mg/liter L-serine: 260 mg/liter Sodium phosphate monobasic: 288.2 mg/liter Zinc sulfate: 1.08 mg/liter Cupric sulfate: 0.0032 mg/liter Ammonium vanadate: 0.00078 mg/liter Cobalt chloride: 0.0025 mg/liter Nickel dichloride hexahydrate: 0.0004 mg/liter Sodium molybdate dehydrate: 0.00016 mg/liter;
and, during cell growth, adding glucose to the medium when glucose levels fall below about 1.5 g/liter and adding L-glutamine when L-glutamine levels fall below about 150 mg/liter; and during cell growth maintaining O.sub.2 concentration at about 60%; pH at about 6.80.02 and temperature at about 36.5 C.0.5 C.; for example, wherein the medium comprises cells that have reached about 60% viability.

EXAMPLES

(144) The present invention is intended to exemplify the present invention and not to be a limitation thereof. Any method or composition disclosed below falls within the scope of the present invention.

Example 1

Generation of 3M Cell Line

(145) Previous unsuccessful attempts were made to pre-adapt CHO host cell lines for efficient growth in serum free media. One attempt was made to gradually adapt host cells into ISCHO-V (a commercially available cell culture medium containing no animal components; available from Irvine Scientific; Santa Ana, Calif.) serum-free medium in suspension for 56 days and then re-adapt back to serum-containing medium in attachment. The cell line was named DXB-IS-A (also known as ISA).

(146) In another attempt, a new serum-free protein-free media formulation, C5467, developed by Sigma-Aldrich Inc. was adapted to scale up antibody production for select clones. Therefore, the attempt was made to gradually adapt host cells into Sigma C5467 medium in suspension for 41 days and then re-adapt back to serum-containing medium in attachment. The cell line generated with this method was named DXB-Sig-A. This cell line was compared with ISA. The cell growth and viability, during suspension adaptation into C5467 medium, of the transfected cell lines derived from DXB-Sig-A and of the ISA cell line, were compared. However, the DXB-Sig-A cell line was found to be even harder than ISA to adapt into the C5467 medium.

(147) Additionally, an attempt was made to simulate the newly developed strategy by abruptly adapting host cells into modified Sigma C5467 medium in suspension for 83 days. The cell line generated with this method was named DXB host (3 mo). This new cell line performed about the same as ISA. Cell growth and viability during suspension adaptation into modified C5467, of the transfected cell lines derived from the DXB host (3 mo) and of the ISA cell line, were compared.

(148) It was concluded that a new approach, other than mere serum-free adaptation, was needed to make these cells more robust. The approach of the present invention was performed by subcloning the DXB host (3 mo) into C5467 medium in 96 well plates twice to ensure purity, recoverability, stability, and consistency in performance in serum-free environment. The new cell line that was made, 3M (also known as DXBHost 2XSusp), was found to be superior to ISA when transformed with anti-IL23, anti-HGF, or cyno-anti-TSLP expression constructs, in terms of cell growth, clone recovery, and the rate of successful clones growing and producing desirable amounts of antibody in serum-free suspension conditions.

(149) Materials & Methods

(150) Cell Thawing.

(151) To revive DXB11 CHO host (3 mo) cells for expansion, a frozen vial was partially submerged into a 37 C. circulating water bath until the content just thawed (about 1-2 min). The content was then transferred into a T75 flask with 20 ml host medium and then grown. A medium exchange with fresh host medium was performed the next day.

(152) Subcloning.

