REPLICATION-COMPETENT VSV-HIV ENV VACCINES

20170095551 ยท 2017-04-06

    Inventors

    Cpc classification

    International classification

    Abstract

    The present relation relates to recombinant vesicular stomatitis virus for use as prophylactic and therapeutic vaccines for infectious diseases of AIDS. The present invention encompasses the preparation and purification of immunogenic compositions which are formulated into the vaccines of the present invention.

    Claims

    1. A recombinant vesicular stomatitis virus (VSV) vector wherein the gene encoding the VSV surface glycoprotein G (VSV G) is functionally replaced by functional clade A HIV Env BG505.

    2. The vector of claim 1 wherein the vector contains and expresses a nucleic acid sequence encoding an amino acid sequence of an Env.BG505 immunogen encoded by the VSVG-Env.BG505.

    3. The vector of claim 1, wherein the amino acid sequence of an Env.BG505 immunogen encoded by the VSVG-Env.BG505 is SEQ ID NO: 2.

    4. The vector of claim 1 wherein the vector comprises the sequence of a VSVG-Env.BG505 genomic clone.

    5. The vector of claim 4, wherein the sequence of a VSVG-Env.BG505 genomic clone is SEQ ID NO: 1.

    6. The vector of claim 1 wherein the HIV Env is recognized by antibodies PG9, PG16, 2G12, b12, 2F5, 4E10 or Z13, or broad potent neutralizing trimer-specific antibodies.

    7. A vaccine comprising the vector of claim 1.

    8. The vaccine of claim 7, wherein the vaccine is an intramuscular or mucosal vaccine.

    9. The vaccine of claim 7, wherein the vaccine is a G-pseudotyped VSVG-Env.BG505 vaccine.

    10. A method of producing an immune response or eliciting an immune response against HIV comprising administering to a mammal a VSV vector wherein the gene encoding the VSV G is functionally replaced by a HIV Env.

    11. The method of claim 10, wherein the HIV Env is a functional clade functional clade A, Clade B, Clade C or Clade E Env.

    12. The method of claim 10, wherein the HIV Env is recognized by a PG9, PG16, 2G12, b12, 2F5, 4E10, Z13 or a broadly neutralizing trimer-specific antibody.

    13. The method of claim 10, wherein the HIV Env is HIV Env BG505.

    14. The method of claim 10, wherein a dose is about 110.sup.4 to 210.sup.8 pfu per ml.

    15. The method of claim 10, wherein the vector is administered to a nasal and/or oral cavity.

    16. The method of claim 15, wherein a dose of 110.sup.8 pfu per ml is administered to each cavity.

    17. The method of claim 10, wherein the vector is administered over a vaccination schedule from about 0 to 29 weeks.

    18. The method of claim 15, wherein the vaccination schedule is at 0, 4 and 29 weeks.

    19. The method of claim 10, wherein the vector is administered as a single dose.

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0021] The following detailed description, given by way of example, but not intended to limit the invention solely to the specific embodiments described, may best be understood in conjunction with the accompanying drawings, in which:

    [0022] FIGS. 1A-1C. Recombinant VSVG-Env. A) A linear map of the VSV genome, which contains 5 gene regions encoding the Nucleocapsid protein (N), the Phosphoprotein (P) RNA-dependent RNA polymerase subunit, Matrix protein (M), Glycoprotein (G), and the catalytic subunit of the polymerase (Large protein or L). The 11-kb RNA genome is single-stranded, nonsegmented, and negative-sense. A single promoter at the 3 end controls mRNA synthesis. Transcription initiated at the 3 end terminates and reinitiates at each gene boundary. Because reinitiation is not 100% efficient, gene regions distal to the promoter are transcribed less efficiently generating a protein expression gradient. Changing the gene order, particularly when N is placed downstream, attenuates virus replication. A schematic of the VSV particle is show next to the genome map. B) Genome of the VSVG-Env.BG505 chimera in which the G gene is replaced with sequence encoding HIV Env.BG505. C) Map of the VSVG-Env genomic clone. The VSV (Indiana serotype) genomic sequence was derived from a lab-adapted virus. The Env.BG505 gene sequence is optimized to reflect VSV codon usage and relatively A+T-rich nucleotide content. To support rescue of recombinant virus, the T7 bacteriophage promoter is positioned to transcribe a positive-sense genome copy precursor and subsequent cleavage by cis-acting ribozymes generate precise termini.

    [0023] FIGS. 2A-2D. Summary of VSVG-Env.BG505 rescue and vaccine preparation. Steps in the process are summarized along with virus particle illustrations that show glycoprotein composition at different stages. Chimeric virus rescue is initiated by electroporating DNA (A) into Vero or VeroCD4/CCR5 cells. Virus that buds from electroporated cells then is expanded using VeroCD4/CCR5 cells before conducting 3 rounds of clonal isolation (B). Clonal isolates are characterized, and candidates are selected for seed virus amplification and storage. Conducting these steps using CD4+/CCR5+ ensures that the vector is genetically stable and is able to propagate efficiently using Env. When a pseudotyped vaccine preparation is produced (C), virus infection is performed using VeroCD4/CCR4 cells electroporated with DNA encoding G. Once the vaccine administered, replication in vivo (D) produces virus particles that lack the G glycoprotein.

    [0024] FIGS. 3A-3B. Improvement of Env spike surface expression. A) Flow cytometry conducted with transfected 293T cells expressing modified Envs. Monoclonal bnAbs used for detection are indicated at the right. Notably, antibodies PG16, PGT151, and PGT145 preferentially react with epitopes that are formed by well-ordered trimers. The linear structure of the corresponding Env-G hybrids (B) is shown below the flow cytometry data in Part A. SP, signal peptide, which is cleaved during translational processing; TM, transmembrane; CT, cytoplasmic tail; MPER, the Env membrane proximal external region; G stem; membrane proximal external region of G.

    [0025] FIGS. 4A-4C. Antigenicity of Env.BG505 trimers delivered with VSVG-Env.BG505. Chimeric virus particles containing Env.BG505 Env only (A) were used for analyses in panels C-D. In B, infected VeroCD4/CCR5 were analyzed by flow cytometry using antibodies listed on the X-axis. In C, purified virus was adsorbed to alum after which the alum-virus complexes were reacted with mAbs and analyzed by flow cytometry. The asterisks in B and C highlight antibodies that preferentially recognized well order trimmers.

    [0026] FIGS. 5A-5C. Anti-Env antibodies elicited by mucosal vaccination with a VSVG-SIV chimeric virus vaccine prototype. A) Genome map of the VSVG-SIV-GagEnv chimera, which contains the SIV Gag and Env genes. B) Three groups of animals (3 per group) were vaccinated with VSVG-SIV-GagEnv, VSVG-SIV-GagEnv prepared with a G pseudotype, or a negative control, which was live recombinant VSV. Animals were vaccinated twice (0 and 6 weeks) with 210.sup.8 pfus. Live virus in buffered solution was administered in drops applied to the nasal and oral cavities (110.sup.8 pfu per site). C) Anti-SIV Env serum antibody titers were quantified by bioplex assay. To the right side of the chart, the peak antibody titer elicited in an earlier study with a DNA-SIV Env prime (electroporation) and Ad5-SIV Env boost is indicated with a dotted line for comparison. Assay background is subtracted from the data presented in the graph.

    [0027] FIGS. 6A-6C. Genome maps comparing VSVG-Env.BG505 and an alternative vector design, VSV-G6-Env.BG505. A) The VSVG-Env.BG505 chimera genome contains 5 genes with Env.BG505 coding sequence inserted in place of G (position 4, also see FIG. 1). Gene expression declines with increasing distance from the transcriptional promoter located at the left end (yellow arrow, and see FIG. 1). The VSVG-Env.BG505 particle is illustrated with only Env incorporated on the surface, which is representative of the progeny virus particles that will be produced as the vector replicates in the vaccinee. B) In the VSV-G6-EnvBG505 vector, the G gene was reintroduced, but placed in position 6, which down-regulates G expression and enables stable coexpression of both glycoproteins. C) VSV schematic for comparison to the two vectors illustrated above.

    [0028] FIG. 7. Preclinical efficacy study design. Three groups of 10 Indian rhesus macaques were vaccinated according to the timeline at the top, which shows months and weeks. The three vaccine groups included: VSVG-Env.BG505 chimeria, VSV-G6-Env.BG505, and saline control. Vaccination and repeated rectal challenge time points are illustrated by filled triangles. Challenge was conducted with a heterologous clade B SHIV (SHIV SF162p3).

    [0029] FIG. 8. Serum antibodies elicited by vaccination. Antibody binding to Env.BG505 gp120 was quantified by ELISA over the course of the vaccination phase. HIV pseudovirus neutralization assays also were conducted (data not shown) and samples with detectable neutralization activity against clade B SF162p3 or autologous clade A BG505 pseudovirions are identified with colored arrows.

    [0030] FIG. 9. Monitoring SHIV genome copies in the blood of infected animals. SHIV genome copies in blood samples were quantified by real-time quantitative PCR (RT-qPCR). Genome copies per ml of plasma are plotted from the time infection was first detected by a qPCR signal of 200 genome copies per ml. Animal identifiers are located to the right of the graphs. Bold indicates infected animals through the 10th challenge.

    [0031] FIG. 10. SHIV infection rate during repetitive rectal challenge. As described in FIG. 7, three groups of 10 animals were vaccinated with VSVG-Env.BG505 (red line), VSV-G6-Env.BG505 (blue line), or saline (black line). About 5 months after the third vaccination at week 48, challenge commenced using 2.210.sup.4 TCID50 per rectal inoculation (TCID50: tissue culture infectious dose required to produce cytopathic effect in 50% of inoculated cell cultures). The graph shows the number of uninfected animals (Y axis) per group prior to commencing the SHIV challenge protocol. SHIV challenge 10 has been completed.

    [0032] FIG. 11. Env.BG505 binding antibody titers at time of SHIV infection in animals vaccinated with VSVG-Env.BG505. ELISA was conducted with Env.BG505 gp120 bound to the plate using samples collected from macaques at the time challenge commenced (week 48) and periodically during the challenge protocol (FIG. 7). Animals 11 and 15 were infected at SHIV challenge 1 and 2, respectively. Animal 16 was infected at challenge 8, which was 19 weeks after the challenge protocol commenced. Colored arrows point to ELISA titers for animals 11, 15, and 16.

    [0033] FIG. 12. Generation of VSVG-Env.BG505 from DNA and summary of steps to produce a seed virus for use in vaccine manufacturing.

    [0034] FIG. 13. Preparation of VSVG-Env.BG505 with G pseudotype. The schematic summarizes a procedure for preparing pseudotyped VSVG-Env.BG505.

    [0035] FIG. 14 shows that VSVG-Env.BG505 is cytolytic and that it forms real plaques after an overnight incubation.

    [0036] FIG. 15 shows that VSV is neurovirulent after an intracranial injection.

    [0037] FIG. 16 shows that pseudotyped VSVGps-Env is not neurovirulent in mice.

    [0038] FIG. 17 shows that three Env mutations were present in the protective VSVG-Env.BG505 vaccine. Adaptive mutations emerged in Env during vector rescue and propagation that increased Env-dependent replication in VeroCD4/CCR5 cells (human CD4/CCR5). The substitutions are stable and included in vaccine vector tested in macaques. The adapted virus is advanced as a genomic DNA clone containing these coding changes supports rescue of recombinant virus.

    [0039] FIGS. 18A-18B show dependence of VSVG-EnvG.BG505 infection on CD4 and CCR5. The virus used in this experiment contained three adaptive amino: K169T, 1307T, and W672R. (A) VERO or VERO-CD4/CCR5 cell lines were infected with 1 plaque-forming unit per ml (PFU/ml) VSVG-Env.BG505 or a mock control. Cytopathic effect caused by VSVDG-Env.BG505 infection is evident only VERO-CD4/CCR5 cells. (B) HOS cells expressing CD4, CCR5 or both were infected with 0.1 PFU/ml of VSVDG-Env.BG505 or a mock control. Cytopathic effect produced by infection is only evident on cells expressing both CD4 and CCR5.

    [0040] FIG. 19 shows a maximal tolerated dose study to test the safety of the VSVG-Env.BG505 using a mouse neurovirulence model. VSVG-Env.BG505 New Jersey G-pseudotype, VSVG-Env.BG505 Indiana G-pseudotype and VSVG-Env.BG505 were tested along with VSV-G5 and VSV-G4 vectors and negative control mice. No adverse events have been observed following intracranial inoculation with VSVG vectors. No weight lose in animals over the 14 days apart from a small decrease at day 1. There was 100% survival in 104, 105 and 106 pfu groups. No paralysis, limb weakness or loss of coordination was observed in any of the groups.

    [0041] FIGS. 20A-20C show that PGT145 binds to sucrose purified VSVG-Env.BG505 and generates a standard curve of binding rate vs concentration (PFU). FIG. 20A shows binding of of PGT145 to sucrose purified VSVG-Env.BG505 chimera (2-fold serially diluted). FIG. 20B shows an association phase only. FIG. 20C shows a chimera virus standard curve: binding rate vs. concentration (pfu). The virus binding association data can be used to generate a standard curve of binding rate vs concentration and determine K.sub.D.

    [0042] FIGS. 21A-21C show that PGT145 binds to sucrose and TFF purified VSVG-Env.BG505 batch to batch differences. FIG. 21A shows binding of PGT145 to sucrose and TFF purified VSVG-Env.BG505 chimera (2-fold serially diluted). FIG. 21B shows sucrose purified virus-association phase only. FIG. 21C shows TFF purified virus-association phase only. From the binding rates of the virus, use standard curve of protein to determine Env concentration. Data analyzed at the 2G12 binding step show better binding rates and therefore enhanced response signals with the sucrose purified sample. Batch to batch differences are determined.

    [0043] FIG. 22 depicts an octet application to monitor epitope mapping of sera from NHPs in the RM1401 and their binding profiles to HIV-Env subfragments. FIG. 22 discloses GGGGS as SEQ ID NO: 6 and 8His as SEQ ID NO: 7.

    [0044] FIGS. 23A-23D show epitope mapping of sera from RM1401 indicate binding to HIV-Env subfragments. The biosensors are anti-HIS1K, the capture is different HIV-Env subfragments, the analyte molecule is sera 13 diluted 1:20 (from an NHP in the RM1401 study that showed protection after challenge with SHIV162p3) and the buffer is PBS/0.1% tween 20. FIG. 23A shows the baseline, loading of the HIV-Env subfragments and sera association, FIG. 23B shows loading samples PBS and C5V %, FIG. 23C shows loading samples BG505 and C4V4 and FIG. 23D shows loading samples GP41 and C3V3. The figures show that sera binds to all subfragments except C4V4.

    [0045] FIG. 24 depicts an evaluation of CD4 gene copy number in a VERT3 preclinical cell line. VERT3 cells were thawed, 3 passages were produced (P1, P2 and P3), gDNA was purified and RNase treated, DNA concentrations were determined by UV spectrophotometry (Nanodrop) and diluted to a stock concentration of 100 ng/ml, genetic integrity was determined by PCR/gel electrophoresis and stability was monitored by qPCR. Stability of CD4 and CCR5 genes in the VERT3 cell line is determined. Passage to passage consistency of the VERT3 cells is monitored. Three SYBR green qPCR assays (CD4, CCR5 and a reference gene -glucuronidase) are designed. Absolute quantification is by a standard curve method. The stability of CD4 and CD4 copy number/cell is determined by the copy ration of CD4 to -glucuronidase and likewise CCR5 stability.

    [0046] FIGS. 25A-25E. VSV-HIV vectors. (A) The VSV genome map is colored to correspond with proteins in the virus particle illustration. The 11-kb single-stranded, negative-sense, nonsegmented RNA genome encodes 5 proteins: (N) Nucleocapsid; Phosphoprotein (P); Large (L) RNA-dependent RNA polymerase subunit; (M) Matrix protein; (G) Glycoprotein. A single 3 promoter controls mRNA synthesis, with promoter-proximal genes being transcribed more frequently. The G gene was replaced with Env.BG505 sequence in VSVG-Env.BG505 (B) and VSV-G6-Env.BG505 (C), with G being reintroduced at the 5 terminus (position 6) of the VSV-G6-Env.BG505 genome. Env.BG505 encoded by both vectors was modified (FIG. 30A) to increase incorporation into the virus particle. (D) The surface of infected VERO or VERO-CD4/CCR5 cells was analyzed by flow cytometry using monoclonal antibodies specific for: high-manose glycans (2G12); a V3 epitope composed of polypeptide and glycan (PGT121); the CD4 binding site in native spikes (VRC01 and VRC06b) or in less compact Env species (F105 and IgGb6); and, native structures formed at the interface of spike subunits (PGT145 and PGT151). (E) Purified virus particles also were analyzed with the same antibodies using alum as a carrier for flow cytometry.

    [0047] FIGS. 26A-B. Preclinical efficacy study. (A) Macaques were vaccinated three times by applying VSVG-EnvG505, VSV-G6-Env.BG505, or buffered solution to both intranasal (110.sup.8 pfus) and intraoral mucosal surfaces (110.sup.8 pfus). Intrarectal challenge with SHIV began 5 months after the final vaccination (study week 48). The SHIV SF 162p3 challenge stock was prepared in macaque PBMCs and has been used in prior studies. Consensus nucleotide sequencing conducted with the challenge virus verified that the Env gene matched Genbank Accession KF042063. Macaques with SHIV genome copies 200 per ml on two successive blood draws were considered positive (FIG. 33) and further challenge was ended. (B) Kaplan-Meier survival curves by treatment assignment. P-values are from an exact log-rank test comparing each active treatment group to the control group.

    [0048] FIG. 27. Env serum antibody analysis. Longitudinal gp120 ELISA endpoint titers showing uninfected (dashed lines) or infected (solid lines) macaques and geometric mean values for the vaccine groups (bold solid lines). Unprotected animals 11, 15 and 16 from the VSVG-Env.BG505 group are identified in A and B to highlight their low titers.

    [0049] FIGS. 28A-28D. Serum antibody analysis by Western blot. Western blot membranes were prepared using purified VSVG-Env.BG505 as a source of Env.BG505 and VSV polypeptides. The membranes were placed in multichannel devices to allow analysis of sera from individual animals. (A) Analysis of week-43 sera from all vaccinated animals and two controls. Labeled above the blot are the vaccine groups, animal numbers (NHP, nonhuman primate), and the SHIV challenge when infection occurred. Underlined NHP numbers indicate an animal that became infected during SHIV challenge. Polypeptide identities are labeled at the left side. Bands corresponding to Env gp41 were not clearly evident until after SHIV infection (FIG. 37). (B) Sera were analyzed from week 48. An independent full-length blot is included in FIG. 37A with all control animal sera. (C) Sera was analyzed from week 62 when 5 of 10 challenges were complete. Asterisks indicate animals infected after 5 challenges. Infected Control animal 31 did not produce an Env signal probably because it had a more severe progressive infection (FIG. 33) that interfered with humoral responses against Env and Gag (FIG. 34). (D) Analysis of sera from week 79, which was 1 year after the final vaccination.

    [0050] FIGS. 29A-29B. Mapping Env antibody binding regions. (A) Linear map of Env Constant (C1-05) and Variable (V1-V5) domains. The map breaks at furin cleavage site between gp120 and gp41. The transmembrane (TM) region and cytoplasmic tail (CT) are labeled in gp41. Below the map, boundaries are shown for the Env fragments fused to human serum albumin (HSA) to generate ELISA substrates. (B) Analysis of sera using capture ELISA and the HSA fusion proteins shown in (A). HSA without a fused Env sequence was included as a negative control. Env gp120 and gp140 ELISA substrates were not fused to HSA. The data from an example experiment (absorbance at 450 nm; A450) is presented as a heat map with the scale shown at the bottom adjacent to a scale showing the SHIV challenge when infection occurred.

    [0051] FIGS. 30A-30F. VSV-HIV vaccine design details. (A) Both vectors express HIV Env.BG505, which was modified to increase incorporation into the VSV particle by replacing the signal sequence, transmembrane region (TM) and cytoplasmic tail (CT) with sequence from G (serotype Indiana; IND). (B) VSVG-Env.BG505 particles used for vaccination were pseudotyped with G. Vaccinating with pseudotyped VSVG-Env.BG505 launches a more robust infection, because G binds ubiquitous cellular receptors allowing the initial round of infection to be independent of Env and the limited population of CD4+/CCR5+ cells. Pseudotyped virus was prepared by conducting the final amplification of vaccine material in VERO-CD4/CCR5 cells expressing G. (D-F) These schematics summarize how early stages of VSV vector infection progresses in macaques with pseudotyped VSVG-Env.BG505 (B) and VSV-G6-Env.BG505 (C). Both can use G to initiate primary infection (D), but subsequent cycles of VSVG-Env.BG505 infection and replication are Env-dependent while VSV-G6-Env.BG505 are G dependent. Additional information on the use of G in the vaccines is provided in FIG. 31.

    [0052] FIGS. 31A-31C. VSV G serotype exchange. Because 3 vaccinations were planned and anti-G antibodies were known to develop when using VSV vectors that express G like VSV-G6-Env (FIG. 25C), Applicants used a G serotype exchange strategy to minimize potential effects of anti-G immunity (A) Timeline of vaccination and SHIV challenge shows how the vaccine G composition was varied. (B) For VSVG-Env.BG505, G was exchanged simply by pseudotyping with G from serotype New Jersey (NJ) or G IND. Only two different G pseudotypes were used for the three sequential vaccinations (A), because interim ELISA data showed that transient mucosal exposure to G in the pseudotyped VSVG-Env.BG505 particle did not elicit substantial amounts of anti-G antibodies (data not shown). (C) For sequential vaccination with VSV-G6-Env.BG505 (B), three vectors were used that differed in their G genes. The G genes came from different vesiculoviruses including VSV serotypes NJ or IND, or Maraba virus.

    [0053] FIG. 32. VSV-HIV shedding in the oral cavity. Samples were collected at 3 days after each of the three vaccinations (FIG. 27A) by swabbing the oral cavity. Samples also were collected 7 days after the first vaccination. Material collected on the swabs was purified using procedures described in the Methods for detecting SHIV genomes in plasma after which qPCR was performed with an amplicon specific for the N gene. The lower limit of measurement was 50 genome copies per reaction. Low quantities of VSVG-EnvG.BG505 genomes were detected at 3 days following the first vaccination in 4 animals and in 3 macaques after the third vaccination. VSV-G6-Env.BG505 genomes were detected in swabs from 8 animals in greater quantities after the first vaccination and in 4 macaques following the third vaccination. These results indicated that VSVG-Env.BG505 shedding into the oral cavity was minimal to undetectable, while the quantity of VSV-G6-Env.BG505 genomes indicated that some virus shedding occurred although it remains to be determined whether live virus was present.

    [0054] FIG. 33. SHIV infection and virus loads. Blood was collected at one and two weeks following each challenge to assess virus loads as described in the Methods. The plots show SHIV genome copies per ml of plasma as measured by RT-qPCR using a SIV Gag-specific amplicon. Animals with 200 copies on two successive blood draws were considered positive after which challenge was stopped. Animal numbers are shown to the right of the plots, and those positive for the Mamu-A*01 or Mamu-A*02 MHC alleles are indicated. Each group had two animals that were positive for Mamu-A*01 and two positive Mamu-A*02, which have been associated with control of disease progression. No macaques were included in the study with Mamu-B*17 or Mamu-B*08 alleles associated with strong replication control. Two animals in the Control group (indicated with X) experienced rapid disease progression and were euthanized before the end of the study.

    [0055] FIGS. 34A-34C. Analysis of anti-Gag response to SHIV infection by Western blotting. (A) SHIV challenge timeline and labeling key for the blots below. (B-C) Gag-specific serum antibodies were detected by reactivity with recombinant SIV Gag (SIVmac239, p55 Gag; Protein Sciences Corp.) on Western blot membranes. Week-62 serum (B) was collected after completing the first 5 challenges and week-79 serum (C) was collected two months after the 10th challenge. Animal numbers are indicated above each lane, and in (B), an asterisk indicates that macaques were infected by the fifth challenge. Two infected animals in the control group (31 and 40) did not have strong anti-Gag or anti-Env (FIG. 37C) antibody responses, which was due to rapid disease progression (FIG. 33) inhibiting development of antibodies.

    [0056] FIGS. 35A-35B. More detailed presentation of the SHIV infection timeline. (A) The Table supplements the survival curve shown in FIG. 26B and the antibody analysis in 3B by provides the timing of SHIV infection for each animal. (B) Boxplots showing ELISA titers during vaccination and challenge phases. The boxplots highlight the low titers in animals 11, 15, and 16 in the VSVG-Env.BG505 group prior to SHIV infection. Boxes show median and quartiles with whiskers extending at most 1.5 times the interquartile range.

    [0057] FIG. 36. CD4 and CD8 T cell frequencies in peripheral blood. PBMCs harvested two weeks after the third vaccination (week 31) were stimulated with peptides representing Env.BG505 gp120, gp41, or VSV N after which intracellular cytokine staining and flow cytometry was conducted to quantify CD4 and CD8 T cells. Overall, the Env-specific T cell frequencies in peripheral blood were low (measurable limit set at 0.05%). In the VSV-G6-Env.BG505 group 5 of 10 animals were positive for gp120-specific CD4 T cells secreting IFN. VSV N-specific CD8 T cells also were detected secreting IFN in 9 of 10 macaques and TNF in 4 or 10 animals. Notably, the frequency of T cells in peripheral blood specific for Env or N were below measurable limits in the group vaccinated with VSVG-Env.BG505.

    [0058] FIGS. 37A-37C. Additional characterization of serum antibodies by Western blot. Assays were performed as in FIG. 28. (A) An independent week-48 Western blot, like the one in FIG. 28B, is shown with all control animals included. The full-length blot also shows reactivity with VSV polypeptides as described in FIG. 28A. Sera from control animals lacked significant VSV and Env signals as expected, except for occasional detection of bands that migrated at positions consistent with VSV M and P. (B) A Western blot performed with sera collected at study week 16, which was 12 weeks after the second vaccination. The result showed that the Env signal was detectable at this earlier time even though the ELISA titers were considerably lower in the VSVG-Env.BG505 group after the second vaccination (FIG. 27A). (C) An independent week-79 Western blot similar to the one in FIG. 28D. The full length blot shows that serum from infected macaques was able to detect gp41. Most control macaques also developed antibodies that bound gp41 except for two animals that had had progressive infections (macaques 31 and 40; FIG. 33) and uninfected animal 32. Animal 31 was euthanized prior to this time point.

    [0059] FIG. 38. Cross clade Env binding detected with Western blot. A Western blot assay was performed using three different VSVG-Env.BG505 chimeras as the source of proteins on the blot. These included clade A.BG505 (different blot than in FIG. 4B), B.SF162.p3, and C.CHSO5 (week 100). The assay was performed as described in FIG. 28 using sera from the VSVG-Env.BG505 group (week 48). Animal numbers are at the top of the blot. Underlined animals were not protected during SHIV challenge.

    [0060] FIG. 39. Analysis of serum antibody binding to different Env regions by Western blotting. Sera from week 48 was analyzed as described in FIG. 28 except that recombinant gp120, gp140, and HSA fusion proteins (FIG. 29A) were used as substrates. The positive control lane (+) included anti-HIS antibody.

    DETAILED DESCRIPTION

    [0061] The terms protein, peptide, polypeptide, and amino acid sequence are used interchangeably herein to refer to polymers of amino acid residues of any length. The polymer may be linear or branched, it may comprise modified amino acids or amino acid analogs, and it may be interrupted by chemical moieties other than amino acids. The terms also encompass an amino acid polymer that has been modified naturally or by intervention; for example disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation or modification, such as conjugation with a labeling or bioactive component.

    [0062] As used herein, the terms antigen or immunogen are used interchangeably to refer to a substance, typically a protein, which is capable of inducing an immune response in a subject. The term also refers to proteins that are immunologically active in the sense that once administered to a subject (either directly or by administering to the subject a nucleotide sequence or vector that encodes the protein) is able to evoke an immune response of the humoral and/or cellular type directed against that protein.

    [0063] The term antibody includes intact molecules as well as fragments thereof, such as Fab, F(ab).sub.2, Fv and scFv which are capable of binding the epitope determinant. These antibody fragments retain some ability to selectively bind with its antigen or receptor and include, for example: [0064] (i) Fab, the fragment which contains a monovalent antigen-binding fragment of an antibody molecule can be produced by digestion of whole antibody with the enzyme papain to yield an intact light chain and a portion of one heavy chain; [0065] (ii) Fab, the fragment of an antibody molecule can be obtained by treating whole antibody with pepsin, followed by reduction, to yield an intact light chain and a portion of the 20 heavy chain; two Fab fragments are obtained per antibody molecule; [0066] (iii) F(ab).sub.2, the fragment of the antibody that can be obtained by treating whole antibody with the enzyme pepsin without subsequent reduction; F(ab).sub.2 is a dimer of two Fab fragments held together by two disulfide bonds; [0067] (iv) scFv, including a genetically engineered fragment containing the variable region of a heavy and a light chain as a fused single chain molecule.

    [0068] General methods of making these fragments are known in the art. (See for example, Harlow and Lane, Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory, New York (1988), which is incorporated herein by reference).

    [0069] It should be understood that the proteins, including the proteins of the invention may differ from the exact sequences illustrated and described herein. Thus, the invention contemplates deletions, additions and substitutions to the sequences shown, so long as the sequences function in accordance with the methods of the invention. In this regard, particularly preferred substitutions will generally be conservative in nature, i.e., those substitutions that take place within a family of amino acids. For example, amino acids are generally divided into four families: (1) acidicaspartate and glutamate; (2) basiclysine, arginine, histidine; (3) non-polaralanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan; and (4) uncharged polarglycine, asparagine, glutamine, cysteine, serine threonine, tyrosine. Phenylalanine, tryptophan, and tyrosine are sometimes classified as aromatic amino acids. It is reasonably predictable that an isolated replacement of leucine with isoleucine or valine, or vice versa; an aspartate with a glutamate or vice versa; a threonine with a serine or vice versa; or a similar conservative replacement of an amino acid with a structurally related amino acid, will not have a major effect on the biological activity. Proteins having substantially the same amino acid sequence as the sequences illustrated and described but possessing minor amino acid substitutions that do not substantially affect the immunogenicity of the protein are, therefore, within the scope of the invention.

    [0070] As used herein the terms nucleotide sequences and nucleic acid sequences refer to deoxyribonucleic acid (DNA) or ribonucleic acid (RNA) sequences, including, without limitation, messenger RNA (mRNA), DNA/RNA hybrids, or synthetic nucleic acids. The nucleic acid can be single-stranded, or partially or completely double-stranded (duplex). Duplex nucleic acids can be homoduplex or heteroduplex.

    [0071] As used herein the term transgene may be used to refer to recombinant nucleotide sequences that may be derived from any of the nucleotide sequences encoding the proteins of the present invention. The term recombinant means a nucleotide sequence that has been manipulated by man and which does not occur in nature, or is linked to another nucleotide sequence or found in a different arrangement in nature. It is understood that manipulated by man means manipulated by some artificial means, including by use of machines, codon optimization, restriction enzymes, etc.

    [0072] For example, in one embodiment the nucleotide sequences may be mutated such that the activity of the encoded proteins in vivo is abrogated. For example, each of the Gag, Pol, Env, Nef, RT, and Int sequences of the invention may be altered in these ways.

    [0073] As regards codon optimization, the nucleic acid molecules of the invention have a nucleotide sequence that encodes the antigens of the invention and can be designed to employ codons that are used in the genes of the subject in which the antigen is to be produced. Many viruses, including HIV and other lentiviruses, use a large number of rare codons and, by altering these codons to correspond to codons commonly used in the desired subject, enhanced expression of the antigens can be achieved. In a preferred embodiment, the codons used are humanized codons, i.e., the codons are those that appear frequently in highly expressed human genes (Andre et al., J. Virol. 72:1497-1503, 1998) instead of those codons that are frequently used by HIV. Such codon usage provides for efficient expression of the transgenic HIV proteins in human cells. Any suitable method of codon optimization may be used. Such methods, and the selection of such methods, are well known to those of skill in the art. In addition, there are several companies that will optimize codons of sequences, such as Geneart (geneart.com). Thus, the nucleotide sequences of the invention can readily be codon optimized.

    [0074] Advantageously, Applicants codon optimize the Env gene so it has the codon bias that is characteristic of VSV. This also results in a relatively low Guanine+Cytosine content of about 40-45%. See, e.g., Rabinovich et al., PLoS One. 2014 Sep. 12; 9(9):e106597. doi: 10.1371/journal.pone.0106597. eCollection 2014.

    [0075] The invention further encompasses nucleotide sequences encoding functionally and/or antigenically equivalent variants and derivatives of the antigens of the invention and functionally equivalent fragments thereof. These functionally equivalent variants, derivatives, and fragments display the ability to retain antigenic activity. For instance, changes in a DNA sequence that do not change the encoded amino acid sequence, as well as those that result in conservative substitutions of amino acid residues, one or a few amino acid deletions or additions, and substitution of amino acid residues by amino acid analogs are those which will not significantly affect properties of the encoded polypeptide. Conservative amino acid substitutions are glycine/alanine; valine/isoleucine/leucine; asparagine/glutamine; aspartic acid/glutamic acid; serine/threonine/methionine; lysine/arginine; and phenylalanine/tyrosine/tryptophan. In one embodiment, the variants have at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% homology or identity to the antigen, epitope, immunogen, peptide or polypeptide of interest.

    [0076] For the purposes of the present invention, sequence identity or homology is determined by comparing the sequences when aligned so as to maximize overlap and identity while minimizing sequence gaps. In particular, sequence identity may be determined using any of a number of mathematical algorithms. A nonlimiting example of a mathematical algorithm used for comparison of two sequences is the algorithm of Karlin & Altschul, Proc. Natl. Acad. Sci. USA 1990; 87: 2264-2268, modified as in Karlin & Altschul, Proc. Natl. Acad. Sci. USA 1993; 90: 5873-5877.

    [0077] Another example of a mathematical algorithm used for comparison of sequences is the algorithm of Myers & Miller, CABIOS 1988; 4: 11-17. Such an algorithm is incorporated into the ALIGN program (version 2.0) which is part of the GCG sequence alignment software package. When utilizing the ALIGN program for comparing amino acid sequences, a PAM120 weight residue table, a gap length penalty of 12, and a gap penalty of 4 can be used. Yet another useful algorithm for identifying regions of local sequence similarity and alignment is the FASTA algorithm as described in Pearson & Lipman, Proc. Natl. Acad. Sci. USA 1988; 85: 2444-2448.

    [0078] Advantageous for use according to the present invention is the WU-BLAST (Washington University BLAST) version 2.0 software. WU-BLAST version 2.0 executable programs for several UNIX platforms can be downloaded from ftp://blast.wustl.edu/blast/executables. This program is based on WU-BLAST version 1.4, which in turn is based on the public domain NCBI-BLAST version 1.4 (Altschul & Gish, 1996, Local alignment statistics, Doolittle ed., Methods in Enzymology 266: 460-480; Altschul et al., Journal of Molecular Biology 1990; 215: 403-410; Gish & States, 1993; Nature Genetics 3: 266-272; Karlin & Altschul, 1993; Proc. Natl. Acad. Sci. USA 90: 5873-5877; all of which are incorporated by reference herein).

    [0079] The various recombinant nucleotide sequences and proteins of the invention are made using standard recombinant DNA and cloning techniques. Such techniques are well known to those of skill in the art. See for example, Molecular Cloning: A Laboratory Manual, second edition (Sambrook et al. 1989).

    [0080] The nucleotide sequences of the present invention may be inserted into vectors. The term vector is widely used and understood by those of skill in the art, and as used herein the term vector is used consistent with its meaning to those of skill in the art. For example, the term vector is commonly used by those skilled in the art to refer to a vehicle that allows or facilitates the transfer of nucleic acid molecules from one environment to another or that allows or facilitates the manipulation of a nucleic acid molecule.

    [0081] Any vector that allows expression of the proteins of the present invention may be used in accordance with the present invention. In certain embodiments, the antigens and/or antibodies of the present invention may be used in vitro (such as using cell-free expression systems) and/or in cultured cells grown in vitro in order to produce the encoded HIV-antigens and/or antibodies which may then be used for various applications such as in the production of proteinaceous vaccines. For such applications, any vector that allows expression of the antigens and/or antibodies in vitro and/or in cultured cells may be used.

    [0082] For applications where it is desired that the proteins be expressed in vivo, for example when the transgenes of the invention are used in DNA or DNA-containing vaccines, any vector that allows for the expression of the proteins of the present invention and is safe for use in vivo may be used. In preferred embodiments the vectors used are safe for use in humans, mammals and/or laboratory animals.

    [0083] For the proteins of the present invention to be expressed, the protein coding sequence should be operably linked to regulatory or nucleic acid control sequences that direct transcription and translation of the protein. As used herein, a coding sequence and a nucleic acid control sequence or promoter are said to be operably linked when they are covalently linked in such a way as to place the expression or transcription and/or translation of the coding sequence under the influence or control of the nucleic acid control sequence. The nucleic acid control sequence can be any nucleic acid element, such as, but not limited to promoters, enhancers, IRES, introns, and other elements described herein that direct the expression of a nucleic acid sequence or coding sequence that is operably linked thereto. The term promoter will be used herein to refer to a group of transcriptional control modules that are clustered around the initiation site for RNA polymerase II and that when operationally linked to the protein coding sequences of the invention lead to the expression of the encoded protein. The expression of the transgenes of the present invention can be under the control of a constitutive promoter or of an inducible promoter, which initiates transcription only when exposed to some particular external stimulus, such as, without limitation, antibiotics such as tetracycline, hormones such as ecdysone, or heavy metals. The promoter can also be specific to a particular cell-type, tissue or organ. Many suitable promoters and enhancers are known in the art, and any such suitable promoter or enhancer may be used for expression of the transgenes of the invention. For example, suitable promoters and/or enhancers can be selected from the Eukaryotic Promoter Database (EPDB).

    [0084] The present invention relates to a recombinant vesicular stomatitis virus (VSV) vector expressing a foreign epitope. Advantageously, the epitope is an HIV epitope. Any HIV epitope may be expressed in a VSV vector. Advantageously, the HIV epitope is an HIV antigen, HIV epitope or an HIV immunogen, such as, but not limited to, the HIV antigens, HIV epitopes or HIV immunogens of U.S. Pat. Nos. 7,341,731; 7,335,364; 7,329,807; 7,323,553; 7,320,859; 7,311,920; 7,306,798; 7,285,646; 7,285,289; 7,285,271; 7,282,364; 7,273,695; 7,270,997; 7,262,270; 7,244,819; 7,244,575; 7,232,567; 7,232,566; 7,223,844; 7,223,739; 7,223,534; 7,223,368; 7,220,554; 7,214,530; 7,211,659; 7,211,432; 7,205,159; 7,198,934; 7,195,768; 7,192,555; 7,189,826; 7,189,522; 7,186,507; 7,179,645; 7,175,843; 7,172,761; 7,169,550; 7,157,083; 7,153,509; 7,147,862; 7,141,550; 7,129,219; 7,122,188; 7,118,859; 7,118,855; 7,118,751; 7,118,742; 7,105,655; 7,101,552; 7,097,971 7,097,842; 7,094,405; 7,091,049; 7,090,648; 7,087,377; 7,083,787; 7,070,787; 7,070,781; 7,060,273; 7,056,521; 7,056,519; 7,049,136; 7,048,929; 7,033,593; 7,030,094; 7,022,326; 7,009,037; 7,008,622; 7,001,759; 6,997,863; 6,995,008; 6,979,535; 6,974,574; 6,972,126; 6,969,609; 6,964,769; 6,964,762; 6,958,158; 6,956,059; 6,953,689; 6,951,648; 6,946,075; 6,927,031; 6,919,319; 6,919,318; 6,919,077; 6,913,752; 6,911,315; 6,908,617; 6,908,612; 6,902,743; 6,900,010; 6,893,869; 6,884,785; 6,884,435; 6,875,435; 6,867,005; 6,861,234; 6,855,539; 6,841,381 6,841,345; 6,838,477; 6,821,955; 6,818,392; 6,818,222; 6,815,217; 6,815,201; 6,812,026; 6,812,025; 6,812,024; 6,808,923; 6,806,055; 6,803,231; 6,800,613; 6,800,288; 6,797,811; 6,780,967; 6,780,598; 6,773,920; 6,764,682; 6,761,893; 6,753,015; 6,750,005; 6,737,239; 6,737,067; 6,730,304; 6,720,310; 6,716,823; 6,713,301; 6,713,070; 6,706,859; 6,699,722; 6,699,656; 6,696,291; 6,692,745; 6,670,181; 6,670,115; 6,664,406; 6,657,055; 6,657,050; 6,656,471; 6,653,066; 6,649,409; 6,649,372; 6,645,732; 6,641,816; 6,635,469; 6,613,530; 6,605,427; 6,602,709 6,602,705; 6,600,023; 6,596,477; 6,596,172; 6,593,103; 6,593,079; 6,579,673; 6,576,758; 6,573,245; 6,573,040; 6,569,418; 6,569,340; 6,562,800; 6,558,961; 6,551,828; 6,551,824; 6,548,275; 6,544,780; 6,544,752; 6,544,728; 6,534,482; 6,534,312; 6,534,064; 6,531,572; 6,531,313; 6,525,179; 6,525,028; 6,524,582; 6,521,449; 6,518,030; 6,518,015; 6,514,691; 6,514,503; 6,511,845; 6,511,812; 6,511,801; 6,509,313; 6,506,384; 6,503,882; 6,495,676; 6,495,526; 6,495,347; 6,492,123; 6,489,131; 6,489,129; 6,482,614; 6,479,286; 6,479,284; 6,465,634; 6,461,615 6,458,560; 6,458,527; 6,458,370; 6,451,601; 6,451,592; 6,451,323; 6,436,407; 6,432,633; 6,428,970; 6,428,952; 6,428,790; 6,420,139; 6,416,997; 6,410,318; 6,410,028; 6,410,014; 6,407,221; 6,406,710; 6,403,092; 6,399,295; 6,392,013; 6,391,657; 6,384,198; 6,380,170; 6,376,170; 6,372,426; 6,365,187; 6,358,739; 6,355,248; 6,355,247; 6,348,450; 6,342,372; 6,342,228; 6,338,952; 6,337,179; 6,335,183; 6,335,017; 6,331,404; 6,329,202; 6,329,173; 6,328,976; 6,322,964; 6,319,666; 6,319,665; 6,319,500; 6,319,494; 6,316,205; 6,316,003; 6,309,633; 6,306,625 6,296,807; 6,294,322; 6,291,239; 6,291,157; 6,287,568; 6,284,456; 6,284,194; 6,274,337; 6,270,956; 6,270,769; 6,268,484; 6,265,562; 6,265,149; 6,262,029; 6,261,762; 6,261,571; 6,261,569; 6,258,599; 6,258,358; 6,248,332; 6,245,331; 6,242,461; 6,241,986; 6,235,526; 6,235,466; 6,232,120; 6,228,361; 6,221,579; 6,214,862; 6,214,804; 6,210,963; 6,210,873; 6,207,185; 6,203,974; 6,197,755; 6,197,531; 6,197,496; 6,194,142; 6,190,871; 6,190,666; 6,168,923; 6,156,302; 6,153,408; 6,153,393; 6,153,392; 6,153,378; 6,153,377; 6,146,635; 6,146,614; 6,143,876 6,140,059; 6,140,043; 6,139,746; 6,132,992; 6,124,306; 6,124,132; 6,121,006; 6,120,990; 6,114,507; 6,114,143; 6,110,466; 6,107,020; 6,103,521; 6,100,234; 6,099,848; 6,099,847; 6,096,291; 6,093,405; 6,090,392; 6,087,476; 6,083,903; 6,080,846; 6,080,725; 6,074,650; 6,074,646; 6,070,126; 6,063,905; 6,063,564; 6,060,256; 6,060,064; 6,048,530; 6,045,788; 6,043,347; 6,043,248; 6,042,831; 6,037,165; 6,033,672; 6,030,772; 6,030,770; 6,030,618; 6,025,141; 6,025,125; 6,020,468; 6,019,979; 6,017,543; 6,017,537; 6,015,694; 6,015,661; 6,013,484; 6,013,432 6,007,838; 6,004,811; 6,004,807; 6,004,763; 5,998,132; 5,993,819; 5,989,806; 5,985,926; 5,985,641; 5,985,545; 5,981,537; 5,981,505; 5,981,170; 5,976,551; 5,972,339; 5,965,371; 5,962,428; 5,962,318; 5,961,979; 5,961,970; 5,958,765; 5,958,422; 5,955,647; 5,955,342; 5,951,986; 5,951,975; 5,942,237; 5,939,277; 5,939,074; 5,935,580; 5,928,930; 5,928,913; 5,928,644; 5,928,642; 5,925,513; 5,922,550; 5,922,325; 5,919,458; 5,916,806; 5,916,563; 5,914,395; 5,914,109; 5,912,338; 5,912,176; 5,912,170; 5,906,936; 5,895,650; 5,891,623; 5,888,726; 5,885,580 5,885,578; 5,879,685; 5,876,731; 5,876,716; 5,874,226; 5,872,012; 5,871,747; 5,869,058; 5,866,694; 5,866,341; 5,866,320; 5,866,319; 5,866,137; 5,861,290; 5,858,740; 5,858,647; 5,858,646; 5,858,369; 5,858,368; 5,858,366; 5,856,185; 5,854,400; 5,853,736; 5,853,725; 5,853,724; 5,852,186; 5,851,829; 5,851,529; 5,849,475; 5,849,288; 5,843,728; 5,843,723; 5,843,640; 5,843,635; 5,840,480; 5,837,510; 5,837,250; 5,837,242; 5,834,599; 5,834,441; 5,834,429; 5,834,256; 5,830,876; 5,830,641; 5,830,475; 5,830,458; 5,830,457; 5,827,749; 5,827,723; 5,824,497 5,824,304; 5,821,047; 5,817,767; 5,817,754; 5,817,637; 5,817,470; 5,817,318; 5,814,482; 5,807,707; 5,804,604; 5,804,371; 5,800,822; 5,795,955; 5,795,743; 5,795,572; 5,789,388; 5,780,279; 5,780,038; 5,776,703; 5,773,260; 5,770,572; 5,766,844; 5,766,842; 5,766,625; 5,763,574; 5,763,190; 5,762,965; 5,759,769; 5,756,666; 5,753,258; 5,750,373; 5,747,641; 5,747,526; 5,747,028; 5,736,320; 5,736,146; 5,733,760; 5,731,189; 5,728,385; 5,721,095; 5,716,826; 5,716,637; 5,716,613; 5,714,374; 5,709,879; 5,709,860; 5,709,843; 5,705,331; 5,703,057; 5,702,707 5,698,178; 5,688,914; 5,686,078; 5,681,831; 5,679,784; 5,674,984; 5,672,472; 5,667,964; 5,667,783; 5,665,536; 5,665,355; 5,660,990; 5,658,745; 5,658,569; 5,643,756; 5,641,624; 5,639,854; 5,639,598; 5,637,677; 5,637,455; 5,633,234; 5,629,153; 5,627,025; 5,622,705; 5,614,413; 5,610,035; 5,607,831; 5,606,026; 5,601,819; 5,597,688; 5,593,972; 5,591,829; 5,591,823; 5,589,466; 5,587,285; 5,585,254; 5,585,250; 5,580,773; 5,580,739; 5,580,563; 5,573,916; 5,571,667; 5,569,468; 5,558,865; 5,556,745; 5,550,052; 5,543,328; 5,541,100; 5,541,057; 5,534,406 5,529,765; 5,523,232; 5,516,895; 5,514,541; 5,510,264; 5,500,161; 5,480,967; 5,480,966; 5,470,701; 5,468,606; 5,462,852; 5,459,127; 5,449,601; 5,447,838; 5,447,837; 5,439,809; 5,439,792; 5,418,136; 5,399,501; 5,397,695; 5,391,479; 5,384,240; 5,374,519; 5,374,518; 5,374,516; 5,364,933; 5,359,046; 5,356,772; 5,354,654; 5,344,755; 5,335,673; 5,332,567; 5,320,940; 5,317,009; 5,312,902; 5,304,466; 5,296,347; 5,286,852, 5,268,265; 5,264,356; 5,264,342; 5,260,308; 5,256,767; 5,256,561; 5,252,556; 5,230,998; 5,230,887; 5,227,159; 5,225,347; 5,221,610, 5,217,861; 5,208,321; 5,206,136; 5,198,346; 5,185,147; 5,178,865; 5,173,400; 5,173,399; 5,166,050; 5,156,951, 5,135,864; 5,122,446; 5,120,662; 5,103,836; 5,100,777; 5,100,662; 5,093,230; 5,077,284; 5,070,010; 5,068,174; 5,066,782; 5,055,391; 5,043,262; 5,039,604; 5,039,522; 5,030,718; 5,030,555; 5,030,449; 5,019,387; 5,013,556; 5,008,183; 5,004,697; 4,997,772; 4,983,529; 4,983,387; 4,965,069; 4,945,082; 4,921,787; 4,918,166; 4,900,548; 4,888,290; 4,886,742; 4,885,235; 4,870,003; 4,869,903; 4,861,707; 4,853,326; 4,839,288; 4,833,072 and 4,795,739.

    [0085] The vector of the present invention advantageously encodes for an Env.BG505 immunogen which may be encoded by a VSVG-Env.BG505 vaccine. The immunogen advantageously has the sequence as provided in SEQ ID NO: 2.

    [0086] In another embodiment, the vector of the present invention may comprise a sequence of a VSVG-Env.BG505 genomic clone. The genomic clone advantageously has the sequence as provided as SEQ ID NO: 1.

    [0087] Advantageously, the HIV epitope may be an Env precursor or gp160 epitope. The Env precursor or gp160 epitope may be recognized by antibodies PG9, PG16, 2G12, b12, 15 2F5, 4E10, Z13, or other broad potent neutralizing antibodies.

    [0088] Adaptive mutations emerged in Env during vector rescue and propagation that increased Env-dependent replication in VeroCD4/CCR5 cells (human CD4/CCR5) (see, e.g., FIG. 17). The substitutions are stable and included in vaccine vector tested in macaques. The adapted virus is advanced as a genomic DNA clone containing these coding changes supports rescue of recombinant virus. Therefore, the present invention also encompasses mutations of env that may increase Env-dependent replication and/or contribute to immunogenicity. The EnvG mutations may include mutations of the lysine at AA position 169, the isoleucine at AA position 307 and/or the tryptophan at AA position 672. In an especially advantageous embodiment, the mutations are K169T, 1307T and/or W672R. Other env mutations may be at P493, M343, K168, E168, Q440 and/or L494. In an advantageous embodiment, the mutations may be M343T, K168E, E168K, E164G, Q440R and/or L494F. see, e.g., Hoffenberg et al., J. Virol. May 2013 vol. 87 no. 10 5372-5383 for Env sequences and alignments.

    [0089] In another embodiment, HIV, or immunogenic fragments thereof, may be utilized as the HIV epitope. For example, the HIV nucleotides of U.S. Pat. Nos. 7,393,949, 7,374,877 7,306,901, 7,303,754, 7,173,014, 7,122,180, 7,078,516, 7,022,814, 6,974,866, 6,958,211, 6,949,337, 6,946,254, 6,896,900, 6,887,977, 6,870,045, 6,803,187, 6,794,129, 6,773,915, 6,768,004, 6,706,268, 6,696,291, 6,692,955, 6,656,706, 6,649,409, 6,627,442, 6,610,476, 6,602,705, 6,582,920, 6,557,296, 6,531,587, 6,531,137, 6,500,623, 6,448,078, 6,429,306, 6,420,545, 6,410,013, 6,407,077, 6,395,891, 6,355,789, 6,335,158, 6,323,185, 6,316,183, 6,303,293, 6,300,056, 6,277,561, 6,270,975, 6,261,564, 6,225,045, 6,222,024, 6,194,391, 6,194,142, 6,162,631, 6,114,167, 6,114,109, 6,090,392, 6,060,587, 6,057,102, 6,054,565, 6,043,081, 6,037,165, 6,034,233, 6,033,902, 6,030,769, 6,020,123, 6,015,661, 6,010,895, 6,001,555, 5,985,661, 5,980,900, 5,972,596, 5,939,538, 5,912,338, 5,869,339, 5,866,701, 5,866,694, 5,866,320, 5,866,137, 5,864,027, 5,861,242, 5,858,785, 5,858,651, 5,849,475, 5,843,638, 5,840,480, 5,821,046, 5,801,056, 5,786,177, 5,786,145, 5,773,247, 5,770,703, 5,756,674, 5,741,706, 5,705,612, 5,693,752, 5,688,637, 5,688,511, 5,684,147, 5,665,577, 5,585,263, 5,578,715, 5,571,712, 5,567,603, 5,554,528, 5,545,726, 5,527,895, 5,527,894, 5,223,423, 5,204,259, 5,144,019, 5,051,496 and 4,942,122 are useful for the present invention.

    [0090] Any epitope recognized by an anti-HIV antibody may be used in the present invention. For example, the anti-HIV antibodies of U.S. Pat. Nos. 6,949,337, 6,900,010, 6,821,744, 6,768,004, 6,613,743, 6,534,312, 6,511,830, 6,489,131, 6,242,197, 6,114,143, 6,074,646, 6,063,564, 6,060,254, 5,919,457, 5,916,806, 5,871,732, 5,824,304, 5,773,247, 5,736,320, 5,637,455, 5,587,285, 5,514,541, 5,317,009, 4,983,529, 4,886,742, 4,870,003 and 4,795,739 are useful for the present invention. Furthermore, monoclonal anti-HIV antibodies of U.S. Pat. Nos. 7,074,556, 7,074,554, 7,070,787, 7,060,273, 7,045,130, 7,033,593, RE39,057, 7,008,622, 6,984,721, 6,972,126, 6,949,337, 6,946,465, 6,919,077, 6,916,475, 6,911,315, 6,905,680, 6,900,010, 6,825,217, 6,824,975, 6,818,392, 6,815,201, 6,812,026, 6,812,024, 6,797,811, 6,768,004, 6,703,019, 6,689,118, 6,657,050, 6,608,179, 6,600,023, 6,596,497, 6,589,748, 6,569,143, 6,548,275, 6,525,179, 6,524,582, 6,506,384, 6,498,006, 6,489,131, 6,465,173, 6,461,612, 6,458,933, 6,432,633, 6,410,318, 6,406,701, 6,395,275, 6,391,657, 6,391,635, 6,384,198, 6,376,170, 6,372,217, 6,344,545, 6,337,181, 6,329,202, 6,319,665, 6,319,500, 6,316,003, 6,312,931, 6,309,880, 6,296,807, 6,291,239, 6,261,558, 6,248,514, 6,245,331, 6,242,197, 6,241,986, 6,228,361, 6,221,580, 6,190,871, 6,177,253, 6,146,635, 6,146,627, 6,146,614, 6,143,876, 6,132,992, 6,124,132, RE36,866, 6,114,143, 6,103,238, 6,060,254, 6,039,684, 6,030,772, 6,020,468, 6,013,484, 6,008,044, 5,998,132, 5,994,515, 5,993,812, 5,985,545, 5,981,278, 5,958,765, 5,939,277, 5,928,930, 5,922,325, 5,919,457, 5,916,806, 5,914,109, 5,911,989, 5,906,936, 5,889,158, 5,876,716, 5,874,226, 5,872,012, 5,871,732, 5,866,694, 5,854,400, 5,849,583, 5,849,288, 5,840,480, 5,840,305, 5,834,599, 5,831,034, 5,827,723, 5,821,047, 5,817,767, 5,817,458, 5,804,440, 5,795,572, 5,783,670, 5,776,703, 5,773,225, 5,766,944, 5,753,503, 5,750,373, 5,747,641, 5,736,341, 5,731,189, 5,707,814, 5,702,707, 5,698,178, 5,695,927, 5,665,536, 5,658,745, 5,652,138, 5,645,836, 5,635,345, 5,618,922, 5,610,035, 5,607,847, 5,604,092, 5,601,819, 5,597,896, 5,597,688, 5,591,829, 5,558,865, 5,514,541, 5,510,264, 5,478,753, 5,374,518, 5,374,516, 5,344,755, 5,332,567, 5,300,433, 5,296,347, 5,286,852, 5,264,221, 5,260,308, 5,256,561, 5,254,457, 5,230,998, 5,227,159, 5,223,408, 5,217,895, 5,180,660, 5,173,399, 5,169,752, 5,166,050, 5,156,951, 5,140,105, 5,135,864, 5,120,640, 5,108,904, 5,104,790, 5,049,389, 5,030,718, 5,030,555, 5,004,697, 4,983,529, 4,888,290, 4,886,742 and 4,853,326, are also useful for the present invention.

    [0091] The vectors used in accordance with the present invention should typically be chosen such that they contain a suitable gene regulatory region, such as a promoter or enhancer, such that the proteins of the invention can be expressed.

    [0092] For example, when the aim is to express the proteins of the invention in vitro, or in cultured cells, or in any prokaryotic or eukaryotic system for the purpose of producing the protein(s), then any suitable vector can be used depending on the application. For example, plasmids, viral vectors, bacterial vectors, protozoal vectors, insect vectors, baculovirus expression vectors, yeast vectors, mammalian cell vectors, and the like, can be used. Suitable vectors can be selected by the skilled artisan taking into consideration the characteristics of the vector and the requirements for expressing the proteins under the identified circumstances.