(153) When cells in the T75 flask reached about 90% confluency, cells were trypsinized and resuspended in 8 ml of host medium. Four ml of the cell suspension was centrifuged at 1000 rpm for 15 minutes. The cell pellet was resuspended with 4 ml of serum-free host medium and 100 ul of cell suspension was two-fold serial diluted across each well in the 8 rows of a 96 well plate containing 100 ul of medium in each well. Each well of the 96-well plate was supplemented with additional 100 ul of fresh serum-free host medium. The plates were incubated at 37 C. in a 7.5% CO.sub.2 incubator with high humidity for 2 weeks. Cells from the wells at the dilution end point of each row were harvested and were transferred to T25 flasks containing 2 ml of serum-free host media. The T-25 flasks were maintained in a 37 C. incubator with 7.5% CO.sub.2 and were agitated at 70 rpm on an orbital shaker for one week. Cells from T-25 flasks were subcloned into 96-well plates and scaled up again to T25 flasks with the procedures described above.

(154) Cell Expansion.

(155) Two ml of cells in T25 flask were transferred into a T75 flask with 5 ml of serum-free host media and were agitated at 70 rpm for 4 days. Cells were then transferred into shake flasks to scale up, i.e., 18 ml for 125-ml flask, 45 ml for 250-ml flask, and 135 ml for 500-ml flask, and were agitated at 105 rpm.

(156) Cell Bank Preparation.

(157) When the cells in the 500-ml shake flask reached a density of 1.710.sup.6 cells/ml, cells were harvested and centrifuged at 1000 rpm for 10 minutes. Cell pellets were resuspended in 20 ml of freezing medium. Cells were aliquoted into twenty 1.8 ml CryoTubes, loaded into a freezing container and placed in a 80 C. freezer overnight. Frozen vials were then transferred into a liquid nitrogen freezer for long-term storage.

(158) TABLE-US-00030 TABLE 1 List of Media (See Table 2 for the List of Components or Chemicals) Medium Name Components Growth medium (general Growth medium could be host term for the media used medium or serum-free host medium. to grow host cells or transfected cells, either in adherent or suspension mode.) Host medium MEM+ with 10% cFBS Serum-free host medium JRH ImMEDIAte ADVANTAGE 65778 with 40 ml/L glutamine, 10 ml/L HT, 20 ml/L GSEM, 1 ml/L Trace A, 1 ml/L Trace B, 1 ml/L CD Lipid, 1 ml/L Mix 1 Freezing medium Growth medium (add 10% serum if serum- free) + 10% DMSO

(159) TABLE-US-00031 TABLE 2 List of Materials Used Component or Chemical Name Comments MEM+ = Minimum Essential Medium with (Gibco CAT# 12571- nucleotides and nucleosides 063) cFBS* = Characterized Fetal Bovine HyClone CAT# Serum, -irradiated SH30071.03 JRH ImMEDIAte ADVANTAGE 65778 = SAFC CAT# 65778- SAFC C5467-44 (w/o ATA (aurine 1000M3367 tricarboxylic acid), w/o L- Glutamine). Glucose 45% solution Sigma CAT# G8769 Glutamine (200 mM) Gibco CAT# 25030-081 HT = HT Supplement (100X)mixture of Gibco CAT# 11067-030 sodium hypoxanthine and thymidine GSEM = GSEM Supplement (50X) SIGMA CAT# G9785 Mix 1 = CHO Kit 2 Iron Chelator SIGMA Trace A = Trace Elements A (1000X) Cellgro CAT# 99-182-C Trace B = Trace Elements B (1000X) Cellgro CAT# 99-175-CI CD Lipid = Chemically Defined Lipid Gibco CAT# 11905-031 Concentrate Trypsin = Trypsin-EDTA (1X) Gibco CAT# 25300-054 DMSO = Dimethyl Sulphoxide Sigma CAT# 2650
Trace Elements A (1000)
1.6 mg/l CuSO.sub.4.5H.sub.2O
863.00 mg/l ZnSO.sub.4.7H.sub.2O
17.30 mg/l Selenite.2Na
1155.10 mg/l Ferric citrate
Trace Elements B (1000)
0.17 mg/l MnSO.sub.4.H.sub.2O
140.00 mg/l Na.sub.2SiO.sub.3.9H.sub.2O
1.24 mg/l Molybdic acid,
Ammonium salt
0.65 mg/l NH.sub.4VO.sub.3
0.13 mg/l NiSO.sub.4.6H.sub.2O
0.12 mg/l SnCl (anhydrous)
Chemically Defined Lipid Concentrate
2 mg/l Arachidonic Acid
220 mg/l Cholesterol
70 mg/l DL-alpha-Tocopherol Acetate
100% Ethyl Alcohol
10 mg/l Linoleic Acid
10 mg/l Linolenic Acid
10 mg/l Myristic Acid
10 mg/l Oleic Acid
10 mg/l Palmitic Acid
10 mg/l Palmitoleic Acid
90000 mg/l Pluronic F-68
10 mg/l Stearic Acid
2200 mg/l Tween 80
GSEM Supplement
450.0 mg/l L-alanine; 4261.0 mg/l L-asparagine.H.sub.2O; 650.0 mg/l L-aspartic acid; 3750.0 mg/I L-glutamic acid; 575.0 mg/l L-proline; 500.0 mg/l L-serine; 350.0 mg/l adenosine; 350.0 mg/I Guanosine; 350.0 mg/l Cytidine; 350.0 mg/l uridine; and 12.0 mg/l thymidine.

(160) TABLE-US-00032 TABLE 3 Lab Equipment and Supplies Lab Equipments and Supplies Catalog, Part, or Model Number CEDEX Counter = CEDEX Automated Innovatis Cell Culture Analyzer 7.5% CO.sub.2 incubator Forma Scientific Model # 3950 Orbital shaker Forma Scientific Model # 416 Allegra-6R benchtop centrifuge Beckman Model # 366816 80 C. Biofreezer Forma Scientific Model # 8584 Liquid nitrogen Cryo plus 3 freezer Forma Scientific Model # 7404 Circulating water bath Precision Model # 51221035 96-well plates Falcon Cat # 353072 T-25 flasks Corning Cat # 430639 T-75 flasks Corning Cat # 430725 125 ml shake flask Corning Cat # 431143 250 ml shake flask Corning Cat # 431144 500 ml shake flask Corning Cat # 431145 1 L shake flask Corning Cat # 431147 1.8 ml CryoTube Nunc Cat # 368632 15 ml-conical tube Falcon Cat # 352097 freezing container = Controlled rate Nalgene Cat # 5100-0001 freezing container = .Mr. Frosty.
Results and Discussion

(161) The 3M (DXBHost 2XSusp) cell line was compared with the old standard host cell line ISA (DXB-IS-A) in the performance of cell growth potential and antibody production. The cell growth potential was evaluated at the host cell stage (i.e., before transfection and subcloning) to avoid clonal variations. The antibody production potential of these two cell lines was evaluated at the cloning stage (i.e., after 19-days of incubation in 96-wells after transfection) and also after adaptation into suspension in serum-free media.

(162) 3M had better cell growth potential than ISA. Both 3M and ISA cells were seeded at 0.510.sup.6 cells/ml with 60 ml serum-free host medium in 250-ml shake flasks. The flasks were agitated at 105 rpm until cell viability reached just below 40%. In batch mode (as shown in FIG. 1), 3M cells reached higher cell density (2.310.sup.6 cells/ml vs. 1.710.sup.6 cells/nil) and lasted for a longer culture time (20 days vs. 10 days) than ISA cells. This means that 3M cells were more robust than ISA cells in serum-free suspension conditions. In theory, if specific antibody productivity is the same for both cell lines after transfection, 3M would produce more antibody than ISA due to higher density and longevity of cells.

(163) The cloning recovery efficiency of 3M and ISA cell lines was compared after transfection with vectors encoding murine anti-IL17 immunoglobulin chains. This was done by counting the number of clones, including multiple clones in single wells, recovered from five 96-well plates with the same seeding cell density. As shown in FIG. 2, the number of clones recovered from five 96 well plates were 58 for 3M and only 17 for ISA. Multiple-clone counting was performed only once. 3M had better cloning recovery efficiency than ISA in all other projects (i.e., anti-IL23 antibody, anti-hepatocyte growth factor and cyno anti-TSLP).