    [0093] When the aim is to express the proteins of the invention in vivo in a subject, for example in order to generate an immune response against an HIV-1 antigen and/or protective immunity against HIV-1, expression vectors that are suitable for expression on that subject, and that are safe for use in vivo, should be chosen. For example, in some embodiments it may be desired to express the proteins of the invention in a laboratory animal, such as for pre-clinical testing of the HIV-1 immunogenic compositions and vaccines of the invention. In other embodiments, it will be desirable to express the proteins of the invention in human subjects, such as in clinical trials and for actual clinical use of the immunogenic compositions and vaccine of the invention. Any vectors that are suitable for such uses can be employed, and it is well within the capabilities of the skilled artisan to select a suitable vector. In some embodiments it may be preferred that the vectors used for these in vivo applications are attenuated to vector from amplifying in the subject. For example, if plasmid vectors are used, preferably they will lack an origin of replication that functions in the subject so as to enhance safety for in vivo use in the subject. If viral vectors are used, preferably they are attenuated or replication-defective in the subject, again, so as to enhance safety for in vivo use in the subject.

    [0094] In preferred embodiments of the present invention viral vectors are used. Viral expression vectors are well known to those skilled in the art and include, for example, viruses such as adenoviruses, adeno-associated viruses (AAV), alphaviruses, herpesviruses, retroviruses and poxviruses, including avipox viruses, attenuated poxviruses, vaccinia viruses, and particularly, the modified vaccinia Ankara virus (MVA; ATCC Accession No. VR-1566). Such viruses, when used as expression vectors are innately non-pathogenic in the selected subjects such as humans or have been modified to render them non-pathogenic in the selected subjects. For example, replication-defective adenoviruses and alphaviruses are well known and can be used as gene delivery vectors.

    [0095] The present invention relates to recombinant vesicular stomatitis (VSV) vectors, however, other vectors may be contemplated in other embodiments of the invention such as, but not limited to, prime boost administration which may comprise administration of a recombinant VSV vector in combination with another recombinant vector expressing one or more HIV epitopes.

    [0096] VSV is a very practical, safe, and immunogenic vector for conducting animal studies, and an attractive candidate for developing vaccines for use in humans. VSV is a member of the Rhabdoviridae family of enveloped viruses containing a nonsegmented, negative-sense RNA genome. The genome is composed of 5 genes arranged sequentially 3-N-P-M-G-L-5, each encoding a polypeptide found in mature virions. Notably, the surface glycoprotein G is a transmembrane polypeptide that is present in the viral envelope as a homotrimer, and like Env, it mediates cell attachment and infection.

    [0097] The VSVs of U.S. Pat. Nos. 7,468,274; 7,419,829; 7,419,674; 7,344,838; 7,332,316; 7,329,807; 7,323,337; 7,259,015; 7,244,818; 7,226,786; 7,211,247; 7,202,079; 7,198,793; 7,198,784; 7,153,510; 7,070,994; 6,969,598; 6,958,226; RE38,824; PP15,957; 6,890,735; 6,887,377; 6,867,326; 6,867,036; 6,858,205; 6,835,568; 6,830,892; 6,818,209; 6,790,641; 6,787,520; 6,743,620; 6,740,764; 6,740,635; 6,740,320; 6,682,907; 6,673,784; 6,673,572; 6,669,936; 6,653,103; 6,607,912; 6,558,923; 6,555,107; 6,533,855; 6,531,123; 6,506,604; 6,500,623; 6,497,873; 6,489,142; 6,410,316; 6,410,313; 6,365,713; 6,348,312; 6,326,487; 6,312,682; 6,303,331; 6,277,633; 6,207,455; 6,200,811; 6,190,650; 6,171,862; 6,143,290; 6,133,027; 6,121,434; 6,103,462; 6,069,134; 6,054,127; 6,034,073; 5,969,211; 5,935,822; 5,888,727; 5,883,081; 5,876,727; 5,858,740; 5,843,723; 5,834,256; 5,817,491; 5,792,604; 5,789,229; 5,773,003; 5,763,406; 5,760,184; 5,750,396; 5,739,018; 5,698,446; 5,686,279; 5,670,354; 5,540,923; 5,512,421; 5,090,194; 4,939,176; 4,738,846; 4,622,292; 4,556,556 and 4,396,628 may be contemplated by the present invention.

    [0098] The nucleotide sequences and vectors of the invention can be delivered to cells, for example if aim is to express and the HIV-1 antigens in cells in order to produce and isolate the expressed proteins, such as from cells grown in culture. For expressing the proteins in cells any suitable transfection, transformation, or gene delivery methods can be used. Such methods are well known by those skilled in the art, and one of skill in the art would readily be able to select a suitable method depending on the nature of the nucleotide sequences, vectors, and cell types used. For example, transfection, transformation, microinjection, infection, electroporation, lipofection, or liposome-mediated delivery could be used. Expression of the proteins can be carried out in any suitable type of host cells, such as bacterial cells, yeast, insect cells, and mammalian cells. The proteins of the invention can also be expressed using including in vitro transcription/translation systems. All of such methods are well known by those skilled in the art, and one of skill in the art would readily be able to select a suitable method depending on the nature of the nucleotide sequences, vectors, and cell types used.

    [0099] In preferred embodiments, the nucleotide sequences, proteins of the invention are administered in vivo, for example where the aim is to produce an immunogenic response in a subject. A subject in the context of the present invention may be any animal. For example, in some embodiments it may be desired to express the transgenes of the invention in a laboratory animal, such as for pre-clinical testing of the HIV-1 immunogenic compositions and vaccines of the invention. In other embodiments, it will be desirable to express the proteins of the invention in human subjects, such as in clinical trials and for actual clinical use of the immunogenic compositions and vaccine of the invention. In preferred embodiments the subject is a human, for example a human that is infected with, or is at risk of infection with, HIV-1.

    [0100] For such in vivo applications the nucleotide sequences, proteins of the invention are preferably administered as a component of an immunogenic composition which may comprise the nucleotide sequences and/or antigens of the invention in admixture with a pharmaceutically acceptable carrier. The immunogenic compositions of the invention are useful to stimulate an immune response against HIV-1 and may be used as one or more components of a prophylactic or therapeutic vaccine against HIV-1 for the prevention, amelioration or treatment of AIDS. The nucleic acids and vectors of the invention are particularly useful for providing genetic vaccines, i.e. vaccines for delivering the nucleic acids encoding the proteins of the invention to a subject, such as a human, such that the proteins are then expressed in the subject to elicit an immune response.

    [0101] The compositions of the invention may be injectable suspensions, solutions, sprays, lyophilized powders, syrups, elixirs and the like. Any suitable form of composition may be used. To prepare such a composition, a nucleic acid or vector of the invention, having the desired degree of purity, is mixed with one or more pharmaceutically acceptable carriers and/or excipients. The carriers and excipients must be acceptable in the sense of being compatible with the other ingredients of the composition. Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations employed, and include, but are not limited to, water, saline, phosphate buffered saline, dextrose, glycerol, ethanol, or combinations thereof, buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride, benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptide; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter-ions such as sodium; metal complexes (e.g., Zn-protein complexes); and/or non-ionic surfactants such as TWEEN, PLURONICS or polyethylene glycol (PEG).

    [0102] An immunogenic or immunological composition can also be formulated in the form of an oil-in-water emulsion. The oil-in-water emulsion can be based, for example, on light liquid paraffin oil (European Pharmacopea type); isoprenoid oil such as squalane, squalene, EICOSANE or tetratetracontane; oil resulting from the oligomerization of alkene(s), e.g., isobutene or decene; esters of acids or of alcohols containing a linear alkyl group, such as plant oils, ethyl oleate, propylene glycol di(caprylate/caprate), glyceryl tri(caprylate/caprate) or propylene glycol dioleate; esters of branched fatty acids or alcohols, e.g., isostearic acid esters. The oil advantageously is used in combination with emulsifiers to form the emulsion. The emulsifiers can be nonionic surfactants, such as esters of sorbitan, mannide (e.g., anhydromannitol oleate), glycerol, polyglycerol, propylene glycol, and oleic, isostearic, ricinoleic, or hydroxystearic acid, which are optionally ethoxylated, and polyoxypropylene-polyoxyethylene copolymer blocks, such as the Pluronic products, e.g., L121. The adjuvant can be a mixture of emulsifier(s), micelle-forming agent, and oil such as that which is commercially available under the name Provax (DEC Pharmaceuticals, San Diego, Calif.).

    [0103] The immunogenic compositions of the invention can contain additional substances, such as wetting or emulsifying agents, buffering agents, or adjuvants to enhance the effectiveness of the vaccines (Remington's Pharmaceutical Sciences, 18th edition, Mack Publishing Company, (ed.) 1980).

    [0104] Adjuvants may also be included. Adjuvants include, but are not limited to, mineral salts (e.g., A1K(SO.sub.4).sub.2, AlNa(SO.sub.4).sub.2, AlNH(SO.sub.4).sub.2, silica, alum, Al(OH).sub.3, Ca.sub.3(PO.sub.4).sub.2, kaolin, or carbon), polynucleotides with or without immune stimulating complexes (ISCOMs) (e.g., CpG oligonucleotides, such as those described in Chuang, T. H. et al, (2002) J. Leuk. Biol. 71(3): 538-44; Ahmad-Nejad, P. et al (2002) Eur. J. Immunol. 32(7): 1958-68; poly IC or poly AU acids, polyarginine with or without CpG (also known in the art as IC31; see Schellack, C. et al (2003) Proceedings of the 34th Annual Meeting of the German Society of Immunology; Lingnau, K. et al (2002) Vaccine 20(29-30): 3498-508), JuvaVax (U.S. Pat. No. 6,693,086), certain natural substances (e.g., wax D from Mycobacterium tuberculosis, substances found in Cornyebacterium parvum, Bordetella pertussis, or members of the genus Brucella), flagellin (Toll-like receptor 5 ligand; see McSorley, S. J. et al (2002) J. Immunol. 169(7): 3914-9), saponins such as QS21, QS17, and QS7 (U.S. Pat. Nos. 5,057,540; 5,650,398; 6,524,584; 6,645,495), monophosphoryl lipid A, in particular, 3-de-O-acylated monophosphoryl lipid A (3D-MPL), imiquimod (also known in the art as IQM and commercially available as Aldara; U.S. Pat. Nos. 4,689,338; 5,238,944; Zuber, A. K. et al (2004) 22(13-14): 1791-8), and the CCR5 inhibitor CMPD167 (see Veazey, R. S. et al (2003) J. Exp. Med. 198: 1551-1562).

    [0105] Aluminum hydroxide or phosphate (alum) are commonly used at 0.05 to 0.1% solution in phosphate buffered saline. Other adjuvants that can be used, especially with DNA vaccines, are cholera toxin, especially CTA1-DD/ISCOMs (see Mowat, A. M. et al (2001) J. Immunol. 167(6): 3398-405), polyphosphazenes (Allcock, H. R. (1998) App. Organometallic Chem. 12(10-11): 659-666; Payne, L. G. et al (1995) Pharm. Biotechnol. 6: 473-93), cytokines such as, but not limited to, IL-2, IL-4, GM-CSF, IL-12, IL-15 IGF-1, IFN-, IFN-, and IFN- (Boyer et al., (2002) J. Liposome Res. 121:137-142; WO01/095919), immunoregulatory proteins such as CD40L (ADX40; see, for example, WO03/063899), and the CD1a ligand of natural killer cells (also known as CRONY or a-galactosyl ceramide; see Green, T. D. et al, (2003) J. Virol. 77(3): 2046-2055), immunostimulatory fusion proteins such as IL-2 fused to the Fc fragment of immunoglobulins (Barouch et al., Science 290:486-492, 2000) and co-stimulatory molecules B7.1 and B7.2 (Boyer), all of which can be administered either as proteins or in the form of DNA, on the same expression vectors as those encoding the antigens of the invention or on separate expression vectors.

    [0106] In an advantageous embodiment, the adjuvants may be lecithin is combined with an acrylic polymer (Adjuplex-LAP), lecithin coated oil droplets in an oil-in-water emulsion (Adjuplex-LE) or lecithin and acrylic polymer in an oil-in-water emulsion (Adjuplex-LAO) (Advanced BioAdjuvants (ABA)).

    [0107] The immunogenic compositions can be designed to introduce the nucleic acids or expression vectors to a desired site of action and release it at an appropriate and controllable rate. Methods of preparing controlled-release formulations are known in the art. For example, controlled release preparations can be produced by the use of polymers to complex or absorb the immunogen and/or immunogenic composition. A controlled-release formulation can be prepared using appropriate macromolecules (for example, polyesters, polyamino acids, polyvinyl, pyrrolidone, ethylenevinylacetate, methylcellulose, carboxymethylcellulose, or protamine sulfate) known to provide the desired controlled release characteristics or release profile. Another possible method to control the duration of action by a controlled-release preparation is to incorporate the active ingredients into particles of a polymeric material such as, for example, polyesters, polyamino acids, hydrogels, polylactic acid, polyglycolic acid, copolymers of these acids, or ethylene vinylacetate copolymers. Alternatively, instead of incorporating these active ingredients into polymeric particles, it is possible to entrap these materials into microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsule and poly-(methylmethacrylate) microcapsule, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in macroemulsions. Such techniques are disclosed in New Trends and Developments in Vaccines, Voller et al. (eds.), University Park Press, Baltimore, Md., 1978 and Remington's Pharmaceutical Sciences, 16th edition.

    [0108] Suitable dosages of the nucleic acids and expression vectors of the invention (collectively, the immunogens) in the immunogenic composition of the invention can be readily determined by those of skill in the art. For example, the dosage of the immunogens can vary depending on the route of administration and the size of the subject. Suitable doses can be determined by those of skill in the art, for example by measuring the immune response of a subject, such as a laboratry animal, using conventional immunological techniques, and adjusting the dosages as appropriate. Such techniques for measuring the immune response of the subject include but are not limited to, chromium release assays, tetramer binding assays, IFN- ELISPOT assays, IL-2 ELISPOT assays, intracellular cytokine assays, and other immunological detection assays, e.g., as detailed in the text Antibodies: A Laboratory Manual by Ed Harlow and David Lane.

    [0109] When provided prophylactically, the immunogenic compositions of the invention are ideally administered to a subject in advance of HIV infection, or evidence of HIV infection, or in advance of any symptom due to AIDS, especially in high-risk subjects. The prophylactic administration of the immunogenic compositions can serve to provide protective immunity of a subject against HIV-1 infection or to prevent or attenuate the progression of AIDS in a subject already infected with HIV-1. When provided therapeutically, the immunogenic compositions can serve to ameliorate and treat AIDS symptoms and are advantageously used as soon after infection as possible, preferably before appearance of any symptoms of AIDS but may also be used at (or after) the onset of the disease symptoms.

    [0110] The immunogenic compositions can be administered using any suitable delivery method including, but not limited to, intramuscular, intravenous, intradermal, mucosal, and topical delivery. Such techniques are well known to those of skill in the art. More specific examples of delivery methods are intramuscular injection, intradermal injection, and subcutaneous injection. However, delivery need not be limited to injection methods. Further, delivery of DNA to animal tissue has been achieved by cationic liposomes (Watanabe et al., (1994) Mol. Reprod. Dev. 38:268-274; and WO 96/20013), direct injection of naked DNA into animal muscle tissue (Robinson et al., (1993) Vaccine 11:957-960; Hoffman et al., (1994) Vaccine 12: 1529-1533; Xiang et al., (1994) Virology 199: 132-140; Webster et al., (1994) Vaccine 12: 1495-1498; Davis et al., (1994) Vaccine 12: 1503-1509; and Davis et al., (1993) Hum. Mol. Gen. 2: 1847-1851), or intradermal injection of DNA using gene gun technology (Johnston et al., (1994) Meth. Cell Biol. 43:353-365). Alternatively, delivery routes can be oral, intranasal or by any other suitable route. Delivery also be accomplished via a mucosal surface such as the anal, vaginal or oral mucosa.

    [0111] Immunization schedules (or regimens) are well known for animals (including humans) and can be readily determined for the particular subject and immunogenic composition. Hence, the immunogens can be administered one or more times to the subject. Preferably, there is a set time interval between separate administrations of the immunogenic composition. While this interval varies for every subject, typically it ranges from 10 days to several weeks, and is often 2, 4, 6 or 8 weeks. For humans, the interval is typically from 2 to 6 weeks. The immunization regimes typically have from 1 to 6 administrations of the immunogenic composition, but may have as few as one or two or four. The methods of inducing an immune response can also include administration of an adjuvant with the immunogens. In some instances, annual, biannual or other long interval (5-10 years) booster immunization can supplement the initial immunization protocol.

    [0112] The present methods also include a variety of prime-boost regimens, for example DNA prime-Adenovirus boost regimens. In these methods, one or more priming immunizations are followed by one or more boosting immunizations. The actual immunogenic composition can be the same or different for each immunization and the type of immunogenic composition (e.g., containing protein or expression vector), the route, and formulation of the immunogens can also be varied. For example, if an expression vector is used for the priming and boosting steps, it can either be of the same or different type (e.g., DNA or bacterial or viral expression vector). One useful prime-boost regimen provides for two priming immunizations, four weeks apart, followed by two boosting immunizations at 4 and 8 weeks after the last priming immunization. It should also be readily apparent to one of skill in the art that there are several permutations and combinations that are encompassed using the DNA, bacterial and viral expression vectors of the invention to provide priming and boosting regimens.

    [0113] The prime-boost regimen can also include VSV vectors that derive their G protein protein from different serotype vesicular stomatitis viruses (Rose N F, Roberts A, Buonocore L, Rose J K. Glycoprotein exchange vectors based on vesicular stomatitis virus allow effective boosting and generation of neutralizing antibodies to a primary isolate of human immunodeficiency virus type 1. J Virol. 2000 December; 74(23):10903-10). The VSV vectors used in these examples contain a G protein derived from the Indiana serotype of VSV. Vectors can also be constructed to express epitopes in the context of G molecules derived from other VSV serotypes (i.e. vesicular stomatitis New Jersey virus or vesicular stomatitis Alagoas virus) or other vesiculoviruses (i.e. Chandipura virus, Cocal virus, Isfahan virus). Thus an epitope like the HIV MPER can be delivered in a prime in the context of a G molecule that is from the Indiana serotype and the immune system can be boosted with a vector that expresses epitopes in the context of second serotype like New Jersey. This circumvents anti-G immunity elicited by the prime, and helps focus the boost response agains the foreign epitope.

    [0114] A specific embodiment of the invention provides methods of inducing an immune response against HIV in a subject by administering an immunogenic composition of the invention, preferably which may comprise an adenovirus vector containing DNA encoding one or more of the epitopes of the invention, one or more times to a subject wherein the epitopes are expressed at a level sufficient to induce a specific immune response in the subject. Such immunizations can be repeated multiple times at time intervals of at least 2, 4 or 6 weeks (or more) in accordance with a desired immunization regime.

    [0115] The immunogenic compositions of the invention can be administered alone, or can be co-administered, or sequentially administered, with other HIV immunogens and/or HIV immunogenic compositions, e.g., with other immunological, antigenic or vaccine or therapeutic compositions thereby providing multivalent or cocktail or combination compositions of the invention and methods of employing them. Again, the ingredients and manner (sequential or co-administration) of administration, as well as dosages can be determined taking into consideration such factors as the age, sex, weight, species and condition of the particular subject, and the route of administration.

    [0116] When used in combination, the other HIV immunogens can be administered at the same time or at different times as part of an overall immunization regime, e.g., as part of a prime-boost regimen or other immunization protocol. In an advantageous embodiment, the other HIV immunogen is env, preferably the HIV env trimer.

    [0117] Many other HIV immunogens are known in the art, one such preferred immunogen is HIVA (described in WO 01/47955), which can be administered as a protein, on a plasmid (e.g., pTHr.HIVA) or in a viral vector (e.g., MVA.HIVA). Another such HIV immunogen is RENTA (described in PCT/US2004/037699), which can also be administered as a protein, on a plasmid (e.g., pTHr.RENTA) or in a viral vector (e.g., MVA.RENTA).

    [0118] For example, one method of inducing an immune response against HIV in a human subject may comprise administering at least one priming dose of an HIV immunogen and at least one boosting dose of an HIV immunogen, wherein the immunogen in each dose can be the same or different, provided that at least one of the immunogens is an epitope of the present invention, a nucleic acid encoding an epitope of the invention or an expression vector, preferably a VSV vector, encoding an epitope of the invention, and wherein the immunogens are administered in an amount or expressed at a level sufficient to induce an HIV-specific immune response in the subject. The HIV-specific immune response can include an HIV-specific T-cell immune response or an HIV-specific B-cell immune response. Such immunizations can be done at intervals, preferably of at least 0-29 or more weeks.

    [0119] Preclinical efficacy in the SHIV challenge model was observed following mucosal vaccination with a total dose of 210.sup.8 pfu per ml. The vaccine dose may be split between two sites, such as mucosal surfaces in the nasal and oral cavities, where each received 110.sup.8 pfu applied in a buffered solution. Dosages ranging from about 110.sup.4 to 110.sup.9 pfu per ml are also contemplated. Single doses are also contemplated. Alternatively, a avaccination schedule from about 0 to 40 weeks is contemplated. A vaccination schedule may be at 0, 4 and 29 weeks.

    [0120] Preclinical efficacy in the SHIV challenge model was observed with a vaccination schedule of 0, 4, and 29 weeks. Other vaccination schedules are also contemplated.

    TABLE-US-00001 SEQIDNO:1: 1 aaattaatacgactcactatagggagaccacaacggtttccctctagcgttgtcttcgtc 61 tgatgagtccgtgaggacgaaactataggaaaggaattcctatagtcACGAAGACAAACA 121 AACCATTATTATCATTAAAAGGCTCAGGAGAAACTTTAACAGTAATCAAAATGTCTGTTA 181 CAGTCAAGAGAATCATTGACAACACAGTCATAGTTCCAAAACTTCCTGCAAATGAGGATC 241 CAGTGGAATACCCGGCAGATTACTTCAGAAAATCAAAGGAGATTCCTCTTTACATCAATA 301 CTACAAAAAGTTTGTCAGATCTAAGAGGATATGTCTACCAAGGCCTCAAATCCGGAAATG 361 TATCAATCATACATGTCAACAGCTACTTGTATGGAGCATTGAAGGACATCCGGGGTAAGT 421 TGGATAAAGATTGGTCAAGTTTCGGAATAAACATCGGGAAGGCAGGGGATACAATCGGAA 481 TATTTGACCTTGTATCCTTGAAAGCCCTGGACGGTGTACTTCCAGATGGAGTATCGGATG 541 CTTCCAGAACCAGCGCAGATGACAAATGGTTGCCTTTGTATCTACTTGGCTTATACAGAG 601 TGGGCAGAACACAAATGCCTGAATACAGAAAAAGGCTCATGGATGGGCTGACAAATCAAT 661 GCAAAATGATCAATGAACAGTTTGAACCTCTTGTGCCAGAAGGTCGTGACATTTTTGATG 721 TGTGGGGAAATGACAGTAATTACACAAAAATTGTCGCTGCAGTGGACATGTTCTTCCACA 781 TGTTCAAAAAACATGAATGTGCCTCGTTCAGATACGGAACTATTGTTTCCAGATTCAAAG 841 ATTGTGCTGCATTGGCAACATTTGGACACCTCTGCAAAATAACCGGAATGTCTACAGAAG 901 ATGTGACGACCTGGATCTTGAACCGAGAAGTTGCAGATGAGATGGTCCAAATGATGCTTC 961 CAGGCCAAGAAATTGACAAGGCTGATTCATACATGCCTTATTTGATCGACTTTGGATTGT 1021 CTTCTAAGTCTCCATATTCTTCCGTCAAAAACCCTGCCTTCCACTTCTGGGGGCAATTGA 1081 CAGCTCTTCTGCTCAGATCCACCAGAGCAAGGAATGCCCGACAGCCTGATGACATTGAGT 1141 ATACATCTCTTACTACAGCAGGTTTGTTGTACGCTTATGCAGTAGGATCCTCTGCTGACT 1201 TGGCACAACAGTTTTGTGTTGGAGATAGCAAATACACTCCAGATGATAGTACCGGAGGAT 1261 TGACGACTAATGCACCGCCACAAGGCAGAGATGTGGTCGAATGGCTCGGATGGTTTGAAG 1321 ATCAAAACAGAAAACCGACTCCTGATATGATGCAGTATGCGAAACGAGCAGTCATGTCAC 1381 TGCAAGGCCTAAGAGAGAAGACAATTGGCAAGTATGCTAAGTCAGAGTTTGACAAATGAC 1441 CCTATAATTCTCAGATCACCTATTATATATTATGCTAGCTATGAAAAAAACTAACAGATA 1501 TCATGGATAATCTCACAAAAGTTCGTGAGTATCTCAAGTCCTATTCTCGTCTAGATCAGG 1561 CGGTAGGAGAGATAGATGAGATCGAAGCACAACGAGCTGAAAAGTCCAATTATGAGTTGT 1621 TCCAAGAGGACGGAGTGGAAGAGCATACTAGGCCCTCTTATTTTCAGGCAGCAGATGATT 1681 CTGACACAGAATCTGAACCAGAAATTGAAGACAATCAAGGCTTGTATGTACCAGATCCGG 1741 AAGCTGAGCAAGTTGAAGGCTTTATACAGGGGCCTTTAGATGACTATGCAGATGAGGACG 1801 TGGATGTTGTATTCACTTCGGACTGGAAACAGCCTGAGCTTGAATCCGACGAGCATGGAA 1861 AGACCTTACGGTTGACATTGCCAGAGGGTTTAAGTGGAGAGCAGAAATCCCAGTGGCTTT 1921 TGACGATTAAAGCAGTCGTTCAAAGTGCCAAACACTGGAATCTGGCAGAGTGCACATTTG 1981 AAGCATCGGGAGAAGGGGTCATCATAAAAAAGCGCCAGATAACTCCGGATGTATATAAGG 2041 TCACTCCAGTGATGAACACACATCCGTCCCAATCAGAAGCCGTATCAGATGTTTGGTCTC 2101 TCTCAAAGACATCCATGACTTTCCAACCCAAGAAAGCAAGTCTTCAGCCTCTCACCATAT 2161 CCTTGGATGAATTGTTCTCATCTAGAGGAGAATTCATCTCTGTCGGAGGTAACGGACGAA 2221 TGTCTCATAAAGAGGCCATCCTGCTCGGTCTGAGGTACAAAAAGTTGTACAATCAGGCGA 2281 GAGTCAAATATTCTCTGTAGACTAGTATGAAAAAAAGTAACAGATATCACAATCTAAGTG 2341 TTATCCCAATCCATTCATCATGAGTTCCTTAAAGAAGATTCTCGGTCTGAAGGGGAAAGG 2401 TAAGAAATCTAAGAAATTAGGGATCGCACCACCCCCTTATGAAGAGGACACTAACATGGA 2461 GTATGCTCCGAGCGCTCCAATTGACAAATCCTATTTTGGAGTTGACGAGATGGACACTCA 2521 TGATCCGAATCAATTAAGATATGAGAAATTCTTCTTTACAGTGAAAATGACGGTTAGATC 2581 TAATCGTCCGTTCAGAACATACTCAGATGTGGCAGCCGCTGTATCCCATTGGGATCACAT 2641 GTACATCGGAATGGCAGGGAAACGTCCCTTCTACAAGATCTTGGCTTTTTTGGGTTCTTC 2701 TAATCTAAAGGCCACTCCAGCGGTATTGGCAGATCAAGGTCAACCAGAGTATCATGCTCA 2761 CTGTGAAGGCAGGGCTTATTTGCCACACAGAATGGGGAAGACCCCTCCCATGCTCAATGT 2821 ACCAGAGCACTTCAGAAGACCATTCAATATAGGTCTTTACAAGGGAACGATTGAGCTCAC 2881 AATGACCATCTACGATGATGAGTCACTGGAAGCAGCTCCTATGATCTGGGATCATTTCAA 2941 TTCTTCCAAATTTTCTGATTTCAGAGAGAAGGCCTTAATGTTTGGCCTGATTGTCGAGAA 3001 AAAGGCATCTGGAGCTTGGGTCCTGGATTCTGTCAGCCACTTCAAATGAGCTAGTCTAGC 3061 TTCCAGCTTCTGAACAATCCCCGGTTTACTCAGTCTCTCCTAATTCCAGCCTTTCGAACA 3121 ACTAATATCCTGTCTTCTCTATCCCTATGAAAAAAACTAACAGAGATCGATCTGTTTCCT 3181 TGACACCAGGAGCCACCATGAAGTGCCTTTTGTACTTAGCTTTTTTATTCATCGGGGTGA 3241 ATTGCAAGGCTAGCGCAGAGAATTTGTGGGTAACAGTCTACTATGGAGTCCCTGTATGGA 3301 AGGATGCAGAGACAACATTGTTCTGTGCTAGTGACGCAAAGGCTTACGAGACGGAGAAGC 3361 ACAATGTGTGGGCAACTCACGCATGTGTCCCAACCGATCCAAATCCTCAAGAGATTCATC 3421 TAGAGAATGTGACTGAAGAATTCAATATGTGGAAGAATAATATGGTAGAGCAAATGCATA 3481 CAGATATCATTAGTTTATGGGACCAGTCACTTAAACCCTGCGTTAAATTGACGCCTCTAT 3541 GTGTGACACTTCAATGTACTAATGTTACAAACAACATAACAGATGATATGAGAGGAGAAC 3601 TGAAGAACTGTAGTTTCAACATGACGACAGAGTTGCGTGACAAGAAACAGAAAGTGTATT 3661 CACTATTCTATCGGTTGGATGTAGTACAGATAAATGAGAATCAAGGAAACAGGTCCAACA 3721 ACTCTAACAAAGAGTACAGACTTATTAATTGCAATACCAGTGCTATCACGCAAGCCTGCC 3781 CAAAGGTTTCATTTGAACCAATACCTATTCATTATTGTGCACCTGCTGGATTCGCCATCC 3841 TCAAATGTAAAGACAAGAAGTTCAATGGAACAGGACCCTGCCCATCAGTTTCAACCGTTC 3901 AGTGCACCCACGGAATCAAGCCTGTAGTTAGTACTCAATTATTGTTAAATGGGAGCTTAG 3961 CTGAAGAAGAAGTTATGATTAGATCAGAGAATATTACCAATAATGCGAAGAACATCTTGG 4021 TTCAATTCAATACTCCAGTCCAGATCAATTGCACAAGGCCTAATAATAATACCAGAAAGA 4081 GTATAAGAATTGGGCCAGGACAGGCATTCTATGCAACAGGAGATATAATCGGAGACATTC 4141 GACAAGCGCACTGCACTGTTTCTAAGGCCACTTGGAATGAAACATTGGGTAAAGTTGTAA 4201 AGCAACTTCGGAAGCATTTCGGAAATAACACAATTATTAGATTTGCGAACTCATCTGGAG 4261 GGGATCTGGAAGTGACAACACACTCTTTCAATTGCGGTGGCGAGTTCTTCTATTGTAATA 4321 CAAGTGGATTATTTAACTCTACTTGGATTTCAAATACCTCAGTCCAAGGATCTAATTCAA 4381 CAGGGTCTAACGATTCTATAACATTACCTTGCCGTATAAAGCAAATTATTAATATGTGGC 4441 AAAGAATCGGGCAAGCGATGTATGCTCCACCTATTCAAGGCGTGATTCGTTGCGTTTCAA 4501 ACATAACAGGGTTGATCCTGACCAGGGATGGAGGCTCTACCAATTCCACCACCGAGACCT 4561 TCCGTCCCGGTGGCGGAGATATGCGGGATAACTGGAGATCAGAGCTCTATAAGTATAAGG 4621 TTGTGAAGATTGAACCTCTTGGAGTTGCCCCTACAAGAGCAAAGAGAAGGGTGGTTGGCC 4681 GAGAGAAGAGAGCAGTTGGCATCGGTGCTGTCTTTCTCGGATTTCTTGGAGCAGCTGGAT 4741 CCACTATGGGAGCAGCATCAATGACACTAACAGTGCAGGCTAGAAATTTGCTTAGCGGAA 4801 TCGTTCAGCAGCAGAGCAATTTACTAAGAGCAATTGAAGCACAGCAACATCTCTTAAAGT 4861 TGACGGTGTGGGGCATTAAACAACTACAAGCGAGAGTGCTTGCCGTCGAAAGATATTTGC 4921 GAGACCAACAGCTATTGGGTATTTGGGGTTGTTCTGGGAAATTAATTTGCACAACAAATG 4981 TTCCATGGAACTCCTCCTGGAGTAATAGGAATTTAAGTGAGATATGGGACAACATGACAT 5041 GGTTGCAGTGGGACAAGGAAATCTCAAATTATACACAGATAATCTATGGATTATTAGAAG 5101 AGTCTCAGAATCAGCAAGAGAAGAATGAACAGGATTTGCTTGCATTGGATAAGTGGGCTT 5161 CTCTATGGAACTGGTTCGATATTAGTAATTGGCTCTGGTATATTAAGAGCTCTATTGCCT 5221 CTTTTTTCTTTATCATAGGGTTAATCATTGGACTATTCTTGGTTCTCCGAGTTGGTATTT 5281 ATCTTTGCATTAAATTAAAGCACACCAAGAAAAGACAGATTTATACAGACATAGAGATGA 5341 ACCGACTTGGAAAGTAAAGCTCAAATCCTGCACAACAGATTCTTCATGTTTGAACCAAAT 5401 CAACTTGTGATATCATGCTCAAAGAGGCCTTAATTAAATTTTAATTTTTAATTTTTATGA 5461 AAAAAACTAACAGCAATCATGGAAGTCCACGATTTTGAGACCGACGAGTTCAATGATTTC 5521 AATGAAGATGACTATGCCACAAGAGAATTCCTGAATCCCGATGAGCGCATGACGTACTTG 5581 AATCATGCTGATTACAATTTGAATTCTCCTCTAATTAGTGATGATATTGACAATTTGATC 5641 AGGAAATTCAATTCTCTTCCGATTCCCTCGATGTGGGATAGTAAGAACTGGGATGGAGTT 5701 CTTGAGATGTTAACATCATGTCAAGCCAATCCCATCTCAACATCTCAGATGCATAAATGG 5761 ATGGGAAGTTGGTTAATGTCTGATAATCATGATGCCAGTCAAGGGTATAGTTTTTTACAT 5821 GAAGTGGACAAAGAGGCAGAAATAACATTTGACGTGGTGGAGACCTTCATCCGCGGCTGG 5881 GGCAACAAACCAATTGAATACATCAAAAAGGAAAGATGGACTGACTCATTCAAAATTCTC 5941 GCTTATTTGTGTCAAAAGTTTTTGGACTTACACAAGTTGACATTAATCTTAAATGCTGTC 6001 TCTGAGGTGGAATTGCTCAACTTGGCGAGGACTTTCAAAGGCAAAGTCAGAAGAAGTTCT 6061 CATGGAACGAACATATGCAGGCTTAGGGTTCCCAGCTTGGGTCCTACTTTTATTTCAGAA 6121 GGATGGGCTTACTTCAAGAAACTTGATATTCTAATGGACCGAAACTTTCTGTTAATGGTC 6181 AAAGATGTGATTATAGGGAGGATGCAAACGGTGCTATCCATGGTATGTAGAATAGACAAC 6241 CTGTTCTCAGAGCAAGACATCTTCTCCCTTCTAAATATCTACAGAATTGGAGATAAAATT 6301 GTGGAGAGGCAGGGAAATTTTTCTTATGACTTGATTAAAATGGTGGAACCGATATGCAAC 6361 TTGAAGCTGATGAAATTAGCAAGAGAATCAAGGCCTTTAGTCCCACAATTCCCTCATTTT 6421 GAAAATCATATCAAGACTTCTGTTGATGAAGGGGCAAAAATTGACCGAGGTATAAGATTC 6481 CTCCATGATCAGATAATGAGTGTGAAAACAGTGGATCTCACACTGGTGATTTATGGATCG 6541 TTCAGACATTGGGGTCATCCTTTTATAGATTATTACGCTGGACTAGAAAAATTACATTCC 6601 CAAGTAACCATGAAGAAAGATATTGATGTGTCATATGCAAAAGCACTTGCAAGTGATTTA 6661 GCTCGGATTGTTCTATTTCAACAGTTCAATGATCATAAAAAGTGGTTCGTGAATGGAGAC 6721 TTGCTCCCTCATGATCATCCCTTTAAAAGTCATGTTAAAGAAAATACATGGCCTACAGCT 6781 GCTCAAGTTCAAGATTTTGGAGATAAATGGCATGAACTTCCGCTGATTAAATGTTTTGAA 6841 ATACCCGACTTACTAGACCCATCGATAATATACTCTGACAAAAGTCATTCAATGAATAGG 6901 TCAGAGGTGTTGAAACATGTCCGAATGAATCCGAACACTCCTATCCCTAGTAAAAAGGTG 6961 TTGCAGACTATGTTGGACACAAAGGCTACCAATTGGAAAGAATTTCTTAAAGAGATTGAT 7021 GAGAAGGGCTTAGATGATGATGATCTAATTATTGGTCTTAAAGGAAAGGAGAGGGAACTG 7081 AAGTTGGCAGGTAGATTTTTCTCCCTAATGTCTTGGAAATTGCGAGAATACTTTGTAATT 7141 ACCGAATATTTGATAAAGACTCATTTCGTCCCTATGTTTAAAGGCCTGACAATGGCGGAC 7201 GATCTAACTGCAGTCATTAAAAAGATGTTAGATTCCTCATCCGGCCAAGGATTGAAGTCA 7261 TATGAGGCAATTTGCATAGCCAATCACATTGATTACGAAAAATGGAATAACCACCAAAGG 7321 AAGTTATCAAACGGCCCAGTGTTCCGAGTTATGGGCCAGTTCTTAGGTTATCCATCCTTA 7381 ATCGAGAGAACTCATGAATTTTTTGAGAAAAGTCTTATATACTACAATGGAAGACCAGAC 7441 TTGATGCGTGTTCACAACAACACACTGATCAATTCAACCTCCCAACGAGTTTGTTGGCAA 7501 GGACAAGAGGGTGGACTGGAAGGTCTACGGCAAAAAGGATGGAGTATCCTCAATCTACTG 7561 GTTATTCAAAGAGAGGCTAAAATCAGAAACACTGCTGTCAAAGTCTTGGCACAAGGTGAT 7621 AATCAAGTTATTTGCACACAGTATAAAACGAAGAAATCGAGAAACGTTGTAGAATTACAG 7681 GGTGCTCTCAATCAAATGGTTTCTAATAATGAGAAAATTATGACTGCAATCAAAATAGGG 7741 ACAGGGAAGTTAGGACTTTTGATAAATGACGATGAGACTATGCAATCTGCAGATTACTTG 7801 AATTATGGAAAAATACCGATTTTCCGTGGAGTGATTAGAGGGTTAGAGACCAAGAGATGG 7861 TCACGAGTGACTTGTGTCACCAATGACCAAATACCCACTTGTGCTAATATAATGAGCTCA 7921 GTTTCCACAAATGCTCTCACCGTAGCTCATTTTGCTGAGAACCCAATCAATGCCATGATA 7981 CAGTACAATTATTTTGGGACATTTGCTAGACTCTTGTTGATGATGCATGATCCTGCTCTT 8041 CGTCAATCATTGTATGAAGTTCAAGATAAGATACCGGGCTTGCACAGTTCTACTTTCAAA 8101 TACGCCATGTTGTATTTGGACCCTTCCATTGGAGGAGTGTCGGGCATGTCTTTGTCCAGG 8161 TTTTTGATTAGAGCCTTCCCAGATCCCGTAACAGAAAGTCTCTCATTCTGGAGATTCATC 8221 CATGTACATGCTCGAAGTGAGCATCTGAAGGAGATGAGTGCAGTATTTGGAAACCCCGAG 8281 ATAGCCAAGTTCCGAATAACTCACATAGACAAGCTAGTAGAAGATCCAACCTCTCTGAAC 8341 ATCGCTATGGGAATGAGTCCAGCGAACTTGTTAAAGACTGAGGTTAAAAAATGCTTAATC 8401 GAATCAAGACAAACCATCAGGAACCAGGTGATTAAGGATGCAACCATATATTTGTATCAT 8461 GAAGAGGATCGGCTCAGAAGTTTCTTATGGTCAATAAATCCTCTGTTCCCTAGATTTTTA 8521 AGTGAATTCAAATCAGGCACTTTTTTGGGAGTCGCAGACGGGCTCATCAGTCTATTTCAA 8581 AATTCTCGTACTATTCGGAACTCCTTTAAGAAAAAGTATCATAGGGAATTGGATGATTTG 8641 ATTGTGAGGAGTGAGGTATCCTCTTTGACACATTTAGGGAAACTTCATTTGAGAAGGGGA 8701 TCATGTAAAATGTGGACATGTTCAGCTACTCATGCTGACACATTAAGATACAAATCCTGG 8761 GGCCGTACAGTTATTGGGACAACTGTACCCCATCCATTAGAAATGTTGGGTCCACAACAT 8821 CGAAAAGAGACTCCTTGTGCACCATGTAACACATCAGGGTTCAATTATGTTTCTGTGCAT 8881 TGTCCAGACGGGATCCATGACGTCTTTAGTTCACGGGGACCATTGCCTGCTTATCTAGGG 8941 TCTAAAACATCTGAATCTACATCTATTTTGCAGCCTTGGGAAAGGGAAAGCAAAGTCCCA 9001 CTGATTAAAAGAGCTACACGTCTTAGAGATGCTATCTCTTGGTTTGTTGAACCCGACTCT 9061 AAACTAGCAATGACTATACTTTCTAACATCCACTCTTTAACAGGCGAAGAATGGACCAAA 9121 AGGCAGCATGGGTTCAAAAGAACAGGGTCTGCCCTTCATAGGTTTTCGACATCTCGGATG 9181 AGCCATGGTGGGTTCGCATCTCAGAGCACTGCAGCATTGACCAGGTTGATGGCAACTACA 9241 GACACCATGAGGGATCTGGGAGATCAGAATTTCGACTTTTTATTCCAAGCAACGTTGCTC 9301 TATGCTCAAATTACCACCACTGTTGCAAGAGACGGATGGATCACCAGTTGTACAGATCAT 9361 TATCATATTGCCTGTAAGTCCTGTTTGAGACCCATAGAAGAGATCACCCTGGACTCAAGT 9421 ATGGACTACACGCCCCCAGATGTATCCCATGTGCTGAAGACATGGAGGAATGGGGAAGGT 9481 TCGTGGGGACAAGAGATAAAACAGATCTATCCTTTAGAAGGGAATTGGAAGAATTTAGCA 9541 CCTGCTGAGCAATCCTATCAAGTCGGCAGATGTATAGGTTTTCTATATGGAGACTTGGCG 9601 TATAGAAAATCTACTCATGCCGAGGACAGTTCTCTATTTCCTCTATCTATACAAGGTCGT 9661 ATTAGAGGTCGAGGTTTCTTAAAAGGGTTGCTAGACGGATTAATGAGAGCAAGTTGCTGC 9721 CAAGTAATACACCGGAGAAGTCTGGCTCATTTGAAGAGGCCGGCCAACGCAGTGTACGGA 9781 GGTTTGATTTACTTGATTGATAAATTGAGTGTATCACCTCCATTCCTTTCTCTTACTAGA 9841 TCAGGACCTATTAGAGACGAATTAGAAACGATTCCCCACAAGATCCCAACCTCCTATCCG 9901 ACAAGCAACCGTGATATGGGGGTGATTGTCAGAAATTACTTCAAATACCAATGCCGTCTA 9961 ATTGAAAAGGGAAAATACAGATCACATTATTCACAATTATGGTTATTCTCAGATGTCTTA 10021 TCCATAGACTTCATTGGACCATTCTCTATTTCCACCACCCTCTTGCAAATCCTATACAAG 10081 CCATTTTTATCTGGGAAAGATAAGAATGAGTTGAGAGAGCTGGCAAATCTTTCTTCATTG 10141 CTAAGATCAGGAGAGGGGTGGGAAGACATACATGTGAAATTCTTCACCAAGGACATATTA 10201 TTGTGTCCAGAGGAAATCAGACATGCTTGCAAGTTCGGGATTGCTAAGGATAATAATAAA 10261 GACATGAGCTATCCCCCTTGGGGAAGGGAATCCAGAGGGACAATTACAACAATCCCTGTT 10321 TATTATACGACCACCCCTTACCCAAAGATGCTAGAGATGCCTCCAAGAATCCAAAATCCC 10381 CTGCTGTCCGGAATCAGGTTGGGCCAATTACCAACTGGCGCTCATTATAAAATTCGGAGT 10441 ATATTACATGGAATGGGAATCCATTACAGGGACTTCTTGAGTTGTGGAGACGGCTCCGGA 10501 GGGATGACTGCTGCATTACTACGAGAAAATGTGCATAGCAGAGGAATATTCAATAGTCTG 10561 TTAGAATTATCAGGGTCAGTCATGCGAGGCGCCTCTCCTGAGCCCCCCAGTGCCCTAGAA 10621 ACTTTAGGAGGAGATAAATCGAGATGTGTAAATGGTGAAACATGTTGGGAATATCCATCT 10681 GACTTATGTGACCCAAGGACTTGGGACTATTTCCTCCGACTCAAAGCAGGCTTGGGGCTT 10741 CAAATTGATTTAATTGTAATGGATATGGAAGTTCGGGATTCTTCTACTAGCCTGAAAATT 10801 GAGACGAATGTTAGAAATTATGTGCACCGGATTTTGGATGAGCAAGGAGTTTTAATCTAC 10861 AAGACTTATGGAACATATATTTGTGAGAGCGAAAAGAATGCAGTAACAATCCTTGGTCCC 10921 ATGTTCAAGACGGTCGACTTAGTTCAAACAGAATTTAGTAGTTCTCAAACGTCTGAAGTA 10981 TATATGGTATGTAAAGGTTTGAAGAAATTAATCGATGAACCCAATCCCGATTGGTCTTCC 11041 ATCAATGAATCCTGGAAAAACCTGTACGCATTCCAGTCATCAGAACAGGAATTTGCCAGA 11101 GCAAAGAAGGTTAGTACATACTTTACCTTGACAGGTATTCCCTCCCAATTCATTCCTGAT 11161 CCTTTTGTAAACATTGAGACTATGCTACAAATATTCGGAGTACCCACGGGTGTGTCTCAT 11221 GCGGCTGCCTTAAAATCATCTGATAGACCTGCAGATTTATTGACCATTAGCCTTTTTTAT 11281 ATGGCGATTATATCGTATTATAACATCAATCATATCAGAGTAGGACCGATACCTCCGAAC 11341 CCCCCATCAGATGGAATTGCACAAAATGTGGGGATCGCTATAACTGGTATAAGCTTTTGG 11401 CTGAGTTTGATGGAGAAAGACATTCCACTATATCAACAGTGTTTAGCAGTTATCCAGCAA 11461 TCATTCCCGATTAGGTGGGAGGCTGTTTCAGTAAAAGGAGGATACAAGCAGAAGTGGAGT 11521 ACTAGAGGTGATGGGCTCCCAAAAGATACCCGAATTTCAGACTCCTTGGCCCCAATCGGG 11581 AACTGGATCAGATCTCTGGAATTGGTCCGAAACCAAGTTCGTCTAAATCCATTCAATGAG 11641 ATCTTGTTCAATCAGCTATGTCGTACAGTGGATAATCATTTGAAATGGTCAAATTTGCGA 11701 AAAAACACAGGAATGATTGAATGGATCAATAGACGAATTTCAAAAGAAGACCGGTCTATA 11761 CTGATGTTGAAGAGTGACCTACACGAGGAAAACTCTTGGAGAGATTAAAAAATCATGAGG 11821 AGACTCCAAACTTTAAGTATGAAAAAAACTTTGATCCTTAAGACCCTCTTGTGGTTTTTA 11881 TTTTTTATCTGGTTTTGTGGTCTTCGTggccggcatggtcccagcctcctcgctggcgcc 11941 ggctgggcaacattccgaggggaccgtcccctcggtaatggcgaatgggacctgctaaca 12001 aagcccgaaaggaagctgagttggctgctgccaccgctgagcaataactagcataacccc 12061 ttggggcctctaaacgggtcttgaggggttttttgctgaaaggaggaactatatccggat 12121 gcggccgatccggctgctaacaaagcccgaaaggaagctgagttggctgctgccaccgct 12181 gagcaataactagcataaccccttggggcctctaaacgggtcttgaggggttttttgctg 12241 aaaggaggaactatatccgggttaacctgcattaatgaatcggccaacgcgcggggagag 12301 gcggtttgcgtattgggcgctcttccgcttcctcgctcactgactcgctgcgctcggtcg 12361 ttcggctgcggcgagcggtatcagctcactcaaaggcggtaatacggttatccacagaat 12421 caggggataacgcaggaaagaacatgtgagcaaaaggccagcaaaaggccaggaaccgta 12481 aaaaggccgcgttgctggcgtttttccataggctccgcccccctgacgagcatcacaaaa 12541 atcgacgctcaagtcagaggtggcgaaacccgacaggactataaagataccaggcgtttc 12601 cccctggaagctccctcgtgcgctctcctgttccgaccctgccgcttaccggatacctgt 12661 ccgcctttctcccttcgggaagcgtggcgctttctcaatgctcacgctgtaggtatctca 12721 gttcggtgtaggtcgttcgctccaagctgggctgtgtgcacgaaccccccgttcagcccg 12781 accgctgcgccttatccggtaactatcgtcttgagtccaacccggtaagacacgacttat 12841 cgccactggcagcagccactggtaacaggattagcagagcgaggtatgtaggcggtgcta 12901 cagagttcttgaagtggtggcctaactacggctacactagaaggacagtatttggtatct 12961 gcgctctgctgaagccagttaccttcggaaaaagagttggtagctcttgatccggcaaac 13021 aaaccaccgctggtagcggtggtttttttgtttgcaagcagcagattacgcgcagaaaaa 13081 aaggatctcaagaagatcctttgatcttttctacggggtctgacgctcagtggaacgaaa 13141 actcacgttaagggattttggtcatgagattatcaaaaaggatcttcacctagatccttt 13201 taaattaaaaatgaagttttaaatcaatctaaagtatatatgagtaaacttggtctgaca 13261 gttaccaatgcttaatcagtgaggcacctatctcagcgatctgtctatttcgttcatcca 13321 tagttgcctgactccccgtcgtgtagataactacgatacgggagggcttaccatctggcc 13381 ccagtgctgcaatgataccgcgagacccacgctcaccggctccagatttatcagcaataa 13441 accagccagccggaagggccgagcgcagaagtggtcctgcaactttatccgcctccatcc 13501 agtctattaattgttgccgggaagctagagtaagtagttcgccagttaatagtttgcgca 13561 acgttgttgccattgctacaggcatcgtggtgtcacgctcgtcgtttggtatggcttcat 13621 tcagctccggttcccaacgatcaaggcgagttacatgatcccccatgttgtgcaaaaaag 13681 cggttagctccttcggtcctccgatcgttgtcagaagtaagttggccgcagtgttatcac 13741 tcatggttatggcagcactgcataattctcttactgtcatgccatccgtaagatgctttt 13801 ctgtgactggtgagtactcaaccaagtcattctgagaatagtgtatgcggcgaccgagtt 13861 gctcttgcccggcgtcaatacgggataataccgcgccacatagcagaactttaaaagtgc 13921 tcatcattggaaaacgttcttcggggcgaaaactctcaaggatcttaccgctgttgagat 13981 ccagttcgatgtaacccactcgtgcacccaactgatcttcagcatcttttactttcacca 14041 gcgtttctgggtgagcaaaaacaggaaggcaaaatgccgcaaaaaagggaataagggcga 14101 cacggaaatgttgaatactcatactcttcctttttcaatattattgaagcatttatcagg 14161 gttattgtctcatgagcggatacatatttgaatgtatttagaaaaataaacaaatagggg 14221 ttccgcgcacatttccccgaaaagtgccacctgacgtc

    [0121] An annotated sequence of SEQ ID NO 1 is provided below. Coded protein disclosed as SEQ ID NO: 2.