(164) Both 3M and ISA cells were transfected using the vectors containing cDNAs for selection markers (i.e., dhfr & hygromycin B resistance) and for antibody light and heavy immunoglobulin chains. The antibody titers in 96 wells after subcloning for 19 days between the hosts 3M and ISA were compared for three expression constructs, anti-IL23 (3 cDNA versions), anti-HGF, and cyno-anti-TSLP.

(165) As shown in FIG. 3, in the cases of versions 2 & 3 of anti-IL-23, the titer distribution of 3M was only slightly higher than that of ISA (at the lower range). In the cases of version 1 of anti-IL23, cyno-anti-TSLP, and first transfection of anti-HGF, the titer distribution of 3M was much higher than for that of ISA. While, for the second transfection of anti-HGF, the titer distribution was reversed, i.e., ISA was slightly higher than that of 3M. Thus, the titer distribution of 3M was statistically higher than for that of ISA. However, exceptions did exist. The reason for the exceptions may be that the comparisons were done in attachment mode (i.e., wherein cells were grown in T75 flasks in adherent culture containing serum media, instead of growing in shake-flasks in suspension condition in a serum-free medium); therefore, the advantage of the robustness (obtained by serum-free suspension adaptation and cloning) of 3M may not have been evident in this subcloning stage in 96 wells.

(166) A key comparison between 3M and ISA is in the final stage of cell line development, i.e., in serum-free suspension mode. Since, at this stage, only a limited number of clones can be selected due to their good growth and sustainable antibody productivity, we compared the number of successful clones from 3M and ISA in different projects. Successful clones were defined, here, as cell lines with good cell growth and relatively high and stable specific productivity in serum-free suspension for over 40 generations. As described below, the majority of the successful clones from three major projects were found to be derived from 3M, instead of ISA:

(167) For anti-IL23, there were 3 versions of cDNAs tested.

(168) 1) For version 1 anti-IL23, the only successful clone was from 3M with a specific productivity of 8 pcd (picograms per cell per day) of immunoglobulin;

(169) 2) For version 2 anti-IL23, 6 out of 7 successful clones were from 3M (FIG. 4). The specific productivity in pcd for these 3M clones were 28, 25, 22, 13 and 8. One ISA clone had a specific productivity of 12 pcd of immunoglobulin, which was low compared to that of the 3M clones.
3) For version 3 anti-IL-23, all 5 successful clone were from 3M. The specific productivity in pcd of immunoglobulin for these 3M clones were 25, 21, 19, 15 and 10.

(170) For anti-HGF, gene non-optimized and optimized versions were generated. Factors affecting mRNA stability, e.g., GC content, ribosomal binding sites, consensus and cryptic splice sites, repeats and secondary structures, were considered during gene optimization.

(171) 1) For non-optimized versions, both of 2 successful clones were from 3M. A clone from ISA grew very well in serum-free suspension, however, the specific productivity dropped down, to become negligible, in only a few generations.

(172) 2) For optimized versions, transfected cell lines did not only produce more antibodies but also were stable for longer generations.

(173) From the observations described above, we have concluded that 3M is a superior host as compared to ISA for cell line development in producing therapeutic antibodies, immunoglobulins and other proteins, particularly proteins of therapeutic interest.

(174) The present invention is not to be limited in scope by the specific embodiments described herein. Indeed, the scope of the present invention includes embodiments specifically set forth herein and other embodiments not specifically set forth herein; the embodiments specifically set forth herein are not necessarily intended to be exhaustive. Various modifications of the invention in addition to those described herein will become apparent to those skilled in the art from the foregoing description. Such modifications are intended to fall within the scope of the claims.

(175) Patents, patent applications, publications, product descriptions, and protocols are cited throughout this application, the disclosures of which are incorporated herein by reference in their entireties for all purposes.