    TABLE-US-00002 >T7-g10Promoter | aaattaatacgactcactatagggagaccacaacggtttccctctagcgttgtcttcgtc < 60 1020304050 >HammerheadRibozyme | tgatgagtccgtgaggacgaaactataggaaaggaattcctatagtcACGAAGACAAACA < 120 708090100110 >VSVLeader | AACCATTATTATCATTAAAAGGCTCAGGAGAAACTTTAACAGTAATCAAAATGTCTGTTA < 180 130140150160170 CAGTCAAGAGAATCATTGACAACACAGTCATAGTTCCAAAACTTCCTGCAAATGAGGATC < 240 190200210220230 CAGTGGAATACCCGGCAGATTACTTCAGAAAATCAAAGGAGATTCCTCTTTACATCAATA < 300 250260270280290 CTACAAAAAGTTTGTCAGATCTAAGAGGATATGTCTACCAAGGCCTCAAATCCGGAAATG < 360 310320330340350 TATCAATCATACATGTCAACAGCTACTTGTATGGAGCATTGAAGGACATCCGGGGTAAGT < 420 370380390400410 TGGATAAAGATTGGTCAAGTTTCGGAATAAACATCGGGAAGGCAGGGGATACAATCGGAA < 480 430440450460470 TATTTGACCTTGTATCCTTGAAAGCCCTGGACGGTGTACTTCCAGATGGAGTATCGGATG < 540 490500510520530 CTTCCAGAACCAGCGCAGATGACAAATGGTTGCCTTTGTATCTACTTGGCTTATACAGAG < 600 550560570580590 TGGGCAGAACACAAATGCCTGAATACAGAAAAAGGCTCATGGATGGGCTGACAAATCAAT < 660 610620630640650 GCAAAATGATCAATGAACAGTTTGAACCTCTTGTGCCAGAAGGTCGTGACATTTTTGATG < 720 670680690700710 TGTGGGGAAATGACAGTAATTACACAAAAATTGTCGCTGCAGTGGACATGTTCTTCCACA < 780 730740750760770 >N | TGTTCAAAAAACATGAATGTGCCTCGTTCAGATACGGAACTATTGTTTCCAGATTCAAAG < 840 790800810820830 ATTGTGCTGCATTGGCAACATTTGGACACCTCTGCAAAATAACCGGAATGTCTACAGAAG < 900 850860870880890 ATGTGACGACCTGGATCTTGAACCGAGAAGTTGCAGATGAGATGGTCCAAATGATGCTTC < 960 910920930940950 CAGGCCAAGAAATTGACAAGGCTGATTCATACATGCCTTATTTGATCGACTTTGGATTGT < 1020 97098099010001010 CTTCTAAGTCTCCATATTCTTCCGTCAAAAACCCTGCCTTCCACTTCTGGGGGCAATTGA < 1080 10301040105010601070 CAGCTCTTCTGCTCAGATCCACCAGAGCAAGGAATGCCCGACAGCCTSATGACATTGAGT < 1140 10901100111011201130 ATACATCTCTTACTACAGCAGGTTTGTTGTACGCTTATGCAGTAGGATCCTCTGCTGACT < 1200 11501160117011801190 TGGCACAACAGTTTTGTGTTGGAGATAGCAAATACACTCCAGATGATAGTACCGGAGGAT < 1260 12101220123012401250 TGACGACTAATGCACCGCCACAAGGCAGAGATGTGGTCGAATGGCTCGGATGGTTTGAAG < 1320 12701280129013001310 ATCAAAACAGAAAACCGACTCCTGATATGATGCAGTATGCGAAACGAGCAGTCATGTCAC < 1380 13301340135013601370 TGCAAGGCCTAAGAGAGAAGACAATTGGCAAGTATGCTAAGTCAGAGTTTGACAAATGAC < 1440 13901400141014201430 CCTATAATTCTCAGATCACCTATTATATATTATGCTAGCTATGAAAAAAACTAACAGATA < 1500 14501460147014801490 TCATGGATAATCTCACAAAAGTTCGTGAGTATCTCAAGTCCTATTCTCGTCTAGATCAGG < 1560 15101520153015401550 CGGTAGGAGAGATAGATGAGATCGAAGCACAACGAGCTGAAAAGTCCAATTATGAGTTGT < 1620 15701580159016001610 TCCAAGAGGACGGAGTGGAAGAGCATACTAGGCCCTCTTATTTTCAGGCAGCAGATGATT < 1680 16301640165016601670 CTGACACAGAATCTGAACCAGAAATTGAAGACAATCAAGGCTTGTATGTACCAGATCCGG < 1740 16901700171017201730 AAGCTGAGCAAGTTGAAGGCTTTATACAGGGGCCTTTAGATGACTATGCAGATGAGGACG < 1800 17501760177017801790 TGGATGTTGTATTCACTTCGGACTGGAAACAGCCTGAGCTTGAATCCGACGAGCATGGAA < 1860 18101820183018401850 >P | AGACCTTACGGTTGACATTGCCAGAGGGTTTAAGTGGAGAGCAGAAATCCCAGTGGCTTT < 1920 18701880189019001910 TGACGATTAAAGCAGTCGTTCAAAGTGCCAAACACTGGAATCTGGCAGAGTGCACATTTG < 1980 19301940195019601970 AAGCATCGGGAGAAGGGGTCATCATAAAAAAGCGCCAGATAACTCCGGATGTATATAAGG < 2040 19902000201020202030 TCACTCCAGTGATGAACACACATCCGTCCCAATCAGAAGCCGTATCAGATGTTTGGTCTC < 2100 20502060207020802090 TCTCAAAGACATCCATGACTTTCCAACCCAAGAAAGCAAGTCTTCAGCCTCTCACCATAT < 2160 21102120213021402150 CCTTGGATGAATTGTTCTCATCTAGAGGAGAATTCATCTCTGTCGGAGGTAACGGACGAA < 2220 21702180219022002210 TGTCTCATAAAGAGGCCATCCTGCTCGGTCTGAGGTACAAAAAGTTGTACAATCAGGCGA < 2280 22302240225022602270 GAGTCAAATATTCTCTGTAGACTAGTATGAAAAAAAGTAACAGATATCACAATCTAAGTG < 2340 22902300231023202330 TTATCCCAATCCATTCATCATGAGTTCCTTAAAGAAGATTCTCGGTCTGAAGGGGAAAGG < 2400 23502360237023802390 TAAGAAATCTAAGAAATTAGGGATCGCACCACCCCCTXATGAAGAGGACACTAACATGGA < 2460 24102420243024402450 GTATGCTCCGAGCGCTCCAATTGACAAATCCTATTTTGGAGTTGACQAGATGGACACTCA < 2520 24702480249025002510 TGATCCGAATCAATTAAGATATGAGAAATTCTTCTTTACAGTGAAAATGACGGTTAGATC < 2580 25302540255025602570 TAATCGTCCGTTCAGAACATACTCAGATGTGGCAGCCGCTGTATCCCATTGGGATCACAT < 2640 25902600261026202630 GTACATCGGAATGGCAGGGAAACGTCCCTTCTACAAGATCTTGGCTTTTTTGGGTTCTTC < 2700 26502660267026802690 >M | TAATCTAAAGGCCACTCCAGCGGTATTGGCAGATCAAGGTCAACCAGAGTATCATGCTCA < 2760 27102720273027402750 CTGTGAAGGCAGGGCTTATTTGCCACACAGAATGGGGAAGACCCCTCCCATGCTCAATGT < 2820 27702780279028002810 ACCAGAGCACTTCAGAAGACCATTCAATATAGGTCTTTACAAGGGAACGATTGAGCTCAC < 2880 28302840285028602870 AATGACCATCTACGATGATGAGTCACTGGAAGCAGCTCCTATGATCTGGGATCATTTCAA < 2940 28902900291029202930 TTCTTCCAAATTTTCTGATTTCAGAGAGAAGGCCTTAATGTTTGGCCTGATTGTCGAGAA < 3000 29502960297029802990 AAAGGCATCTGGAGCTTGGGTCCTGGATTCTGTCAGCCACTTCAAATGAGCTAGTCTAGC < 3060 30103020303030403050 TTCCAGCTTCTGAACAATCCCCGGTTTACTCAGTCTCTCCTAATTCCAGCCTTTCGAACA < 3120 30703080309031003110 ACTAATATCCTGTCTTCTCTATCCCTATGAAAAAAACTAACAGAGATCGATCTGTTTCCT < 3180 31303140315031603170 TGACACCAGGAGCCACCATGAAGTGCCTTTTGTACTTAGCTTTTTTATTCATCGGGGTGA < 3240 MKCLLYLAFLFIGVN 31903200321032203230 ATTGCAAGGCTAGCGCAGAGAATTTGTGGGTAACAGTCTACTATGGAGTCCCTGTATGGA < 3300 CKASAENLWVTVYYGVPVWK 32503260327032803290 AGGATGCAGAGACAACATTGTTCTGTGCTAGTGACGCAAAGGCTTAGGAGACGGAGAAGC < 3360 DAETTLFCASDAXAYETEKH 33103320333033403350 ACAATGTGTGGGCAACTCACGCATGTGTCCCAACCGATCCAAATCCTCAAGAGATTCATC < 3420 NVWATHACVPTDPNPQEIHL 33703380339034003410 TAGAGAATGTGACTGAAGAATTCAATATGTGGAAGAATAATATGGTAGAGCAAATGCATA < 3480 ENVTEEFNMWKNNMVEQMHT 34303440345034603470 CAGATATCATTAGTTTATGGGACCAGTCACTTAAACCCTGCGTTAAATTGACGCCTCTAT < 3540 DIISLWDQSLKPCVKLTPLC 34903500351035203530 GTGTGACACTTCAATGTACTAATGTTACAAACAACATAACAGATGATATGAGAGGAGAAC < 3600 VTLQCTNVTNNITDDMRSEL 35503560357035803590 TGAAGAACTGTAGTTTCAACATGACGACAGAGTTGCGTGACAAGAAACAGAAAGTGTATT < 3660 KNCSFNKTTELRDKKQKVYS 36103620363036403650 CACTATTCTATCGGTTGGATGTAGTACAGATAAATGAGAATCAAGGAAACAGGTCCAACA < 3720 LFYRLDVVQINENQGNRSNN 36703680369037003710 ACTCTAACAAAGAGTACAGACTTATTAATTGCAATACCAGTGCTATCACGCAAGCCTGCC < 3780 SNKEYRLTNCKTSAITQACP 37303740375037603770 CAAAGGTTTCATTTGAACCAATACCTATTCATTATTGTGCACCTGCTGGATTCGCCATCC < 3840 KVSFEPIPIHYCAPAGFAIL 37903800381038203830 TCAAATGTAAAGACAAGAAGTTCAATGGAACAGGACCCTGCCCATCAGTTTCAACCGTTC < 3900 KCKDKKFNGTGPCPSVSTVQ 38503860387038803890 AGTGCACCCACGGAATCAAGCCTGTAGTTAGTACTCAATTATTGTTAAATGGGAGCTTAG < 3960 CTHGIKPVVSTQLLLNGSLA 39103920393039403950 CTGAAGAAGAAGTTATGATTAGATCAGAGAATATTACCAATAATGCGAAGAACATCTTGG < 4020 EEEVMIRSENITHNAKNILV 39703980399040004010 TTCAATTCAATACTCCAGTCCAGATCAATTGCACAAGGCCTAATAATAATACCAGAAAGA < 4080 QFNTPVQIMCTRPKNNTRKS 40304040405040604070 GTATAAGAATTGGGCCAGGACAGGCATTCTATGCAACAGGAGATATAATCGGAGACATTC < 4140 IRIGPGQAFYATGDIIGDIR 40904100411041204130 GACAAGCGCACTGCACTGTTTCTAAGGCCACTTGGAATGAAACATTGGGTAAAGTTGTAA < 4200 QAHCTVSKATWNETLGKVVK 41504160417041804190 AGCAACTTCGGAAGCATTTCGGAAATAACACAATTATTAGATTTGCGAACTCATCTGGAG < 4260 QLRKHFGNKTIIRFASSSGG 42104220423042404250 >Env.BG505immunogen | GGGATCTGGAAGTGACAACACACTCTTTCAATTGCGGTGGCGAGTTCTTCTATTGTAATA < 4320 DLEVTTHSFKCGGEFFYCKT 42704280429043004310 CAAGTGGATTATTTAACTCTACTTGGATTTCAAATACCTCAGTCCAAGGATCTAATTCAA < 4380 SGLFNSTWISHTSVQGSNST 43304340435043604370 CAGGGTCTAACGATTCTATAACATTACCTTGCCGTATAAAGCAAATTATTAATATGTGGC < 4440 GSNDSITLPCRIKQIINKWQ 43904400441044204430 AAAGAATCGGGCAAGCGATGTATGCTCCACCTATTCAAGGCGTGATTCGTTGCGTTTCAA < 4500 HIGQAMYAPPIQGVIRCVSN 44504460447044804490 ACATAACAGGGTTGATCCTGACCAGGGATGGAGGCTCTACCAATTCCACCACCGAGACCT < 4560 ITGLILTRDQQSTNSTTETF 45104520453045404550 TCCGTCCCGGTGGCGGAGATATGCGGGATAACTGGAGATCAGAGCTCTATAAGTATAAGG < 4620 RPGGGDHRDSWRSELYKYKV 45704580459046004610 TTGTGAAGATTGAACCTCTTGGAGTTGCCCCTACAAGAGCAAAGAGAAGGGTGGTTGGCC < 4680 VKIEPLGVAPTRAKRRVVGR 46304640465046604670 GAGAGAAGAGAGCAGTTGGCATCGGTGCTGTCTTTCTCGGATTTCTTGGAGCAGCTGGAT < 4740 EKRAVGIGAVFLGFLGAAGS 46904700471047204730 CCACTATGGGAGCAGCATCAATGACACTAACAGTGCAGGCTAGAAATTTGCTTAGCGGAA < 4800 TMGAASMTLTVQARNLLSGI 47504760477047804790 TCGTTCAGCAGCAGAGCAATTTACTAAGAGCAATTGAAGCACAGCAACATCTCTTAAAGT < 4860 VQQQSNLLRAIEAQQHLLKL 48104820483048404850 TCACGGTGTGGGGCATTAAACAACTACAAGCGAGAGTGCTTGCCGTCGAAAGATATTTGC < 4920 TVWGIKQLQARVLAVERYLR 48704880489049004910 GAGACCAACAGCTATTGGGTATTTGGGGTTGTTCTGGGAAATTAATTTGCACAACAAATG < 4980 DQQLLGIWGCSGKLICTTNV 49304940495049604970 TTCCATGGAACTCCTCCTGGAGTAATAGGAATTTAAGTGAGATATGGGACAACATGACAT < 5040 PWWSSWSNRNLSEIWBNMTW 49905000501050205030 GGTTGCAGTGGGACAAGGAAATCTCAAATTATACACAGATAATCTATGGATTATTAGAAG < 5100 LQWDKEISNYTQIIYGLLEE 50505060507050805090 AGTCTCAGAATCAGCAAGAGAAGAATGAACAGGATTTGCTTGCATTGGATAAGTGGGCTT < 5160 SQNQQEKNEQDLLALDKWAS 51105120513051405150 CTCTATGGAACTGGTTCGATATTAGTAATTGGCTCTGGTATATTAAGAGCTCTATTGCCT < 5220 LKNWFDISHWLWYIKSSIAS 51705180519052005210 CTTTTTTCTTTATCATAGGGTTAATCATTGGACTATTCTTGGTTCTCCGAGTTGGTATTT < 5280 FFFIIGLIIGLFLVLRVGIY 52305240525052605270 ATCTTTGCATTAAATTAAAGCACACCAAGAAAAGACAGATTTATACAGACATAGAGATGA < 5340 LCIKLRHTKKHQIYTDIEMN 52905300531053205330 ACCGACTTGGAAAGTAAAGCTCAAATCCTGCACAACAGATTCTTCATGTTTGAACCAAAT < 5400 RLGK* 53505360537053805390 CAACTTGTGATATCATGCTCAAAGAGGCCTTAATTAAATTTTAATTTTTAATTTTTATGA < 5460 54105420543054405450 AAAAAACTAACAGCAATCATGGAAGTCCACGATTTTGAGACCGACGAGTTCAATGATTTC < 5520 54705480549055005510 AATGAAGATGACTATGCCACAAGAGAATTCCTGAATCCCGATGAGCGCATGACGTACTTG < 5580 55305540555055605570 AATCATGCTGATTACAATTTGAATTCTCCTCTAATTAGTGATGATATTGACAATTTGATC < 5640 55905600561056205630 AGGAAATTCAATTCTCTTCCGATTCCCTCGATGTGGGATAGTAAGAACTGGGATGGAGTT < 5700 56505660567056805690 CTTGAGATGTTAACATCATGTCAAGCCAATCCCATCTCAACATCTCAGATGCATAAATGG < 5760 57105720573057405750 ATGGGAAGTTGGTTAATGTCTGATAATCATGATGCCAGTCAAGGGTATAGTTTTTTACAT < 5820 57705780579058005810 GAAGTGGACAAAGAGGCAGAAATAACATTTGACGTGGTGGAGACCTTCATCCGCGGCTGG < 5880 58305840585058605870 GGCAACAAACCAATTGAATACATCAAAAAGGAAAGATGGACTGACTCATTCAAAATTCTC < 5940 58905900591059205930 GCTTATTTGTGTCAAAAGTTTTTGGACTTACACAAGTTGACATTAATCTTAAATGCTGTC < 6000 59505960597059805990 TCTGAGGTGGAATTGCTCAACTTGGCGAGGACTTTCAAAGGCAAAGTCAGAAGAAGTTCT < 6060 60106020603060406050 CATGGAACGAACATATGCAGGCTTAGGGTTCCCAGCTTGGGTCCTACTTTTATTTCAGAA < 6120 60706080609061006110 GGATGGGCTTACTTCAAGAAACTTGATATTCTAATGGACCGAAACTTTCTGTTAATGGTC < 6180 61306140615061606170 AAAGATGTGATTATAGGGAGGATGCAAACGGTGCTATCCATGGTATGTAGAATAGACAAC < 6240 61906200621062206230 CTGTTCTCAGAGCAAGACATCTTCTCCCTTCTAAATATCTACAGAATTGGAGATAAAATT < 6300 62506260627062806290 GTGGAGAGGCAGGGAAATTTTTCTTATGACTTGATTAAAATGGTGGAACCGATATGCAAC < 6360 63106320633063406350 TTGAAGCTGATGAAATTAGCAAGAGAATCAAGGCCTTTAGTCCCACAATTCCCTCATTTT < 6420 63706380639064006410 GAAAATCATATCAAGACTTCTGTTGATGAAGGGGCAAAAATTGACCGAGGTATAAGATTC < 6480 64306440645064606470 CTCCATGATCAGATAATGAGTGTGAAAACAGTGGATCTCACACTGGTGATTTATGGATCG < 6540 64906500651065206530 TTCAGACATTGGGGTCATCCTTTTATAGATTATTACGCTGGACTAGAAAAATTACATTCC < 6600 65506560657065806590 CAAGTAACCATGAAGAAAGATATTGATGTGTCATATGCAAAAGCACTTGCAAGTGATTTA < 6660 66106620663066406650 GCTCGGATTGTTCTATTTCAACAGTTCAATGATCATAAAAAGTGGTTCGTGAATGGAGAC < 6720 66706680669067006710 TTGCTCCCTCATGATCATCCCTTTAAAAGTCATGTTAAAGAAAATACATGGCCTACAQCT < 6780 67306740675067606770 GCTCAAGTTCAAGATTTTGGAGATAAATGGCATGAACTTCCGCTGATTAAATGTTTTGAA < 6840 67906800681068206830 ATACCCGACTTACTAGACCCATCGATAATATACTCTGACAAAAGTCATTCAATGAATAGG < 6900 68506860687068806890 TCAGAGGTGTTGAAACATGTCCGAATGAATCCGAACACTCCTATCCCTAGTAAAAAGGTG < 6960 69106920693069406950 TTGCAGACTATGTTGGACACAAAGGCTACCAATTGGAAAGAATTTCTTAAAGAGATTGAT < 7020 69706980699070007010 GAGAAGGGCTTAGATGATGATGATCTAATTATTGGTCTTAAAGGAAAGGAGAGGGAACTG < 7080 70307040705070607070 AAGTTGGCAGGTAGATTTTTCTCCCTAATGTCTTGGAAATTGCGAGAATACTTTGTAATT < 7140 70907100711071207130 ACCGAATATTTGATAAAGACTCATTTCGTCCCTATGTTTAAAGGCCTGACAATGGCGGAC < 7200 71507160717071807190 GATCTAACTGCAGTCATTAAAAAGATGTTAGATTCCTCATCCGGCCAAGGATTGAAGTCA < 7260 72107220723072407250 TATGAGGCAATTTGCATAGCCAATCACATTGATTACGAAAAATGGAATAACCACCAAAGG < 7320 72707280729073007310 AAGTTATCAAACGGCCCAQTGTTCCGAGTTATGGGCCAGTTCTTAGGTTATCCATCCTTA < 7380 73307340735073607370 ATCGAGAGAACTCATGAATTTTTTGAGAAAAGTCTTATATACTACAATGGAAGACCAGAC < 7440 73907400741074207430 TTGATGCGTGTTCACAACAACACACTGATCAATTCAACCTCCCAACQAGTTTGTTGGCAA < 7500 74507460747074807490 GGACAAGAGGGTGGACTGGAAGGTCTACGGCAAAAAGGATGGAGTATCCTCAATCTACTG < 7560 75107520753075407550 GTTATTCAAAGAGAGGCTAAAATCAGAAACACTGCTGTCAAAGTCTTGGCACAAGGTGAT < 7620 75707580759076007610 AATCAAGTTATTTGCACACAGTATAAAACGAAGAAATCGAGAAACGTTGTAGAATTACAG < 7680 76307640765076607670 GGTGCTCTCAATCAAATGGTTTCTAATAATGAGAAAATTATGACTGCAATCAAAATAGGG < 7740 76907700771077207730 ACAGGGAAGTTAGGACTTTTGATAAATGACGATGAGACTATGCAATCTGCAGATTACTTG < 7800 77507760777077807790 AATTATGGAAAAATACCGATTTTCCGTGGAGTGATTAGAGGGTTAGAGACCAAGAGATGG < 7860 78107820783078407850 TCACGAGTGACTTGTGTCACCAATGACCAAATACCCACTTGTGCTAATATAATGAGCTCA < 7920 78707880789079007910 GTTTCCACAAATGCTCTCACCGTAGCTCATTTTGCTGAGAACCCAATCAATGCCATGATA < 7980 79307940795079607970 CAGTACAATTATTTTGGGACATTTGCTAGACTCTTGTTGATGATGCATGATCCTGCTCTT < 8040 79908000801080208030 CGTCAATCATTGTATGAAGTTCAAGATAAGATACCGGGCTTGCACAGTTCTACTTTCAAA < 8100 80508060807080808090 TACGCCATGTTGTATTTGGACCCTTCCATTGGAGGAGTGTCGGGCATGTCTTTGTCCAGG < 8160 81108120813081408150 TTTTTGATTAGAGCCTTCCCAGATCCCGTAACAGAAAGTCTCTCATTCTGGAGATTCATC < 8220 81708180819082008210 CATGTACATGCTCGAAGTGAGCATCTGAAGGAGATGAGTGCAGTATTTGGAAACCCCGAG < 8280 82308240825082608270 ATAGCCAAGTTCCGAATAACTCACATAGACAAGCTAGTAGAAGATCCAACCTCTCTGAAC < 8340 82908300831083208330 ATCGCTATGGGAATGAGTCCAGCGAACTTGTTAAAGACTGAGGTTAAAAAATGCTTAATC < 8400 83508360837083808390 GAATCAAGACAAACCATCAGGAACCAGGTGATTAAGGATGCAACCATATATTTGTATCAT < 8460 84108420843084408450 GAAGAGGATCGGCTCAGAAGTTTCTTATGGTCAATAAATCCTCTGTTCCCTAGATTTTTA < 8520 84708480849085008510 AGTGAATTCAAATCAGGCACTTTTTTGGGAGTCGCAGACGGGCTCATCAGTCTATTTCAA < 8580 85308540855085608570 AATTCTCGTACTATTCGGAACTCCTTTAAGAAAAAGTATCATAGGGAATTGGATGATTTG < 8640 85908600861086208630 >L | ATTGTGAGGAGTGAGGTATCCTCTTTGACACATTTAGGGAAACTTCATTTGAGAAGGGGA < 8700 86508660867086808690 TCATGTAAAATGTGGACATGTTCAGCTAGTCATGCTGACACATTAAGATACAAATCCTGG < 8760 87108720873087408750 GGCCGTACAGTTATTGGGACAACTGTACCCCATCCATTAGAAATGTTGGGTCCACAACAT < 8820 87708780879088008810 CGAAAAGAGACTCCTTGTGCACCATGTAACACATCAGGGTTCAATTATGTTTCTGTGCAT < 8880 88308840885088608870 TGTCCAGACGGGATCCATGACGTCTTTAGTTCACGGGGACCATTGCCTGCTTATCTAGGG < 8940 88908900891089208930 TCTAAAACATCTGAATCTACATCTATTTTGCAGCCTTGGGAAAGGGAAAGCAAAGTCCCA < 9000 89508960897089808990 CTGATTAAAAGAGCTACACGTCTTAGAGATGCTATCTCTTGGTTTGTTGAACCCGACTCT < 9060 90109020903090409050 AAACTAGCAATGACTATACTTTCTAACATCCACTCTTTAACAGGCGAAGAATGGACCAAA < 9120 90709080909091009110 AGGCAGCATGGGTTCAAAAGAACAGGGTCTGCCCTTCATAGGTTTTCGACATCTCGGATG < 9180 91309140915091609170 AGCCATGGTGGGTTCGCATCTCAGAGCACTGCAGCATTGACCAGGTTGATGGCAACTACA < 9240 91909200921092209230 GACACCATGAGGGATCTGGGAGATCAGAATTTCGACTTTTTATTCCAAGCAACGTTGCTC < 9300 92509260927092809290 TATQCTCAAATTACCACCACTGTTGCAAGAGACGGATGGATCACCAGTTGTACAGATCAT < 9360 93109320933093409350 TATCATATTGCCTGTAAGTCCTGTTTGAGACCCATAGAAGAGATCACCCTGGACTCAAGT < 9420 93709380939094009410 ATGGACTACACGCCCCCAGATGTATCCCATGTGCTGAAGACATGGAGGAATGGGGAAGGT < 9480 94309440945094609470 TCGTGGGGACAAGAGATAAAACAGATCTATCCTTTAGAAGGGAATTGGAAGAATTTAGCA < 9540 94909500951095209530 CCTGCTGAGCAATCCTATCAAGTCGGCAGATGTATAGGTTTTCTATATGGAGACTTGGCG < 9600 95509560957095809590 TATAGAAAATCTACTCATGCCGAGGACAGTTCTCTATTTCCTCTATCTATACAAGGTCGT < 9660 96109620963096409650 ATTAGAGGTCGAGGTTTCTTAAAAGGGTTGCTAGACGGATTAATGAGAGCAAGTTGCTGC < 9720 96709680969097009710 CAAGTAATACACCGGAGAAGTCTGGCTCATTTGAAGAGGCCGGCCAACGCAGTGTACGGA < 9780 97309740975097609770 GGTTTGATTTACTTGATTGATAAATTGAGTGTATCACCTCCATTCCTTTCTCTTACTAGA < 9840 97909800981098209830 TCAGGACCTATTAGAGACGAATTAGAAACGATTCCCCACAAGATCCCAACCTCCTATCCG < 9900 98509860987098809890 ACAAGCAACCGTGATATGGGGGTGATTGTCAGAAATTACTTCAAATACCAATGCCGTCTA < 9960 99109920993099409950 ATTGAAAAGGGAAAATACAGATCACATTATTCACAATTATGGTTATTCTCAGATGTCTTA < 10020 9970998099901000010010 TCCATAGACTTCATTGGACCATTCTCTATTTCCACCACCCTCTTGCAAATCCTATACAAG < 10080 1003010040100501006010070 CCATTTTTATCTGGGAAAGATAAGAATGAGTTGAGAGAGCTGGCAAATCTTTCTTCATTG < 10140 1009010100101101012010130 CTAAGATCAGGAGAGGGGTGGGAAGACATACATGTGAAATTCTTCACCAAGGACATATTA < 10200 1015010160101701018010190 TTGTGTCCAGAGGAAATCAGACATGCTTGCAAGTTCGGGATTGCTAAGGATAATAATAAA < 10260 1021010220102301024010250 GACATGAGCTATCCCCCTTGGGGAAGGGAATCCAGAGGGACAATTACAACAATCCCTGTT < 10320 1027010280102901030010310 TATTATACGACCACCCCTTACCCAAAGATGCTAGAGATGCCTCCAAGAATCCAAAATCCC < 10380 1033010340103501036010370 CTGCTGTCCGGAATCAGGTTGGGCCAATTACCAACTGGCGCTCATTATAAAATTCGGAGT < 10440 1039010400104101042010430 ATATTACATGGAATGGGAATCCATTACAGGGACTTCTTGAGTTGTGGAGACGGCTCCGGA < 10500 1045010460104701048010490 GGGATGACTGCTGCATTACTACGAGAAAATGTGCATAGCAGAGGAATATTCAATAGTCTG < 10560 1051010520105301054010550 TTAGAATTATCAGGGTCAGTCATGCGAGGCGCCTCTCCTGAGCCCCGCAGTGCCCTAGAA < 10620 1057010580105901060010610 ACTTTAGGAGGAGATAAATCGAGATGTGTAAATGGTGAAACATGTTGGGAATATCCATCT < 10680 1063010640106501066010670 GACTTATGTGACCCAAGGAGTTGGGACTATTTCCTCCGACTCAAAGCAGGCTTGGGGCTT < 10740 1069010700107101072010730 CAAATTGATTTAATTGTAATGGATATGGAAGTTCGGGATTCTTCTAGTAGCCTGAAAATT < 10800 1075010760107701078010790 GAGACGAATGTTAGAAATTATGTGCACCGGATTTTGGATGAGCAAGGAGTTTTAATCTAC < 10860 1081010820108301084010850 AAGACTTATGGAACATATATTTGTGAGAGCGAAAAGAATGCAGTAACAATCCTTGGTCCC < 10920 1087010880108901090010910 ATGTTCAAGACGGTCGACTTAGTTCAAACAGAATTTAGTAGTTCTCAAACGTCTGAAGTA < 10980 1093010940109501096010970 TATATGGTATGTAAAGGTTTGAAGAAATTAATCGATGAACCCAATCCCGATTGGTCTTCC < 11040 1099011000110101102011030 ATCAATGAATCCTGGAAAAACCTGTACGCATTCCAGTCATCAGAACAGGAATTTGCCAGA < 11100 1105011060110701108011090 GCAAAGAAGGTTAGTACATACTTTAGCTTGACAGGTATTCCCTCCCAATTCATTCCTGAT < 11160 1111011120111301114011150 CCTTTTGTAAACATTGAGACTATGCTACAAATATTCGGAGTACCCACGGGTGTGTCTCAT < 11220 1117011180111901120011210 GCGGCTGCCTTAAAATCATCTGATAGACCTGCAGATTTATTGACCATTAGCCTTTTTTAT < 11280 1123011240112501126011270 ATGGCGATTATATCGTATTATAACATCAATCATATCAGAGTAGGACCGATACCTCCGAAC < 11340 1129011300113101132011330 CCCCCATCAGATGGAATTGCACAAAATGTGGGGATCGCTATAACTGGTATAAGCTTTTGG < 11400 1135011360113701138011390 CTGAGTTTGATGGAGAAAGACATTCCACTATATCAACAGTGTTTAGCAGTTATCCAGCAA < 11460 1141011420114301144011450 TCATTCCCGATTAGGTGGGAGGCTGTTTCAGTAAAAGGAGGATACAAGCAGAAGTGGAGT < 11520 1147011480114901150011510 ACTAGAGGTGATGGGCTCCCAAAAGATAGCCGAATTTCAGACTCCTTGGCCCCAATCGGG < 11580 1153011540115501156011570 AACTGGATCAGATCTCTGGAATTGGTCCGAAACCAAGTTCGTCTAAATCCATTCAATGAG < 11640 1159011600116101162011630 ATCTTGTTCAATCAGCTATGTCGTACAGTGGATAATCATTTGAAATGGTCAAATTTGCGA < 11700 1165011660116701168011690 AAAAACACAGGAATGATTGAATGGATCAATAGACGAATTTCAAAAGAAGACCGGTCTATA < 11760 1171011720117301174011750 CTGATGTTGAAGAGTGACCTAGACGAGGAAAACTCTTGGAGAGATTAAAAAATCATGAGG < 11820 1177011780117901180011810 >VSVTrailer | AGACTCCAAACTTTAAGTATGAAAAAAACTTTGATCCTTAAGACCCTCTTGTGGTTTTTA < 11880 1183011840118501186011870 TTTTTTATCTGGTTTTGTGGTCTTCGTggccggcatggtcccagcctcctcgctggcgcc < 11940 1189011900119101192011930 >HepatitisDeltaVirusRibozyme | ggctgggcaacattccgaggggaccgtcccctcggtaatggcgaatgggacctgctaaca < 12000 1195011960119701198011990 aagcccgaaaggaagctgagttggctgctgccaccgctgagcaataactagcataacccc < 12060 1201012020120301204012050 ttggggcctctaaacgggtcttgaggggttttttgctgaaaggaggaactatatccggat < 12120 1207012080120901210012110 >T7Terminators | gcggccgatccggctgctaacaaagcccgaaaggaagctgagttggctgctgccaccgct < 12180 1213012140121501216012170 gagcaataactagcataaccccttggggcctctaaacgggtcttgaggggttttttgctg < 12240 1219012200122101222012230 aaaggaggaactatatccgggttaacctgcattaatgaatcggccaacgcgcggggagag < 12300 1225012260122701228012290 gcggtttgcgtattgggcgctcttccgcttcctcgctcactgactcgctgcgctcggtcg < 12360 1231012320123301234012350 ttcggctgcggcgagcggtatcagctcactcaaaggcggtaatacggttatccacagaat < 12420 1237012380123901240012410 caggggataacgcaggaaagaacatgtgagcaaaaggccagcaaaaggccaggaaccgta < 12480 1243012440124501246012470 aaaaggccgcgttgctggcgtttttccataggctccgcccccctgacgagcatcacaaaa < 12540 1249012500125101252012530 atcgacgctcaagtcagaggtggcgaaacccgacaggactataaagataccaggcgtttc < 12600 1255012560125701258012590 cccctggaagctccctcgtgcgctctcctgttccgaccctgccgcttaccggatacctgt < 12660 1261012620126301264012650 ccgcctttctcccttcgggaagcgtggcgctttctcaatgctcacgctgtaggtatctca < 12720 1267012680126901270012710 gttcggtgtaggtcgttcgctccaagctgggctgtgtgcacgaaccccccgttcagcccg < 12780 1273012740127501276012770 accgctgcgccttatccggtaactatcgtcttgagtccaacccggtaagacacgacttat < 12840 1279012800128101282012830 cgccactggcagcagccactggtaacaggattagcagagcgaggtatgtaggcggtgcta < 12900 1285012860128701288012890 cagagttcttgaagtggtggcctaactacggctacactagaaggacagtatttggtatct < 12960 1291012920129301294012950 gcgctctgctgaagccagttaccttcggaaaaagagttggtagctcttgatccggcaaac < 13020 1297012980129901300013010 aaaccaccgctggtagcggtggtttttttgtttgcaagcagcagattacgcgcagaaaaa < 13080 1303013040130501306013070 aaggatctcaagaagatcctttgatcttttctacggggtctgacgctcagtggaacgaaa < 13140 1309013100131101312013130 actcacgttaagggattttggtcatgagattatcaaaaaggatcttcacctagatccttt < 13200 1315013160131701318013190 >pSP72 | taaattaaaaatgaagttttaaatcaatctaaagtatatatgagtaaacttggtctgaca < 13260 1321013220132301324013250 gttaccaatgcttaatcagtgaggcacctatctcagcgatctgtctatttcgttcatcca < 13320 1327013280132901330013310 tagttgcctgactccccgtcgtgtagataactacgatacgggagggcttaccatctggcc < 13380 1333013340133501336013370 ccagtgctgcaatgataccgcgagacccacgctcaccggctccagatttatcagcaataa < 13440 1339013400134101342013430 accagccagccggaagggccgagcgcagaagtggtcctgcaactttatccgcctccatcc < 13500 1345013460134701348013490 agtctattaattgttgccgggaagctagagtaagtagttcgccagttaatagtttgcgca < 13560 1351013520135301354013550 acgttgttgccattgctacaggcatcgtggtgtcacgctcgtcgtttggtatggcttcat < 13620 1357013580135901360013610 tcagctccggttcccaacgatcaaggcgagttacatgatcccccatgttgtgcaaaaaag < 13680 1363013640136501366013670 cggttagctccttcggtcctccgatcgttgtcagaagtaagttggccgcagtgttatcac < 13740 1369013700137101372013730 tcatggttatggcagcactgcataattctcttactgtcatgccatccgtaagatgctttt < 13800 1375013760137701378013790 ctgtgactggtgagtactcaaccaagtcattctgagaatagtgtatgcggcgaccgagtt < 13860 1381013820138301384013850 gctcttgcccggcgtcaatacgggataataccgcgccacatagcagaactttaaaagtgc < 13920 1387013880138901390013910 tcatcattggaaaacgttcttcggggcgaaaactctcaaggatcttaccgctgttgagat < 13980 1393013940139501396013970 ccagttcgatgtaacccactcgtgcacccaactgatcttcagcatcttttactttcacca < 14040 1399014000140101402014030 gcgtttctgggtgagcaaaaacaggaaggcaaaatgccgcaaaaaagggaataagggcga < 14100 1405014060140701408014090 cacggaaatgttgaatactcatactcttcctttttcaatattattgaagcatttatcagg < 14160 1411014120141301414014150 gttattgtctcatgagcggatacatatttgaatgtatttagaaaaataaacaaatagggg < 14220 1417014180141901420014210 ttccgcgcacatttccccgaaaagtgccacctgacgtc < 14258 142301424014250

    TABLE-US-00003 Features: T7-g10 Promoter [1:49] Hammerhead Ribozyme [50:107] VSV Leader [108:170] N [171:1439] p [1503:2300] M [2360:3049] Env.BG505 immunogen [3198:5357] L [5479:11808] VSV Trailer [11809:11907] Hepatitis Delta Virus Ribozyme [11913:11991] T7 Terminators [11992:12260] pSP72 [12261:14258]

    TABLE-US-00004 SEQIDNO:2 [00001]embedded image 61hacvptdpnpqeihlenvteefnmwknnmveqmhtdiislwdqslkpcvkltplcvtlqc 121tnvtnnitddmrgelkncsfnmttelrdkkqkvyslfyrldvvqinenqgnrsnnsnkey 181rlincntsaitqacpkvsfepipihycapagfailkckdkkfngtgpcpsvstvqcthgi 241kpvvstql11ngslaeeevmirsenitnnaknilvqfntpvqinctrpnnntrksirigp 301gqafyatgdiigdirgahctvskatwnetlgkvvkqlrkhfgnntiirfanssggdlevt 361thsfncggeffycntsglfnstwisntsvqgsnstgsndsitlperikqiinmwqrigqa 421myappiqgvircvsnitgliltrdggstnsttetfrpgggdmrdnwrselykykvvkiep 481lgvaptrakrrvvgrekravgigavflgflgaagstmgaasmtltvgarnllsgivqqqs 541nllraieagqhllkltvwgikqlqarvlaverylrdqq11giwgcsgklicttnvpwnss 601wsnrnlseiwdnmtwlqwdkeisnytqiiyglleesqnqqekneqdllaldkwaslwnwf [00002]embedded image

    [0122] It is to be understood and expected that variations in the principles of invention as described above may be made by one skilled in the art and it is intended that such modifications, changes, and substitutions are to be included within the scope of the present invention.

    [0123] Although the present invention and its advantages have been described in detail, it should be understood that various changes, substitutions and alterations can be made herein without departing from the spirit and scope of the invention as defined in the appended claims.

    [0124] The present invention will be further illustrated in the following Examples which are given for illustration purposes only and are not intended to limit the invention in any way.

    Example 1: VSVG-Env.BG505 VaccineLive Attenuated VSV-HIV Chimera Delivering Env Trimers

    [0125] Vesicular stomatitis virus (VSV) has been modified to generate a live chimeric virus vaccine (VSVG-Env.BG505) for active immunization against HIV. The replication-competent recombinant chimera delivers a functional HIV Env glycoprotein trimer (clade A.BG505) in the context of viral replication mimicking native HIV spike presentation during an HIV infection.

    [0126] The VSVG-Env.BG505 chimera was constructed by replacing the natural VSV glycoprotein (G) gene with coding sequence for Env.BG505 (FIG. 1). As a result, Env is the only transmembrane glycoprotein encoded by the chimera, and virus propagation and spread is dependent on expression of functional Env trimers and infection of CD4+/CCR5+ cells.

    [0127] VSVG-Env.BG505 is generated from a VSV genomic DNA clone that was developed from a lab-adapted strain of VSV (Indiana serotype). The genomic sequence is similar, but not identical, to the VSV genomic clone developed at Yale University (1), which is used for other VSV-based vaccine candidates including the attenuated VSV-N4CT1 vector developed by Profectus and NIAID (2), and the VSVG-Ebola virus chimera developed by the National Microbiology Laboratory in Canada (3), NewLink Genetics, and Merck Vaccines (4-6). About 100 nucleotides out 11 kb differ between the Yale and IAVI genomic clones.

    [0128] Live VSVG-Env.BG505 is recovered from plasmid DNA by electroporating cells with the modified VSV genomic clone (FIG. 1C), a plasmid encoding T7 RNA polymerase to synthesize genomic RNA copies, and five plasmids that provide VSV polypeptides (N, P, M, G, L) in trans to initiate virus replication (9). The virus rescue protocol does not require proprietary transfection reagents or helper virus, and it has been optimized for use with Vero cell substrates (protocol adapted from (10, 11)). Recovery of infectious VSVG-Env.BG505 can be initiated by electroporating plasmids into Vero cells derived from a qualified cell bank (cells from Meridian Life Science, Inc. are used at IAVI), after which the virus must be propagated in cells that express CD4 and CCR5 to support Env-dependent replication. Thus, recombinant virus amplification, clonal isolation, virus seed preparation, and vaccine production is performed with a modified Vero cell line that contains the genes for human CD4 and CCR5 (VeroCD4/CCR5).

    [0129] Applicants developed a stable VeroCD4/CCR5 cell line for propagation of the VSVG-Env.BG505 chimera. The cell line used in the lab currently encodes human CD4 and CCR5 and was developed under research conditions starting with cells obtained from the Meridian Life Science qualified Vero cell bank. The research VeroCD4/CCR5 cell line is stable and has been used for several years to support work on VSVG-Env.BG505 and a number of similar chimeric viruses. Yields of VSVG-Env.BG505 produced in VeroCD4/CCR5 monolayers typically are >110.sup.7 pfus per ml of harvested culture medium. Work on deriving a new cell line has been initiated for the purpose of generating VeroCD4/CCR5 cells that will meet requirements associated with future VSVG-Env.BG505 cGMP manufacturing. As used herein, VeroCD4/CCR5 and VERT or VERT3 are used interchangeably.

    [0130] The VSVG-Env.BG505 vaccine tested in rhesus macaques contained pseudotyped (12) virus particles to enhance vaccine uptake and promote a vigorous initial round of infection and replication. When virus was grown to produce a batch of vaccine, infection was conducted under conditions in which the VSV G glycoprotein was transiently expressed in VeroCD4/CCR5 cells allowing production of particles containing G. An efficient laboratory method was developed to simplify addition of the G pseudotype. A suspension of VeroCD4/CCR5 cells is mixed with plasmid DNA encoding G and VSVG-Env.BG505 particles after which the mixture is subjected to electroporation. The electroporated cells are then distributed into cell factories containing culture medium. Virus is harvested and purified 48 hours post-electroporation.

    [0131] Two points about G pseudotyping and the VSVG-Env.BG505 vaccine are worth emphasizing. First, VSVG-Env.BG505 does not contain the G gene; thus, infected cells do not express G and the VSV glycoprotein is present only in pseudotyped virus particles used for vaccination. Following vaccination, progeny VSVG-Env.BG505 particles produced by the first round of replication will lack the G glycoprotein making all subsequent rounds of infection dependent on HIV Env and infection of CD4+/CCR5+ cells of lymphoid origin. Because G is present only transiently (FIG. 2), it cannot promote spread of infection to other types of cells and tissues (i.e. neurons in the central nervous system).

    [0132] The second point is related to the benefit of the pseudotyping. It is well established that G is a very effective virus attachment protein, which has been used to pseudotype a variety of different candidate viral vaccines, gene therapy vectors, and oncolytic agents (12-15). A positive effect of pseudotyping on immunogenicity of a prototype VSVG-SIV Env chimera was demonstrated experimentally in a small pilot macaque study in which animals were vaccinated mucosally (combination of oral and nasal cavity) with a vaccine prepared with and without a G pseudotype. In animals vaccinated with pseudotyped virus particles, anti-SIV Env antibody titers were greater than 100-fold higher (FIG. 5). Moreover, the transient exposure to G in the virus inoculumn did not elicit significant titers of anti-G antibodies (data not shown).

    [0133] Many different glycoproteins may be used to pseudotype VSV particles besides G. Alternative pseudotypes may be useful for targeting vaccine delivery to different areas. Examples include F plus H from morbilliviruses, the F and HN from various parainfluenza viruses, the F and G from various pneumoviruses, the F plus HN from various rubulla viruses. Also, the glycorpteins from filoviruses or arena viruses, among others.

    [0134] Although the efficacious VSVG-Env.BG505 vaccine was a pseudotyped particle, it is important to note that studies have not yet been done in macaques to assess whether pseudotyping contributes to vaccine efficacy. Furthermore, G was selected for pseudotyping because it was known to be highly effective, but other alternative viral glycoproteins can be used if it becomes necessary to develop a pseudotyped vaccine that targets a more limited cell population.

    [0135] The VSVG-Env.BG505 vaccine was designed to deliver authentic HIV envelope (Env) trimers mimicking the presentation of Env spikes by HIV infection or a live attenuated HIV vaccine. As designed, the replication competent chimeric virus provides several important immunostimulants once administered, including: 1) innate signaling initiated by infection and replication of an RNA virus; 2) infected cells containing Env incorporated in the cell surface membrane; and 3) progeny virus particles containing Env spikes arrayed on their surface. Moreover, like HIV or SIV, Env-dependent VSVG-Env.BG505 propagation in vivo might contribute to vaccine efficacy by providing more persistent antigen exposure and immune stimulation that is associated with infection occurring in lymphoid tissues (16, 17).

    [0136] VSVG-Env.BG505 is designed to propagate using Env as its attachment and entry protein. This has several important consequences during chimeric virus replication in the vaccinee, including: 1) there is strong selective pressure to maintain the gene encoding functional Env; 2) it ensures that the replicating chimeric virus will present the immune system with authentic Env spike targets; and 3) because Env is functional and incorporated in the membrane, it has the conformational flexibility of a native spike and will expose the immune system with a full range of authentic antigenic determinants. Related to the last point, it also is important to emphasize that the functional Env.BG505 trimer expressed by VSVG-Env.BG505 is not a conformationally constrained trimer like some other experimental vaccines that have been develop recently like Env.BG505 SOSIP or Env.BG505 NFL described by others (18, 19).

    [0137] Rose and colleagues first demonstrated that it was feasible to generate an infectious VSVG-Env chimera using a clade B Env (23), but additional development was necessary to advance an effective vaccine candidate. First, the Env.BG505 immunogen was selected specifically because it was known to have a broad antigenicity profile (24) and it was isolated from an infected infant that produced bnAbs (25, 26). Second, it was necessary to investigate Env modifications for a number of reasons, including 1) to ensure Env gene genetic stability; 2) to enable vigorous replication in cell culture that would support vaccine production; and 3) to substantially increase Env incorporation into to the infected cell membrane and virus particle to provide improved display of Env spike immunogens. Following an approached suggested by earlier data showing that the Env cytoplasmic tail caused vector genetic instability (unpublished and (27)) and suppressed incorporation into VSV particles (28), a number of hybrid Envs were designed and evaluated (FIG. 3) in which various combinations of the Env signal peptide (SP), transmembrane (TM) region, and cytoplasmic tail (CT) were replaced with sequence from VSV G (Indiana serotype). A hybrid Env containing the VSV G SP, TM and CT was found to be expressed abundantly on the cell surface of transfected cells and also was found to support efficient Env-dependent replication of the VSVG-Env.BG505 chimera in CD4+/CCR5+ cells. A hybrid in which the Env membrane-proximal external region (MPER) also was replaced with the analogous Stem domain of G was expressed in modestly greater quantities on the surface of transfected cells, but since it lacked the important Env MPER epitope, all subsequent vector design has focused on the Env hybrids where the SP, TM, and CT are substituted with VSV G sequences. Therefore, the VSVG-Env.BG505 vaccine encodes a highly expressed Env-G hybrid, which is designed so that all sequence displayed on the membrane surface is Env ectodomain while intracellular and membrane-spanning sequences are derived from G.

    [0138] The Env-G hybrid immunogen incorporated on the surface of infected cells and VSVG-Env.BG505 particles is broadly antigenic. An example of infected cells analyzed by flow cytometry (FIG. 4B) shows that multiple mAbs bind the cell surface including PGT145, PGT151 and VRC06, which bind preferentially to determinants formed by well-ordered trimmers (19, 21, 22). Similarly, bnAbs recognize purified virions when they are adsorbed to alum and the alum-virus complexes are analyzed by flow cytometry (FIG. 4D), which agrees with electron microscope images (FIG. 4C) showing surface density consistent with the present of glycoprotein complexes on the surface of VSVG-Env.BG505 particles.

    [0139] Part of the vaccine design objective was to develop a chimeric virus that could be administered effectively by a mucosal route to stimulate immune protection at the mucosal barrier. Even though a mucosal barrier is advantageous, Applicants do not envision the vaccine to be limited to this route of administration. Because research and development on lentivirus virus vectors has shown that Env is not an effective attachment protein for virus particle delivery, VSVG-Env.BG505 modifications were considered that might significantly improve virus uptake without changing the key feature of the chimeric virus, which is its unique design in which Env is the sole glycoprotein expressed following infection. Thus, rather than genetically modifying the VSVG-Env.BG505 vector further, a decision was made to test vaccines in which the virus particles were prepared with a G pseudotype, as a considerable body of work on lentiviruses (12) as well as a variety of chimeric VSV vectors (29) showed that pseudotyping with G was effective.

    [0140] To support testing of a pseudotyped VSVG-Env vaccine, a simple system was developed to add G to virus particles. Briefly, a suspension of VeroCD4/CCR5 cells is mixed with plasmid DNA encoding G and VSVG-Env.BG505 particles and then mixture is subjected to electroporation. The electroporated cell suspension is then distributed into cell stacks and cultured for 48 hours after which pseudotyped virus particles are harvested and purified. The efficiency of pseudotyping can then be quantified by evaluating plaque formation on CD4+/CCR5+ cell monolayers in which Env or G can direct infection, and comparing this to G-mediated infection of standard Vero monolayers, which support a single-cycle of infection that can be quantified by immunostaining to detect individual cells expressing viral proteins.

    [0141] A pilot study was conducted in Indian rhesus macaques with a prototype VSVG-SIV chimera (FIG. 5A, VSVG-SIV-GagEnv). Macaques were used for this early study because transgenic or humanized small animal models that can support replication of a CD4/CCR5-tropic virus have limitations. The macaque study was conducted for three primary reasons: 1) assess the ability to safely vaccinate mucosally in the nasal and oral cavity with a chimeric virus; 2) detect and quantify serum anti-Env antibodies elicited by mucosal vaccination; and 3) compare vaccines prepared with and without a G pseudotype.

    [0142] Macaques were vaccinated (FIG. 5B) at weeks 0 and 6 by applying virus solution to the nasal and oral cavities (110.sup.8 pfus per site). Importantly, animal behavior was normal following vaccination and no lesions were observed in or around the nose or mouth. Quantification of antibody titers by bioplex assay (30) showed that the chimeric virus vaccines were immunogenic and that the pseudotyped vaccine was significantly more potent. Following the first vaccination, samples analyzed at week 6 showed that the pseudotyped VSVG-SIV-GagEnv vaccine elicited low but detectable antibody titers, while animals vaccinated with an empty VSV vector or the chimeric virus lacking the G pseudotype had values near baseline. Env antibody titers increased after homologous boost at week 6, and it was clear that the peak titer elicited by the pseudotyped chimera was considerably stronger (>1,000) compared to the magnitude of the response generated by the vaccine lacking the G pseudotype, and the titers also remained substantial >2.5 months after the week-6 boost. It also is worth highlighting that two mucosal vaccinations with the pseudotyped VSVG-SIV-GagEnv vaccine generated antibody titers that were in the same range as peak responses seen with a relatively potent vaccination regimen based on 3DNA-SIV-Env prime (intramuscular electroporation) and Ad5-SIV Env (intramuscular) boost (31).

    [0143] Several conclusions were drawn from this pilot study. First, the chimeric virus vaccine was able to safely elicit anti-Env antibodies against a membrane anchored Env spike. Second, antibody titers of this magnitude elicited by mucosal vaccination indicated that the VSVG-SIV chimera replicated following vaccination and that the antibody response was not elicited simply by exposure to the virus particles delivered in a buffered solution. This assumption also is consistent with the fact that G in the pseudotyped particles did not elicit an anti-G response significantly above background in an ELISA (data not shown). Finally, it was evident that the chimeric virus vaccine prepared with the G pseudotype was more potent, thus the HIV vaccine based on VSVG-Env.BG505 was advanced for testing in macaques as a pseudotyped vaccine.

    [0144] The preclinical efficacy of the VSVG-Env.BG505 vaccine prepared with a G pseudotype is being evaluated in Indian rhesus macaques using the rectal SHIV challenge model. The study was designed with the three main objectives: 1) show that the VSVG-Env.BG505 chimera could be administered safely to the nasal and oral cavities; 2) demonstrate that vaccination elicits anti-Env antibodies; and 3) establish that vaccination provides measurable protection from rectal exposure with a heterologous clade B SHIV (SHIV SF162p3).

    [0145] The study also included a head-to-head comparison with a second VSV vector encoding the same Env.BG505 trimer immunogen. The main purpose of this comparison was to evaluate an alternative Env.BG505 delivery vector (VSV-G6-Env.BG505, FIG. 6) that would have increased replicative capacity in vivo. To achieve greater replicative capacity, the VSV-G6-Env.BG505 vector was designed to contain genes encoding Env.BG505 and G; therefore, the vector coexpresses the glycoproteins in infected cells, and incorporate both trimeric complexes in virus particles. As designed, the VSV-G6-Env.BG505 vector can propagate and spread in a wider range of cells in vivo because the continuous expression of G allows infection and spread into a much broader range of cell types. Thus, both the pseudotyped VSVG-Env.BG505 chimera and VSV-G6-Env.BG505 can infect most cell types at the site of vaccine administration using G, but after the initial round of replication, secondary infection initiated by progeny virus particles will be significantly different, with the VSVG-Env.BG505 targeted specifically to CD4+/CCR5+ cells and VSV-G6-Env.BG505 being able to spread into multiple cell types.

    [0146] The preclinical efficacy study was designed with three groups of 10 macaques (negative for Mamu-B*08 and -B*17 MHC alleles associated with immune control) that were vaccinated at weeks 0, 4, and 29 with pseudotyped VSVG-Env.BG505, VSV-G6-Env.BG505 or a saline control. It is important to highlight that vaccination was conducted only with the live VSV vectors, and no boost was performed with a heterologous vaccine. Vaccines were administered by application to mucosal surfaces in the nasal and oral cavity of sedated animals (110.sup.8 pfus per site). No local lesions were observed and all macaques behaved normally after vaccination.

    [0147] All macaques immunized with a VSV-based Env.BG505 vaccine developed detectable anti-Env serum antibodies after the second vaccination. The third vaccination at week 29 provided a boost, and perhaps more importantly, increased the durability of the antibody titiers, which persisted during the 5-month rest period before challenge in 8 out of 10 macaques vaccinated with VSVG-Env.BG505 and all animals vaccinated with VSV-G6-Env.BG505. The TZM-bl assay (33) also was used to analyse serum for virus-neutralizing antibodies (nAbs). The resulted showed that nAb titers were low (titers 100) and were detectable in only some vaccinated animals (summarized on the ELISA chart in FIG. 8). In macaques vaccinated with the VSVG-Env.BG505 chimera, 4 animals were positive for nAbs active against HIV SF162p3 pseudovirus at week 31, but the titers waned to undetectable by the day of SHIV challenge. Vaccination with VSV-G6-Env.BG505 elicited nAbs against SF162p3 and homologous BG505 pseudovirus that were detectable at week 31 and 48, but not in all animals.

    [0148] Clade B SHIV SF162p3 challenge commenced at week 48, which was about 5 months after the final vaccination (FIG. 7). The challenge protocol was composed of 3 stages: the first 5 rectal exposures conducted approximately every two weeks, a 6-week rest period, and the final 5 biweekly exposures. Macaques with 200 genome SHIV copies per ml of plasma were considered infected after which challenge was stopped. All infected macaques were viremic for weeks following the initial infection (FIG. 9) as determined by detection of SHIV genomes in the blood, and accordingly, the infected animals developed antibodies against Gag expressed by the SHIV (data not shown).

    [0149] The SHIV infection rate was significantly reduced in macaques vaccinated with the VSVG-Env.BG505 chimera compared to animals vaccinated with VSV-G6-Env.BG505 or saline control (FIG. 10). Over the course of 9 challenges, 9 out of 10 macaques in the Control and VSV-G6-Env.BG505 groups became chronically infected with SHIV at a similar frequency. In contrast, in macaques vaccinated with VSVG-Env.BG505, just 3 were infected with challenge virus indicating that VSAG-Env.BG505 immunization significantly increased resistance to mucosal SHIV infection. Thus, vaccine efficacy as measured by prevention of rectal infection with a heterologous clade B SHIV was 67%.

    [0150] Immunologic assessment continues, but current results point to a potential relationship between the reduced frequency of infection seen in the animals vaccinated with the VSVG-Env.BG505 vaccine (FIG. 10) and Env-specific serum antibodies. First, both replication-competent VSV vectors elicited serum antibodies that persisted for the 5-month period between the final vaccination and the beginning of the repetitive SHIV challenge protocol (FIG. 8). In the animals vaccinated with VSVG-Env.BG505, there were 2 animals in which the antibody titers waned to baseline levels by week 48 when challenge commenced (FIG. 8), and interestingly, these were the same two animals that appeared least resistant in this group and became infected by challenge 2 (FIG. 10). The third animal that became infected in this group resisted 7 challenges conducted over a period of about 4.5 months, but became infected at exposure 8 by which time the serum antibody titers had waned. These results imply that there is a relationship between Env.BG505 gp120 binding antibody titers and SHIV infection resistance. This trend is summarized graphically in FIG. 11.

    [0151] In contrast to the results seen in animals vaccinated with the VSVG-Env.BG505 chimera, that rate of infection in macaques vaccinated with VSV-G6-Env.BG505 was very similar to the control group indicating that vaccination did not have measurable effect on SHIV infection frequency (FIG. 10). This was observed even though all animals had developed Env antibodies in response to vaccination, including some macaques that had nAbs (FIG. 8).

    [0152] Taken together, the results of vaccination with the different live VSV-based vectors show that both types of vaccine elicit Env antibodies, but that the quality of the antiviral immunity is very different. What is responsible for this difference in protection is not understood at this time, but perhaps it is related to antibody binding site specificity, the diversity of Env epitopes recognized, or IgG effector functions. Alternatively, the two live vectors might elicit different profiles of Env-specific T cells with antiviral activity that is affecting infection resistance. Ongoing and future immunologic assessment will help identify differences in the immune responses elicited by the two vaccines, which will provide guidance for vector and immunogen improvements.

    [0153] The results produced with two different replicating VSV-based vaccines also illustrates clearly that specific vaccine design details can have a pronounced effect on efficacy. Some of the unique features of the VSVG-Env.BG505 vaccine that might contribute to efficacy, include; 1) CD4+/CCR5+ tropism that targets replication to lymphoid cells and tissues; 2) chimeric virus propagation in vivo that is dependent on expression of functional Env and will provide immune system exposure to authentic Env spikes; 3) the only glycoprotein expressed is Env, thus there is no other competing glycoprotein immunogen that might dominate immune responses; and 4) the lack of other vector-encoded glycoproteins eliminates development of potent anti-vector antibodies that might interfere with multiple immunizations.

    [0154] Preclinical efficacy in the SHIV challenge model was observed following mucosal vaccination with a total dose of 210.sup.8 pfu per ml. The vaccine dose was split between two sites. Mucosal surfaces in the nasal and oral cavities each received 110.sup.8 pfu applied in a buffered solution.

    [0155] Preclinical efficacy in the SHIV challenge model was observed with a vaccination schedule of 0, 4, and 29 weeks. Other vaccination schedules are also contemplated.

    [0156] Mucosal vaccination in the nasal and oral cavity was tested primarily because the goal was to stimulate enhanced mucosal immunity. Other considerations supporting this vaccination route included: 1) providing access to submucosal CD4+/CCR5+ lymphocytes that would be targets for VSVG-Env.BG505 replication, and 2) VSV naturally infects these mucosal sites.

    [0157] VSVG-Env.BG505 is a recombinant chimeric virus based on the VSV Indiana serotype. The VSV G gene deleted and replaced with sequence encoding functional HIV Env.BG505. The live vaccine is replication competent and propagates specifically in cells that contain the CD4/CCR5 receptors.

    [0158] The efficacious preclinical vaccine is a G-pseudotyped VSVG-Env.BG505 that is applied to nasal and oral cavity mucosal surfaces at 0, 4, and 29 weeks.

    [0159] The VSVG-Env.BG505 vaccine is expected to be safe for use in humans, because 1) no observable adverse reactions occurred in vaccinated macaques, and 2) the chimeric virus design makes propagation dependent on Env, thus virus spread in vivo is restricted to lymphoid cell and tissues that express CD4 and CCR5 and will prevent virus replication in other sites like the central nervous system.

    [0160] The preferred cell line for vaccine production is VeroCD4/CCR5, which has been used to support preclinical development of the VSVG-Env.BG505 chimeric virus vaccine. A similar cell line must be rederived using conditions and materials that are consistent with using the cells for vaccine manufacturing. Manufacturing processes and steps are set forth in FIG. 12. Preparation of VSVG-Env.BG505 with G pseudotype is set forth in FIG. 13.

    [0161] Preclinical material tested in macaques may be purified by 2 round of centrifugation through sucrose cushion and the method is based on tangential flow filtration.

    [0162] Preclinical vaccine material is stored frozen (80) in Hank's Balanced Salt Solution (HBSS) supplemented with 15% trehalose.

    [0163] Raw material and biological starting material suitability, quality, and characterization (e.g., passage history of cell substrate and viral seed material) may include: [0164] Recombinant VSVG-Env.BG505 is generated from a plasmid DNA containing a modified VSV genomic clone in which the G gene is replaced with sequence encoding HIV Env.BG505. Rescue of recombinant virus is initiated by electroporating the genomic clone with supporting plasmids that direct expression of VSV N, P, M, G, and L proteins and T7 phage RNA polymerase. [0165] The VSV genomic clone is based on the VSV Indiana serotype. [0166] The VeroCD4/CCR5 cell line used for preclinical development was generated starting with Vero cells from a cell bank qualified cell bank (obtained from Meridian Life Science, Inc). The VeroCD4/CCR5 cell line was generated by microporating cells with a plasmid that contains genes for expression of human CD4 and CCR5 and the Neo resistance marker. [0167] VeroCD4/CCR5 is typically propagated in monolayer cultures. Cell factories are used for virus production. The cells are grown in DMEM supplemented with 10% fetal bovine serum from certified suppliers. Virus amplification can be conducted in monolayers in which the medium is exchanged with serum-free growth medium such as VPSFM.

    [0168] Preclinical vaccine characterization may include: [0169] Potency: Virus is quantified by plaque assay on VeroCD4/CCR5 cells. To confirm virus particles are pseudotyped with G, standard Vero monolayers are infected and the single-cycle infection in incubated overnight. Monolayers are subsequently immunostained to quantify infected cells.

    [0170] Additional vaccine virus characterization: [0171] Genome copies (qPCR) per infectious unit [0172] Genomic nucleotide sequence [0173] Env insert integrity by PCR [0174] Env expression by Western blot [0175] Env expression detected on infected cells by flow cytometry and bnAbs [0176] Virus purity by denaturing gel electrophoresis and silver stain [0177] Mycoplasma testing by PCR [0178] Endotoxin testing

    [0179] Assay development required to support lot release or product characterization may include: [0180] Potencysee above, plaque assay and genome-to-pfu ratio [0181] Safety: [0182] Env insert integrity by PCR [0183] Lack of VSV G gene by PCR [0184] Genomic sequence [0185] Infection of Vero cells with pseudotyped virus and subsequent blind passage to confirm lack of CPE indicating that virus is CD4/CCR5-dependent as expected

    [0186] Preparation of reagents to develop assays may include: [0187] Primers and probes are available to assess genomic sequences, quantify genome copies, and specifically detect the Env gene insert. [0188] Antibodies that can neutralize the pseudotyped VSVG-Env.BG505 chimera are required for adventitious agent testing. Antibodies recognizing the G pseudotype block infection in eggs, mice, and most cell lines provided they do not express primate CD4/CCR5.

    REFERENCE CITATIONS

    [0189] 1. Lawson N D, Stillman E A, Whitt M A, Rose J K. Recombinant vesicular stomatitis viruses from DNA. Proceedings of the National Academy of Sciences of the United States of America. 1995; 92(10):4477-81. PubMed PMID: 7753828. [0190] 2. Clarke D K, Nasar F, Chong S, Johnson J E, Coleman J W, Lee M, Witko S E, Kotash C S, Abdullah R, Megati S, Luckay A, Nowak B, Lackner A, Price R E, Little P, Kalyan N, Randolf V, Javadian A, Zamb T J, Parks C L, Egan M A, Eldridge J, Hendry M, Udem S A. Neurovirulence and immunogenicity of attenuated recombinant vesicular stomatitis viruses in nonhuman primates. J Virol. 2014; 88(12):6690-701. doi: 10.1128/JVI.03441-13. PubMed PMID: 24696472; PubMed Central PMCID: PMC4054374. [0191] 3. Jones S M, Feldmann H, Stroher U, Geisbert J B, Fernando L, Grolla A, Klenk H D, Sullivan N J, Volchkov V E, Fritz E A, Daddario K M, Hensley L E, Jahrling P B, Geisbert T W. Live attenuated recombinant vaccine protects nonhuman primates against Ebola and Marburg viruses. Nature medicine. 2005; 11(7):786-90. PubMed PMID: 15937495. [0192] 4. Regules J A, Beigel J H, Paolino K M, Voell J, Castellano A R, Munoz P, Moon J E, Ruck R C, Bennett J W, Twomey P S, Gutierrez R L, Remich S A, Hack H R, Wisniewski M L, Josleyn M D, Kwilas S A, Van Deusen N, Mbaya O T, Zhou Y, Stanley D A, Bliss R L, Cebrik D, Smith K S, Shi M, Ledgerwood J E, Graham B S, Sullivan N J, Jagodzinski L L, Peel S A, Alimonti J B, Hooper J W, Silvera P M, Martin B K, Monath T P, Ramsey W J, Link C J, Lane H C, Michael N L, Davey R T, Jr., Thomas S J, r V-Z-GPSG. A Recombinant Vesicular Stomatitis Virus Ebola VaccinePreliminary Report. The New England journal of medicine. 2015. doi: 10.1056/NEJMoa1414216. PubMed PMID: 25830322. [0193] 5. Henao-Restrepo A M, Longini I M, Egger M, Dean N E, Edmunds W J, Camacho A, Carroll M W, Doumbia M, Draguez B, Duraffour S, Enwere G, Grais R, Gunther S, Hossmann S, Konde M K, Kone S, Kuisma E, Levine M M, Mandal S, Norheim G, Riveros X, Soumah A, Trelle S, Vicari A S, Watson C H, Keita S, Kieny M P, Rottingen J A. Efficacy and effectiveness of an rVSV-vectored vaccine expressing Ebola surface glycoprotein: interim results from the Guinea ring vaccination cluster-randomised trial. Lancet. 2015; 386(9996):857-66. doi: 10.1016/S0140-6736(15)61117-5. PubMed PMID: 26248676. [0194] 6. Agnandji S T, Huttner A, Zinser M E, Njuguna P, Dahlke C, Fernandes J F, Yerly S, Dayer J A, Kraehling V, Kasonta R, Adegnika A A, Altfeld M, Auderset F, Bache E B, Biedenkopf N, Borregaard S, Brosnahan J S, Burrow R, Combescure C, Desmeules J, Eickmann M, Fehling S K, Finckh A, Goncalves A R, Grobusch M P, Hooper J, Jambrecina A, Kabwende A L, Kaya G, Kimani D, Lell B, Lemaitre B, Lohse A W, Massinga-Loembe M, Matthey A, Mordmuller B, Nolting A, Ogwang C, Ramharter M, Schmidt-Chanasit J, Schmiedel S, Silvera P, Stahl F R, Staines H M, Strecker T, Stubbe H C, Tsofa B, Zaki S, Fast P, Moorthy V, Kaiser L, Krishna S, Becker S, Kieny M P, Bejon P, Kremsner P G, Addo M M, Siegrist C A. Phase 1 Trials of rVSV Ebola Vaccine in Africa and EuropePreliminary Report. The New England journal of medicine. 2015. doi: 10.1056/NEJMoa1502924. PubMed PMID: 25830326. [0195] 7. Barr J N, Whelan S P, Wertz G W. Transcriptional control of the RNA-dependent RNA polymerase of vesicular stomatitis virus. Biochim Biophys Acta. 2002; 1577(2):337-53. PubMed PMID: 12213662. [0196] 8. Wertz G W, Perepelitsa V P, Ball L A. Gene rearrangement attenuates expression and lethality of a nonsegmented negative strand RNA virus. Proceedings of the National Academy of Sciences of the United States of America. 1998; 95(7):3501-6. PubMed PMID: 9520395. [0197] 9. Rabinovich S, Powell R L, Lindsay R W, Yuan M, Carpov A, Wilson A, Lopez M, Coleman J W, Wagner D, Sharma P, Kemelman M, Wright K J, Seabrook J P, Arendt H, Martinez J, DeStefano J, Chiuchiolo M J, Parks C L. A novel, live-attenuated vesicular stomatitis virus vector displaying conformationally intact, functional HIV-1 envelope trimers that elicits potent cellular and humoral responses in mice. PLoS ONE. 2014; 9(9):e106597. doi: 10.1371/journal.pone.0106597. PubMed PMID: 25215861; PubMed Central PMCID: PMC4162551. [0198] 10. Witko S E, Johnson J E, Kalyan N K, Felber B K, Pavlakis G N, Sidhu M K, Hendry R M, Udem S A, Parks C L. Refined methods for propagating vesicular stomatitis virus vectors that are defective for G protein expression. J Virol Methods. 2010; 164(1-2):43-50. Epub 2009/11/28. doi: 10.1016/j.jviromet.2009.11.023. PubMed PMID: 19941901; PubMed Central PMCID: PMC2837098. [0199] 11. Witko S E, Kotash C S, Nowak R M, Johnson J E, Boutilier L A, Melville K J, Heron S G, Clarke D K, Abramovitz A S, Hendry R M, Sidhu M S, Udem S A, Parks C L. An efficient helper-virus-free method for rescue of recombinant paramyxoviruses and rhadoviruses from a cell line suitable for vaccine development. J Virol Methods. 2006; 135(1):91-101. PubMed PMID: 16569439. [0200] 12. Cronin J, Zhang X Y, Reiser J. Altering the tropism of lentiviral vectors through pseudotyping. Current gene therapy. 2005; 5(4):387-98. PubMed PMID: 16101513. [0201] 13. Levy C, Verhoeyen E, Cosset F L. Surface engineering of lentiviral vectors for gene transfer into gene therapy target cells. Curr Opin Pharmacol. 2015; 24:79-85. doi: 10.1016/j.coph.2015.08.003. PubMed PMID: 26298515. [0202] 14. Kahn J S, Roberts A, Weibel C, Buonocore L, Rose J K. Replication-competent or attenuated, nonpropagating vesicular stomatitis viruses expressing respiratory syncytial virus (RSV) antigens protect mice against RSV challenge. J Virol. 2001; 75(22):11079-87. PubMed PMID: 11602747. [0203] 15. Kapadia S U, Simon I D, Rose J K. SARS vaccine based on a replication-defective recombinant vesicular stomatitis virus is more potent than one based on a replication-competent vector. Virology. 2008; 376(1):165-72. PubMed PMID: 18396306. [0204] 16. Fukazawa Y, Lum R, Okoye A A, Park H, Matsuda K, Bae J Y, Hagen S I, Shoemaker R, Deleage C, Lucero C, Morcock D, Swanson T, Legasse A W, Axthelm M K, Hesselgesser J, Geleziunas R, Hirsch V M, Edlefsen P T, Piatak M, Jr., Estes J D, Lifson J D, Picker L J. B cell follicle sanctuary permits persistent productive simian immunodeficiency virus infection in elite controllers. Nature medicine. 2015; 21(2):132-9. doi: 10.1038/nm.3781. PubMed PMID: 25599132; PubMed Central PMCID: PMC4320022. [0205] 17. Fukazawa Y, Park H, Cameron M J, Lefebvre F, Lum R, Coombes N, Mahyari E, Hagen S I, Bae J Y, Reyes M D, 3rd, Swanson T, Legasse A W, Sylwester A, Hansen S G, Smith A T, Stafova P, Shoemaker R, Li Y, Oswald K, Axthelm M K, McDermott A, Ferrari G, Montefiori D C, Edlefsen P T, Piatak M, Jr., Lifson J D, Sekaly R P, Picker L J. Lymph node T cell responses predict the efficacy of live attenuated SIV vaccines. Nature medicine. 2012; 18(11):1673-81. doi: 10.1038/nm.2934. PubMed PMID: 22961108; PubMed Central PMCID: PMC3493820. [0206] 18. Sanders R W, van Gils M J, Derking R, Sok D, Ketas T J, Burger J A, Ozorowski G, Cupo A, Simonich C, Goo L, Arendt H, Kim H J, Lee J H, Pugach P, Williams M, Debnath G, Moldt B, van Breemen M J, Isik G, Medina-Ramirez M, Back J W, Koff W C, Julien J P, Rakasz E G, Seaman M S, Guttman M, Lee K K, Klasse P J, LaBranche C, Schief W R, Wilson I A, Overbaugh J, Burton D R, Ward A B, Montefiori D C, Dean H, Moore J P. HIV-1 neutralizing antibodies induced by native-like envelope trimers. Science. 2015. doi: 10.1126/science.aac4223. PubMed PMID: 26089353. [0207] 19. Sharma S K, de Val N, Bale S, Guenaga J, Tran K, Feng Y, Dubrovskaya V, Ward A B, Wyatt R T. Cleavage-Independent HIV-1 Env Trimers Engineered as Soluble Native Spike Mimetics for Vaccine Design. Cell Rep. 2015; 11(4):539-50. doi: 10.1016/j.celrep.2015.03.047. PubMed PMID: 25892233. [0208] 20. Burton D R, Mascola J R. Antibody responses to envelope glycoproteins in HIV-1 infection. Nature immunology. 2015; 16(6):571-6. doi: 10.1038/ni.3158. PubMed PMID: 25988889. [0209] 21. Blattner C, Lee J H, Sliepen K, Derking R, Falkowska E, de la Pena A T, Cupo A, Julien J P, van Gils M, Lee P S, Peng W, Paulson J C, Poignard P, Burton D R, Moore J P, Sanders R W, Wilson I A, Ward A B. Structural Delineation of a Quaternary, Cleavage-Dependent Epitope at the gp41-gp120 Interface on Intact HIV-1 Env Trimers. Immunity. 2014. doi: 10.1016/j.immuni.2014.04.008. PubMed PMID: 24768348. [0210] 22. Falkowska E, Le K M, Ramos A, Doores K J, Lee J H, Blattner C, Ramirez A, Derking R, van Gils M J, Liang C H, McBride R, von Bredow B, Shivatare S S, Wu C Y, Chan-Hui P Y, Liu Y, Feizi T, Zwick M B, Koff W C, Seaman M S, Swiderek K, Moore J P, Evans D, Paulson J C, Wong C H, Ward A B, Wilson I A, Sanders R W, Poignard P, Burton D R. Broadly Neutralizing HIV Antibodies Define a Glycan-Dependent Epitope on the Prefusion Conformation of gp41 on Cleaved Envelope Trimers. Immunity. 2014. doi: 10.1016/j.immuni.2014.04.009. PubMed PMID: 24768347. [0211] 23. Boritz E, Gerlach J, Johnson J E, Rose J K. Replication-competent rhabdoviruses with human immunodeficiency virus type 1 coats and green fluorescent protein: entry by a pH-independent pathway. J Virol. 1999; 73(8):6937-45. Epub 1999/07/10. PubMed PMID: 10400792; PubMed Central PMCID: PMC112779. [0212] 24. Hoffenberg S, Powell R, Carpov A, Wagner D, Wilson A, Kosakovsky Pond S, Lindsay R, Arendt H, Destefano J, Phogat S, Poignard P, Fling S P, Simek M, Labranche C, Montefiori D, Wrin T, Phung P, Burton D, Koff W, King C R, Parks C L, Caulfield M J. Identification of an HIV-1 clade A envelope that exhibits broad antigenicity and neutralization sensitivity and elicits antibodies targeting three distinct epitopes. J Virol. 2013; 87(10):5372-83. doi: 10.1128/JVI.02827-12. PubMed PMID: 23468492; PubMed Central PMCID: PMC3648150. [0213] 25. Goo L, Chohan V, Nduati R, Overbaugh J. Early development of broadly neutralizing antibodies in HIV-1-infected infants. Nature medicine. 2014; 20(6):655-8. doi: 10.1038/nm.3565. PubMed PMID: 24859529; PubMed Central PMCID: PMC4060046. [0214] 26. Wu X, Parast A B, Richardson B A, Nduati R, John-Stewart G, Mbori-Ngacha D, Rainwater S M, Overbaugh J. Neutralization escape variants of human immunodeficiency virus type 1 are transmitted from mother to infant. J Virol. 2006; 80(2):835-44. doi: 10.1128/JVI.80.2.835-844.2006. PubMed PMID: 16378985; PubMed Central PMCID: PMC1346878. [0215] 27. Wyatt L S, Belyakov I M, Earl P L, Berzofsky J A, Moss B. Enhanced cell surface expression, immunogenicity and genetic stability resulting from a spontaneous truncation of HIV Env expressed by a recombinant MVA. Virology. 2008; 372(2):260-72. Epub 2007/12/01. doi: 10.1016/j.virol.2007.10.033. PubMed PMID: 18048074; PubMed Central PMCID: PMC2289778. [0216] 28. Johnson J E, Rodgers W, Rose J K. A plasma membrane localization signal in the HIV-1 envelope cytoplasmic domain prevents localization at sites of vesicular stomatitis virus budding and incorporation into VSV virions. Virology. 1998; 251(2):244-52. Epub 1998/12/05. doi: 10.1006/viro.1998.9429. PubMed PMID: 9837788. [0217] 29. Tani H, Morikawa S, Matsuura Y. Development and Applications of VSV Vectors Based on Cell Tropism. Front Microbiol. 2011; 2:272. doi: 10.3389/fmicb.2011.00272. PubMed PMID: 22279443; PubMed Central PMCID: PMCPMC3260743. [0218] 30. Powell R L, Ouellette I, Lindsay R W, Parks C L, King C R, McDermott A B, Morrow G. A Multiplex Microsphere-Based Immunoassay Increases the Sensitivity of SIV-Specific Antibody Detection in Serum Samples and Mucosal Specimens Collected from Rhesus Macaques Infected with SIVmac239. BioResearch open access. 2013; 2(3):171-8. doi: 10.1089/biores.2013.0009. PubMed PMID: 23741627; PubMed Central PMCID: PMC3666263. [0219] 31. Winstone N, Wilson A J, Morrow G, Boggiano C, Chiuchiolo M J, Lopez M, Kemelman M, Ginsberg A A, Mullen K, Coleman J W, Wu C D, Narpala S, Ouellette I, Dean H J, Lin F, Sardesai N Y, Cassamasa H, McBride D, Felber B K, Pavlakis G N, Schultz A, Hudgens M G, King C R, Zamb T J, Parks C L, McDermott A B. Enhanced control of pathogenic Simian immunodeficiency virus SIVmac239 replication in macaques immunized with an interleukin-12 plasmid and a DNA prime-viral vector boost vaccine regimen. J Virol. 2011; 85(18):9578-87. Epub 2011/07/08. doi: 10.1128/JVI.05060-11. PubMed PMID: 21734035; PubMed Central PMCID: PMC3165762. [0220] 32. Barouch D H, Alter G, Broge T, Linde C, Ackerman M E, Brown E P, Borducchi E N, Smith K M, Nkolola J P, Liu J, Shields J, Parenteau L, Whitney J B, Abbink P, Ng'ang'a D M, Seaman M S, Lavine C L, Perry J R, Li W, Colantonio A D, Lewis M G, Chen B, Wenschuh H, Reimer U, Piatak M, Lifson J D, Handley S A, Virgin H W, Koutsoukos M, Lorin C, Voss G, Weijtens M, Pau M G, Schuitemaker H. HIV-1 vaccines. Protective efficacy of adenovirus/protein vaccines against SIV challenges in rhesus monkeys. Science. 2015; 349(6245):320-4. doi: 10.1126/science.aab3886. PubMed PMID: 26138104. [0221] 33. Sarzotti-Kelsoe M, Bailer R T, Turk E, Lin C L, Bilska M, Greene K M, Gao H, Todd C A, Ozaki D A, Seaman M S, Mascola J R, Montefiori D C. Optimization and validation of the TZM-bl assay for standardized assessments of neutralizing antibodies against HIV-1. J Immunol Methods. 2014; 409:131-46. doi: 10.1016/j.jim.2013.11.022. PubMed PMID: 24291345; PubMed Central PMCID: PMCPMC4040342.

    Example 2: Vaccination with a Live Vesicular Stomatitis Virus-HIV Env Chimera Prevents SHIV Infection

    [0222] Seven of 10 Indian rhesus macaques vaccinated with a novel replication-competent vesicular stomatitis virus vector designed with functional HIV Env substituting for the native VSV glycoprotein remained uninfected after repeated rectal challenge with a heterologous clade B SHIV.

    [0223] HIV is a challenging vaccine target because its functional envelope glycoproteins (Envs) are highly glycosylated, sequence diverse, and assembled into a compact trimeric complex (the Env spike) that restricts epitope access. Moreover, vaccines based on non-native forms of Env are either ineffective or provide limited protection. Therefore, Applicants developed a novel spike delivery vaccine (VSVG-Env.BG505) from vesicular stomatitis virus (VSV) by replacing the VSV glycoprotein (G) with functional clade A HIV Env. Rhesus macaques vaccinated with live VSVG-Env.BG505 developed Env antibodies, and importantly, 7 of 10 remained uninfected after repeated rectal challenge with heterologous clade B SHIV SF 162p3. In contrast, a second more typical VSV vector expressing both Env and G induced Env antibodies but failed to protect, showing that the VSVG-Env.BG505 vector design was associated with preclinical efficacy. Applicants' results indicate that the VSVG chimeric virus platform is an important developing vaccine technology for HIV Env glycoprotein delivery.

    [0224] HIV is a challenging vaccine target because its functional envelope glycoproteins (Envs) are highly glycosylated, sequence diverse, and assembled into a compact trimeric complex (the Env spike) that restricts epitope access. Moreover, vaccines based on non-native forms of Env are either ineffective or provide limited protection. Therefore, Applicants developed a novel spike delivery vaccine (VSVG-Env.BG505) from vesicular stomatitis virus (VSV) by replacing the VSV glycoprotein (G) with functional clade A HIV Env. Rhesus macaques vaccinated with live VSVG-Env.BG505 developed Env antibodies, and importantly, 7 of 10 remained uninfected after repeated rectal challenge with heterologous clade B SHIV SF 162p3. In contrast, a second more typical VSV vector expressing both Env and G induced Env antibodies but failed to protect, showing that the VSVG-Env.BG505 vector design was associated with preclinical efficacy. Applicants' results indicate that the VSVG chimeric virus platform is an important developing vaccine technology for HIV Env glycoprotein delivery.

    [0225] Replication-Competent VSV-HIV Env Vaccine Vectors.

    [0226] The VSVG-Env.BG505 chimera was developed by replacing the VSV G gene with sequence encoding functional Env.BG505 (FIGS. 25A-B with more detail in the Materials and Methods) In addition to expressing Env and replicating with the cell tropism of HIV, the VSVG-Env.BG505 chimera has several other features to highlight. First, its dependence on Env.BG505 for propagation ensures that some functionally-configured Env is expressed during viral replication that will expose the immune system to authentic Env spikes. Second, because the vector lacks the G gene, negative effects caused by G expression are avoided, such as the VSV glycoprotein dominating B cell responses or inducing potent anti-vector immunity. Finally, cells infected with VSVG-Env.BG505 produce progeny virus particles containing Env arrayed on their surface, which is expected to substantially enhance immunogen presentation to B lymphocytes (11).

    [0227] To directly investigate whether the live VSVG-Env.BG505 chimera was advantageous for the reasons mentioned above, VSV-G6-Env.BG505 (FIG. 25C) was developed as a comparator for use in the macaque study described below. VSV-G6-Env.BG505 is a more typical VSV vector in which the Env.BG505 gene was added as an extra transcription while retaining G. The vector was generated by reintroducing the G gene at the terminus of the negative-sense RNA genome (FIGS. 25A and C; G in genome position 6), which maintained Env in the same genomic position relative to the promoter (FIG. 25A) as in VSVG-Env.BG505 and modestly downregulated G expression (16). VSV-G6-Env.BG505 propagates efficiently using G, which recognizes a ubiquitous cellular receptor that enables infection of a broad range of cell types (17); thus, including VSV-G6-Env.BG505 in the vaccine study allowed us to ask whether this G-dependent vector might deliver the Env spike more effectively, perhaps because constitutive G expression confers increased replicative capacity in vivo, a different cell and tissue tropism, or both.

    [0228] Env.BG505 expression by the two different VSV vectors was compared by infecting cultured cells and conducting flow cytometry using monoclonal antibodies that bind a variety of Env epitopes (4-6). When VERO cells or a stable VERO derivative (VERO-CD4/CCR5) expressing human CD4 and CCR5 were exposed to VSVG-Env.BG505, only the CD4+/CCR5+ cells were infected as shown by Env detected on the cell surface (FIG. 25D). The expanded tropism conferred by G allowed VSV-G6-Env.BG505 to infect both cell types although the intensity of Env surface staining was reduced compared to VERO-CD4/CCR5 cells infected with VSVG-Env.BG505. The more intense cell surface staining produced by VSVG-Env.BG505 infection was due at least in part to increased Env expression, which was detectable by Western blot analysis (data not shown), but it also was possible that G co-expression by cells infected with VSV-G6-Env.BG505 had a negative effect on Env incorporation into the cell plasma membrane. It also is important to note that the panel of monoclonal antibodies used for flow cytometry included some that recognize native Env spikes structures (PGT145, PGT151, and VRCO6b) as well as others (IgGb6 and F105) that bind epitopes that are exposed when the Env subunits are not assembled into a compact spike (18-20). Infected cells were bound by all antibodies included in the panel demonstrating that multiple forms of Env were expressed on the cell surface including well-ordered Env spikes, as is typical for an HIV infection (21).

    [0229] Because Env spikes arrayed on progeny virions produced during replication in vivo were expected to be important immunogens (11), the antigenicity of purified virus particles was analyzed with a modified flow cytometry assay. In this assay, virus particles are adsorbed to aluminum phosphate (alum) to generate alum-virus complexes that can be incubated with monoclonal antibodies and are large enough to be analyzed with a flow cytometer (16). Subsequent analysis with the same monoclonal antibody panel showed that substantially more Env was incorporated in the VSVG-Env.BG505 chimera compared to VSV-G6-Env.BG505 (FIG. 25E and note different Y axes), which also was confirmed by Western blotting (data not shown). The flow cytometry data also showed that the antigenicity of VSVG-Env.BG505 virions was similar to the infected cell surface (FIG. 25D), including binding by VRCO6b, PGT145 and PGT151. In summary, analysis of purified virions showed that both VSVG-Env.BG505 and VSV-G6-Env.BG505 contained Env, but the immunogen was considerably more abundant in the VSVG chimeric virus particle.

    [0230] Vaccination and Preclinical Efficacy.

    [0231] Three groups of 10 male Indian rhesus macaques were vaccinated by administering live vector or saline control to both intranasal and intraoral surfaces at 0, 4 and 29 weeks (FIG. 26A). The five-month break between the second and third vaccination was included to provide time for germinal center reactions and B cell differentiation (22). All immunizations were conducted with a VSV vector, and no booster vaccinations were administered with a heterologous vector or subunit vaccine.

    [0232] No adverse reactions were observed after vaccination. Virus shedding into the oral cavity was analyzed using qRT-PCR, which showed that viral genomes were low to undetectable for VSVG-Env.BG505 but increased for VSV-G6-Env.BG505 particularly following the first vaccination (FIG. 32). This result implied that the replicative capacity of VSV-G6-Env.BG505 was greater, but it might also be due to differences in cell and tissue tropism affecting shedding into the oral cavity. VSV genomes were not detected in the blood (data not shown) in either group, which was consistent with lack of viremia detected in earlier studies (23). Interestingly, VSVG-ZEBOV did cause transient viremia in macaques (13) and clinical trial participants (14, 15), which might reflect an effect of cell tropism conferred by the Ebola virus glycoprotein.

    [0233] Intrarectal SHIV SF162p3 challenge commenced at week 48, about 4.5 months after the third vaccination (FIG. 26A). This rest period prior to SHIV challenge allowed waning of peak adaptive immune responses as well as decay of innate immunity that might have been triggered by VSV. A maximum of 10 sequential challenges were planned (FIG. 26A), with the first five being conducted approximately every 2 weeks after which a brief rest period was included to allow innate immune responses to decline if any were induced by repeated SHIV exposure (24, 25). Challenged animals that had 200 SHIV genome copies or more on two successive blood draws were considered positive (FIG. 33), at which time challenge was stopped. All vaccinated animals that tested positive for SHIV genomes also developed antibodies against Gag expressed by the SHIV (FIG. 34).

    [0234] After completing repetitive SHIV challenge, 9 of 10 placebo control animals were infected but just 3 of 10 in the VSVG-Env.BG505 group (FIG. 26B). This indicated that the VSVG-Env.BG505 group was significantly protected with an overall efficacy of 67% (P=0.014). The per-challenge vaccine efficacy for VSVG-Env.BG505 was estimated to be 79.8% based on a Leaky vaccine model (26). In contrast, vaccination with VSV-G6-Env.BG505 had no protective effect (FIG. 26B, and Table 1).

    [0235] Immune Responses Induced by Vaccination.

    [0236] Vaccinated macaques in both groups developed serum antibodies detectable with an Env gp120.BG505 ELISA (FIG. 27A). The longitudinal antibody titer profiles (FIG. 27A) showed that the first dose induced low antibody responses in both vaccine groups, which were not statistically different two weeks after immunization (box plots in FIG. 27B, Single Time Points). Titers increased after the second vaccination (FIG. 27A) and were statistically higher in the VSV-G6-Env.BG505 group 2 weeks later (FIG. 27B). Also in the VSV-G6-Env.BG505 group, the antibody titers were more durable after the second vaccination (FIG. 27A), and this difference was significant as shown by the average values of the aggregate titers during the six-month period prior to the third vaccination (FIG. 27B, Aggregate Values). The effect of the third vaccination differed between the groups. VSVG-Env.BG505 evoked a stronger response than VSV-G6-Env.BG505 (FIG. 27A) with the net result being that both groups had statistically equivalent mean titers two weeks following the third dose (FIG. 27B). Titer durability also was similar in both groups after the third vaccination up to the beginning of SHIV challenge at week 48, as shown in the longitudinal profile (FIG. 27A) and the average of the aggregate values during this time period (FIG. 27B). Overall, the ELISA data demonstrated that both mucosal vaccines were immunogenic without requiring a boost with a heterologous vaccine, and that the live viruses induced serum antibodies that persisted in most animals following the third vaccination.

    [0237] A prominent feature of the ELISA data was the low values corresponding to the three animals in the VSVG-Env.BG505 group (11, 15, and 16) that were unable to resist SHIV infection (FIG. 27A, fine solid red lines; FIG. 27B, solid red circles). Antibody titers in animals 11 and 15 were at the lower measureable limit when SHIV challenge was initiated at week 48 (FIGS. 26A and B), and both macaques were infected right away at challenge 1 and 2, respectively (FIG. 26B with more detail in FIG. 36). Animal 16 had somewhat higher ELISA values after the third vaccination (FIGS. 27A and B) that persisted up to initiation of SHIV challenge, suggesting that this enabled the macaque to resist 7 challenges conducted over a period of 5 months (FIGS. 26B and 36). By challenge 8 (week 67) when infection occurred in animal 16, titers had declined to near baseline (FIG. 36B). Thus, in the three unprotected macaques in the VSVG-Env.BG505 group, low binding antibody titers were associated with the timing of SHIV infection.

    [0238] Since neutralizing antibodies did not appear to be responsible for protection, other characteristics of the immune response were assessed. For example, Env-specific T-cells in peripheral blood were found to be below measurable limits in the VSVG-Env.BG505 group when analyzed by intracellular cytokine staining two weeks after the third vaccination (FIG. S7). This indicated that cellular immunity did not play a prominent role in protection although it did not rule out the possibility that T lymphocytes resident in tissues might be important (28). This lack of a substantial T cell response evoked by live VSVG-Env.BG505 was similar to what was observed in macaques vaccinated with VSVG-ZEBOV previously (13). Sera from just 3 of the 7 protected macaques vaccinated with VSVG-Env.BG505 had detectable anti-V1V2 IgG, while it was more frequently detected in the VSV-G6-Env.BG505 group that was not protected (FIG. S8) indicating that antibodies with this specificity were not correlated with SHIV resistance.

    [0239] Because neither neutralizing antibodies or IgG specific for gp70-V1V2 correlated with protection, serum antibodies were characterized further with a Western blot assay that could detect binding to Env as well as VSV structural proteins. This was done to investigate whether B cell responses against any of the polypeptides expressed by the replicating vectors might help differentiate between the two vaccine groups. Western blot membranes were prepared using proteins derived from purified VSVG-EnvG.BG505 particles, which provided multiple forms of the Env.BG505 (gp160 precursor, gp120, and gp41) as well as the internal VSV structural proteins (N, P, and M; FIG. 25A). Blot membranes were placed in a multichannel device to create lanes that allowed analysis of sera from individual macaques, and when samples were analyzed from after the third vaccination (week 43), two distinctive differences in antibody reactivity were detected between the groups (FIG. 28A). In animals vaccinated with VSVG-Env.BG505, the Env signals were more prominent (animals 12-14, 17-20) while signals corresponding to VSV polypeptides were weak. In contrast, sera from animals vaccinated with VSV-G6-Env.BG505 reacted more strongly with VSV structural proteins (N, P, and M), and relatively weakly with gp120 and gp160. The difference in Env signal between the groups was somewhat unexpected, as the group mean gp120 ELISA titers were similar following the third vaccination (FIGS. 27A and B) suggesting that the ELISA and Western blot might be probing different Env antibody qualities. The Western blot results also showed clearly that the polyclonal antibody response induced by the two vaccines was different.

    [0240] The Western blot also differentiated between macaques in the VSVG-Env.BG505 group (FIG. 28A) that did or did not resist SHIV infection. Sera from the 7 macaques that were protected produced Env signals of varying intensities (macaques 12-14 and 17-20), while sera from the three animals that were not protected (11, 15, and 16) produced very weak to undetectable signals. At week 43, the ELISA titers in animals 11 and 15 were low (FIG. 27A), consistent with the lack of Western blot signal. ELISA titers were higher in animal 16 at this time, suggesting that titer as well as characteristics of the polyclonal antibodies might contribute to lack of reactivity in the Western blot. Similar Western blot binding profiles also were produced by sera from other time points during the vaccination regimen. For example, the pattern of Env (FIG. 28B) and VSV polypeptide reactivity (FIG. 37A) was reproduced with week-48 sera and also with sera from after the second vaccination (FIG. 37B, week 16) even though the antibody titers were considerably lower in the VSVG-Env.BG505 group at this earlier time point (FIG. 27A).

    [0241] To determine if the Western blot Env signal persisted in serum from protected macaques, sera was analyzed from the SHIV challenge phase. At study week 62, after 5 SHIV challenges, the Env bands remained detectable in the uninfected macaques in the VSVG-Env.BG505 group (FIG. 28C, animals 12-14, 17-20). It also was evident that the Env signals increased substantially in macaques that were infected by week 62, such as animals 11 and 15. Later, at week 79 when 10 challenges were complete, and about one year after the last vaccination, sera from 5 of 7 uninfected macaques still produced an Env band that was readily visualized (FIG. 28D, animals 12-14, 19 and 20) and two produced weaker but detectable bands (17 and 18). These results showed that VSVG-Env.BG505 elicited Env binding antibodies that persisted in the uninfected animals.

    [0242] Because Western blotting (FIG. 28) and gp120 ELISA data (FIG. 27) indicated that Env binding antibodies played a role in preventing infection with a heterologous clade B SHIV challenge virus, it was important to confirm that vaccination induced antiserum with substantial cross-clade binding activity. A binding antibody multiplex assay (BAMA, 30) was used to assess binding against two Env panels (gp120 or gp140) composed of substrates from clade A, B, and C as well as several circulating recombinant viruses. Assays also were performed with four Env gp120 substrates used in clinical trials as well as Env gp120 and gp140 from clade B SF162.LS, which is an Env from a progenitor of the SHIV SF162p3 challenge virus.

    [0243] Finally, to determine what regions of Env might be targeted in response to VSVG-Env.BG505 vaccination, additional mapping of serum antibody binding specificity was performed with several assays. For conducting ELISAs and Western blots, seven different regions of Env.BG505 (FIG. 29A) were expressed as fusion proteins using human serum albumin (HSA) as the N-terminal fusion partner. Fusion to HSA enabled expression of the Env.BG505 fragments as secreted glycoproteins (31). For the ELISA results shown in FIG. 29B, the purified recombinant proteins were captured on microtiter plates (capture ELISA) using their C-terminal His tag after which they were reacted with sera from week 48. Four conclusions can be drawn from the capture ELISA data. First, the predominant positive signal in both vaccine groups was against the HSA-V3C3 and HSA-gp41 (gp41 ectodomain only). These fusion proteins also generated the most frequent and intense signals when used in a Western blot assay (FIG. 39). Second, sera from the three unprotected macaques in the VSVG-Env.BG505 group (11, 15, and 16) had lower HSA-V3C3 and HSA-gp41 values consistent with these animals being low responders, as observed earlier with gp120 ELISA (FIGS. 27A-B) and Western blots (FIGS. 28A-B). Finally, the HSA-gp41 substrate allowed unambiguous detection of antibodies specific for gp41 in vaccinated animals (FIGS. 29B and 39), which were not observed in the earlier Western blot assays (FIGS. 28A and 37). Lack of gp41 signals in the prior Western blots likely was due to lower gp41 quantities being present on the blot membrane, but perhaps conformation assumed by the different gp41 substrates played some role. It was also noticeable that the capture ELISA gp41 values were generally higher in protected animals from the VSVG-Env.BG505 group.

    [0244] Seven of 10 macaques vaccinated with the live Env-dependent VSVG-Env.BG505 chimera remained uninfected after repeated rectal challenge with heterologous clade B SHIV SF162p3 (FIG. 26). Notably, this level of efficacy was produced with a three-dose regimen of VSVG-Env.BG505, which differentiates this vaccine from some others evaluated before where protection was observed after immunization with multiple types of vaccine used either in combination or in a heterologous prime-boost regimen (8, 33, 34).

    [0245] In the 7 protected macaques vaccinated with VSVG-Env.BG505, resistance to SHIV infection was associated with persistent Env-specific serum antibodies, while in the three animals that became infected, poor vaccine take or waning antibody titers were a marker of susceptibility (FIGS. 27-29 and 36). Perhaps the most visual evidence for this was the gp120 ELISA data (FIGS. 27A and B, and 36) and Western blot results (FIG. 28), which clearly showed that the unprotected animals had reduced quantities of Env-specific serum antibodies. Further analysis of the sera from this group identified statistically significant correlations between the magnitude of antibody binding activity and SHIV infection resistance (6D), but it remains to be determined if the more abundant Env antibodies are directly involved in the protective mechanism or whether they primarily are indicators of VSVG-Env.BG505 vaccine take. The suggestion that they contribute to the mechanism of protection might gain support from the data showing that gp120 V3 and gp41 (FIG. 29) were prominent targets of the antibody response induced by VSVG-Env.BG505. Antibody binding to V3 and gp41 has been linked to protection before, for example, reduced infection risk was correlated with anti-V3 antibodies in the RV144 clinical trial (32) and anti-gp41 antibodies have been associated with protection from progressive SIV infection in the macaque model (35).

    [0246] Functional activities associated with the protective antibodies remain to be identified. Virus neutralizing activity was not detected in serum (FIG. 27D), although it might have been unmeasurable because the live vectors induced modest antibody titers (FIG. 27A). Even if undetectable quantities of neutralizing serum antibodies were present, their activity likely would not be adequate to mediate protection (36). Maybe mucosal vaccination with VSVG-Env.BG505 resulted in neutralizing antibody being tissue associated or in mucosal secretions rather than in circulation, although anti-gp120 antibodies were not detected in oral or rectal swab samples (data not shown). It seems more likely that protection was due to Env-specific immunoglobulins that direct antibody-mediated effector functions, like those induced by other Env vaccine candidates evaluated in recent preclinical studies (33, 34) or the RV144 clinical trial (8). There is growing recognition that antibodies lacking classic in vitro virus neutralizing activity contribute substantially to protection from viral infections, as illustrated by some recent studies on influenza virus (37, 38); thus, further investigation and comparison of effector functions associated with IgG induced by protective VSVG-Env.BG505 or nonprotective VSV-G6-Env.BG505 will be informative.

    [0247] Although the serum antibody titers evoked by mucosal vaccination with VSVG-Env.BG505 were modest (FIG. 27A), the Western blot results indicated that binding activity persisted for at least a year in protected animals (FIG. 28D). This might resemble what is observed during vaccination with live attenuated viruses like in the measles vaccine. Antibody titers established by measles vaccination are considerably lower than those reached during natural infection, but the attenuated virus replicates sufficiently to establish durable protective antibodies (39). There likely is a similar requirement for VSVG-Env.BG505 to achieve replication threshold that provides an adequate quantity and duration of Env expression, results in release of immunogenic virus particles containing Env arrayed on their surface (11), and distributes immunogen to lymphoid tissues (40). Possibly, vaccine failure in the three unprotected macaques in the VSVG-Env.BG505 group was caused by inadequate replication, thus future studies that investigate VSVG-Env.BG505 propagation in vivo will be important.

    [0248] Replicative capacity might also contribute to a notable difference between the VSVG-ZEBOV and VSVG-Env.BG505 chimeric virus vaccines. In preclinical and clinical studies (13-15), a single vaccination with VSVG-ZEBOV was sufficient for efficacy. Applicants' data suggested that multiple VSVG-Env.BG505 vaccinations probably were necessary to establish a more persistent Env antibody titer, with the third vaccination having a substantial effect on durability (FIG. 27A). A single vaccination with VSVG-ZEBOV may be sufficient because the virus apparently replicates and disseminates more extensively based on finding virus in the blood of macaques and clinical trial volunteers (13-15). This suggests that further development of the VSVG-Env.BG505 vaccine may benefit from investigating how to safely increase virus replication. This might be achieved by launching a more robust initial infection using a different vaccination route or higher dose, or alternatively, maybe a VSVG-Env.BG505 vector can be developed that has increased replicative capacity. A follow up study in macaques is being initiated to investigate some of these variables.

    [0249] The VSVG chimeric virus design appears to be emerging as an important vaccine technology for delivery of viral glycoprotein immunogens. The VSVG-ZEBOV clinical trials showed that the Ebola virus vaccine was safe and efficacious (13-15). Promising preclinical results also have been produced with other hemorrhagic fever virus glycoproteins (41), and now Applicants' data shows that this strategy can be adapted for use with an HIV Env trimer immunogen, which is well known to be a very difficult vaccine target (5). The effectiveness of the VSVG chimera design probably is due to its ability to reproduce features of a natural pathogen infection without pathology that inhibits development of protective adaptive immunity. Vaccine features such as expression of the native transmembrane glycoprotein on the surface of infected cells, infection directed to cells and tissues specified by the tropism of the foreign glycoprotein, and the presentation of immunogen arrayed on virus particles all likely play important roles in shaping the immune response. Moreover, the lack of a G gene in the vector is very important, because it eliminates expression of a dominant off-target B cell immunogen, prevents development of potent anti-G antibodies, and allows the foreign glycoprotein to be repetitively arrayed on the virus particle without interference from G.

    [0250] To evaluate whether the promising preclinical performance of VSVG-Env.BG505 can be extended to humans, as it was for the VSVG-ZEBOV vaccine, Applicants are developing a clinical trial candidate. It is relevant to clinical development to mention that the G gene deletion in VSVG-ZEBOV resulted in loss of the VSV neurovirulence phenotype that is observed in some preclinical models (42). Advancing VSVG-Env.BG505 to clinical trial will be valuable, as it will answer whether the live chimeric virus platform can be used to safely induce Env binding antibodies with properties like those described above in healthy clinical trial volunteers.

    [0251] Molecular Cloning, Recombinant Proteins, and Cell Line Development.

    [0252] The VSV genomic clone is based on the VSV Indiana (IND) serotype (16). The plasmid vector containing the VSV genomic clone was similar to one used before (46) except that the T7 RNA polymerase promoter was replaced with a longer version that improves T7 RNA polymerase processivity (T7-g10 (47) and a hammerhead ribozyme sequence was positioned between the T7-g10 promoter and the beginning of the VSV nucleotide sequence (48). The hepatitis delta virus ribozyme and T7 terminator sequences downstream of the 3 end of the VSV antigenome were the same as used before (46). Modified genomic clones with the G IND or G New Jersey (NJ) gene moved to genomic position 6 (VSV-G6, FIG. 25C) were described earlier (16) and a third clone was developed for this study using Maraba (MAR) virus G (Genbank HQ660076.1). Plasmids that express the VSV structural proteins (N, P, M, G, and L) under control of the CMV promoter were used to support VSV rescue (16) instead of those controlled by the T7 promoter used in the earlier procedure (46). A plasmid designed to express T7 RNA polymerase from the CMV promoter was designed similarly to the one described previously (46).

    [0253] The Env immunogen expressed by VSVG-Env.BG505 and VSV-G6-Env.BG505 was based on the wild-type clade A Env.BG505 amino acid sequence (Genbank ABA61516, 49, 50). Env.BG505 was modified by replacing the signal sequence, transmembrane region and cytoplasmic tail with corresponding regions of G from VSV IND (FIG. 30A). The nucleotide sequence encoding the modified Env.BG505 was optimized with a VSV codon bias as described previously (16) after which the gene was inserted in the VSV genomic clone in place of G. Additional VSVG-Env chimeras were developed similarly based on Env C.CHSO5 (week 100; Genbank KC247391.1) and Env B. SF 162p3 (Genbank KF042063).

    [0254] A series of plasmids also were constructed to allow expression of several different domains of Env.BG505 fused to the C-terminus of human serum (HSA, 31). A glycine-serine linker (GGGGS (SEQ ID NO: 6)) was inserted between the C-terminus of HSA and the Env sequence, and a C-terminal histidine tag was added to enable chromatographic purification of HSA-fusion proteins secreted from transfected cells. The HSA fusion proteins were expressed by transfecting 293T cells and purified as described previously (49). His-tagged Env.BG505 gp120 (49) and gp140 containing a flexible linker in place of the furin cleavage site (51) were expressed and purified similarly.

    [0255] A stable VERO cell line expressing human CD4 and CCR5 (VERO-CD4/CCR5) was developed for propagating the VSVG-Env.BG505 vector. The human CD4 and CCR5 coding sequences were joined by a 2A-like element (52) to form a single cistron (CCR5-2A-CD4), which was inserted into a plasmid under the control of a transcription unit developed from the human heat shock protein 60 gene (53). A stable cell line was generated by introducing DNA into cells by microporation (Neon Transfection System, Invitrogen) and selecting clonal isolates resistant to G418.

    [0256] Cell Culture and Virus.

    [0257] Recombinant virus recovery from DNA and virus propagation was performed using VERO or VERO-CD4/CCR5 cells. Three media were used for VERO cell propagation and electroporation procedures that were similar to those described before (46). VERO cell medium 1 (VCM1) is Dulbecco's modified Eagle's medium (DMEM) supplemented with 10% heat-inactivated fetal bovine serum, 220 M 2-mercaptoethanol, 2 mM L-glutamine, 1 mM sodium pyruvate, and 0.1 mM MEM nonessential amino acids. VCM2 is Iscove's modified Dulbecco's medium (IMDM) supplemented with 220 M 2-mercaptoethanol, 1% DMSO, 2 mM L-glutamine, 1 mM sodium pyruvate, and 0.1 mM MEM nonessential amino acids. VCM3 is the same as VCM1 with addition of 50 g/mL Gentamicin. The VERO-CD4/CCR5 cell line was propagated in VCM3 containing 1 mg per mL G418. All medium and supplements were obtained from ThermoFisher.

    [0258] Recombinant VSV was rescued from DNA using a helper-virus-free method adapted from Witko et al. (46) using the modified plasmids described above. Virus rescue was initiated by electroporation of plasmids encoding T7 RNA polymerase, VSV N, P, M, G, and L, and the appropriate VSV genomic clone into VERO (for VSV-G6) or VERO-CD4-CCR5 (for VSVG) cells. Conditions for electroporation with a BTX ECM 830 instrument (Harvard Apparatus) and subsequent virus recovery were similar to those used in the earlier method (46).

    [0259] To ensure efficient vaccination with either vaccine, two vector-specific modifications were applied, but the fundamental vaccine designs shown in FIGS. 25A-C were not changed. These modifications enhanced vaccine delivery without altering the Env-dependent propagation of VSVG-Env.BG505 or the G-dependent propagation of VSV-G6-Env.BG505. The modifications are illustrated in FIGS. 30 and 31). To enhance mucosal VSVG-Env.BG505 uptake, vaccine material was prepared as a pseudotyped virus particle bearing G (G pseudotype; FIGS. 30B and 31A-B). This was done simply by amplifying vaccine material in VERO-CD4/CCR5 cells that transiently expressed VSV G. Pseudotyped VSVG-Env.BG505 launches a more robust initial infection, because G recognizes a ubiquitous receptor found on a wide range of cells (17). Importantly, G is not expressed by cells infected with pseudotyped VSVG-Env.BG505 and all subsequent rounds of infection in vivo are Env dependent (FIG. 30). For VSV-G6-Env.BG505, it was modified to reduce the negative effects of anti-G antibodies that develop during repeated vaccination with vectors expressing G. Three versions of VSV-G6-Env.BG505 (FIGS. 31A and C) were used in sequence during the three-dose regimen (FIG. 31A). Each version of VSV-G6-Env.BG505 differed only in the G gene (FIG. 31C), which was exchanged with sequences from three different vesiculoviruses including VSV IND, VSV NJ, and Maraba virus (16, 54).

    [0260] Large batches of VSVG-Env.BG505 or VSV-G6-Env.BG505 were amplified using VERO-CD4/CCR5 or VERO cells, respectively. Cell monolayers were grown in Cell Factories (Corning) using VCM3, but once infection was initiated, the medium was changed to Virus Production Serum-Free Medium (VPSFM, supplemented with 4 mM L-Glutamine, 50 U/mL Penicillin and 50 g/mL Streptomycin; ThermoFisher). Cells were infected with 0.1 plaque-forming units per cell and then incubated for about 24 h before the medium supernatant was harvested and clarified by centrifugation at 900g for 30 m at room temperature. Clarified supernatants were overlaid on 20% sucrose cushions prepared in phosphate-buffered saline (PBS), then centrifuged for 2 hrs (18,000 rpm, 42,900 g, 4 C.) using a SW28 rotor (Beckman Coulter). The sucrose solution was aspirated completely from the virus pellet after which virus was suspended in Hank's Balanced Salt Solution (HBSS, ThermoFisher) containing 15% Trehalose (Life Sciences Advanced Technologies) that was adjusted to pH 7.2. Virus suspensions were stored at 80 C. in aliquots.

    [0261] Pseudotyped VSVG-Env.BG505 was produced in VERO-CD4/CCR5 cells that were electroporated with plasmid expressing VSV G IND or NJ. In preparation for electroporation, cells were harvested and treated as described before (46) and were suspended in 0.7 ml of VCM2 (210.sup.7 cells). Purified VSVG-Env.BG505 (0.1 pfu per cell) and 50 ug of pCMV-G expression plasmid was added to the cell suspension before performing electroporation with the BTX ECM830 instrument. After electroporation, the cells were processed and transferred to one T175 flask per electroporation cuvette, after which they were cultured in VCM1 for 3-4 hours at 37 C. before performing heat shock (43 C.) for 3 hours (46). After heat shock, the cells were returned to 37 C. and allowed to recover for 2 h before the medium was removed and replaced VPSFM supplemented with 4 mM L-Glutamine. Incubation was continued 24-48 hours at 37 C. until cytopathic effect was evident throughout the culture after which virus was harvested and purified as described above.

    [0262] VSV vector infectious units were quantified by plaque assay (16). For VSVG-Env.BG505, GHOST-CD4-CCR5 cell monolayers were used (NIH AIDS Reagent Program, Division of AIDS, NIAID, NIH, catalog number 3944, 55) while VERO cells were used for VSV-G6-Env.BG505. Near-confluent cell monolayers were infected with serially diluted virus before being overlaid with VCM3 containing 0.8% agarose. When plaques were visible, cells were fixed with 7% formaldehyde and stained with a solution of 7% crystal violet in water. Plaques were counted from duplicate wells and infectious titers were expressed as plaque-forming units (pfus) per ml.

    [0263] Western blotting was used to confirm Env expression by infected cells and also to characterize purified VSV vector particles. For analysis of Env expression, cytoplasmic lysates were prepared from infected monolayers using CellLytic M reagent (Sigma). Lysate proteins were then subjected to denaturing SDS polyacrylamide gel electrophoresis (SDS PAGE) and transferred to nitrocellulose membranes. Proteins were detected with monoclonal antibodies or polyclonal serum specific for Env gp120.BG505 or VSV structural proteins. Secondary antibodies conjugated to horse-radish peroxidase and chemiluminescence detection was used to visualize specific bands. Protein composition of VSV vector particles was analyzed by Western blot using similar methods applied to virus purified by centrifugation through sucrose cushions.

    [0264] VSV vector vaccine material was subjected to several tests to ensure the quality. Endotoxin levels were tested using the Endosafe Portable Test System (Charles River Laboratories, Boston). All vaccine lots had endotoxin levels less than 10 EU/ml. The absence of Mycoplasma was confirmed by PCR using the MycoSEQ Mycoplasma Detection System (Life Technologies). Residual VERO cell DNA was less than 10 ng per dose as determined with the resDNASEQ Vero Residual DNA Quantitation System (Life Technologies). Gene sequences were confirmed by nucleic acid sequencing as described before (16).

    [0265] Vaccinations, SHIV Challenge, and Animal Care and Use.

    [0266] Purpose-bred male Indian rhesus macaques were 4-7 years of age when they arrived at The State University of New York (SUNY) Downstate Medical Center, Division of Comparative Medicine. Animal care and use complied with The United States Department of Agriculture and The New York State Department of Health regulations. The SUNY Downstate Medical Center Institutional Animal Care and Use Committee reviewed all experimental procedures. Prior to receipt, all macaques were confirmed to be negative for Herpes B virus (BV), tuberculosis (TB), simian immunodeficiency virus (SIV), simian retrovirus (SRV), and simian T lymphotropic virus (STLV), as well as Shigella and Campylobacter jejuni.

    [0267] No Macaques were included in the study if they were positive for MHC alleles Mamu-B*08 and B*17 associated with strong SIV replication control (56). Both groups vaccinated with VSV vectors each had 2 animals that were positive for Mamu-A*01 and two positive A*02, which have been associated with control of disease progression (56). The placebo control group also contained two animals that were positive for A*02 and one for A*01. For vaccination, macaques were sedated and positioned in dorsal recumbency after which vaccine was administered by the intraoral and intranasal routes. Vaccine or buffer control was administered by drops using a 1000 l micropipette. 500 l was delivered intranasally by alternating drops between the left and right nares, with time between drops allowed for the droplet to be inhaled. For intraoral, a total of 500 l was administered by drops applied sublingually on the frenulum (250 l) and to the anterior buccal surface of the inferior lip (250 l) followed by 30-60 seconds of gentle massage to help distribute the inoculum. Animals were kept in dorsal recumbency throughout the procedure and were left in this position for an additional 5 minutes before being returned to their cages. Animals were singly housed for 48 h following all vaccinations, after which they were housed together (2-3 animals per cage) within the same vaccination group. Bedding material was analyzed for VSV genomes by qPCR and none was detected (data not shown).

    [0268] Rectal challenge was performed using SHIV SF 162p3 that was prepared in primary cultures of macaque PBMCs (34). The inoculum (total of 2.210.sup.4 TCID50) consisted of virus in 1 ml of saline or RPMI medium. Sedated animals were positioned in sternal recumbency with the posterior elevated by placing an empty plastic container between the lower abdomen and the procedure table. Inoculation was performed by atraumatic insertion of a lightly lubricated 3 mL syringe approximately 5 cm into the rectum. The inoculum was slowly instilled over a one-minute period with the syringe left in place for and additional 4 minutes. After removing the syringe, macaques remained in sternal recumbency for 10 minutes. Challenged animals were caged separately for 48 h before being housed in groups of 2-3 within the same vaccination group.

    [0269] SHIV infection was monitored by reverse transcription and quantitative PCR (RT-qPCR) using methods similar to those described earlier (57). Briefly, virus from 1.0 ml of plasma was collected by centrifugation at 25,000g for 90 min (5 C.). The virus pellet was processed using the RNeasy Micro kit (Qiagen) by suspending virus in solution containing 300 l of lysis buffer, 3 l of 14.2 M 2-mercaptoethanol (Bio-Rad), and 16 l of 20 mg/ml proteinase K (Qiagen). Samples were digested at 56 C. for 1 h, then RNA was purified using spin columns following the RNeasy Micro kit protocol. RNA was eluted in 50 l of RNase-free water supplemented with 1 mM dithiothreitol (Sigma) and 1 U/l RNAseOUT (Thermo Fisher Scientific) after which duplicate RT reactions were performed using 15 l of purified RNA per reaction and 10 l of a cocktail composed of reagents from the Sensiscript Reverse Transcriptase kit (Qiagen, Valencia, Calif., USA) including 1 reverse transcription buffer, 0.5 mM of each dNTP, 10 U/reaction RNase Inhibitor (Invitrogen, Carlsbad, Calif., USA), 10 Units Sensiscript Reverse transcriptase, and Gag-specific reverse primer (400 nM, 5-CACTAGKTGTCTCTGCACTATPTGTTT-3(SEQ ID NO: 3)) that annealed to the positive-sense genomic RNA. Reverse transcription was performed at 50 C. for 45 min and terminated by heat inactivation (95 C. for 2 min). The heat-inactivated 25-l reaction was adjusted for qPCR by adding 30 l of a reagent mix composed of 1 QuantiTect Multiplex PCR Master Mix (Qiagen), 400 nM of Gag-specific forward primer (5-GTCTGCGTCATPTGGTGCAT-3 SEQ ID NO: 4)) and Gag-specific reverse primer, and 200 nM 6-carboxyfluorescein (FAM)-labeled minor groove binder (MGB) probe (5-6FAM-CTTCPTCAGTKTGTTTCA-MGB-3 SEQ ID NO: 5)). A Stratagene Mx3005P Sequence Detection System was used for amplification and detection with the following conditions: 15 min at 95 C. followed by 45 cycles of 60 secs at 94 C. and 90 secs at 60 C. Results from duplicate test samples were averaged and genome copy numbers were interpolated from a curve generated with known RNA standards. Positive samples were defined as 200 genome copies per ml of plasma.

    [0270] Analysis of Immune Responses.

    [0271] To prepare plasma and peripheral blood mononuclear cells (PBMCs), blood was collected in tubes coated with sodium heparin. Plasma was prepared by removing cells by centrifugation and storage at 20 C. PBMCs were isolated by density gradient centrifugation on Ficoll Hypaque (GE Healthcare) in Accuspin tubes (Sigma-Aldrich) as described previously (57). Harvested PBMCs were suspended in Recovery Cell Culture Freezing Medium (Thermo Fisher Scientific) and stored in liquid nitrogen. Serum used for ELISA, Western blot procedures, binding antibody multiplex assays, or HIV pseudovirus neutralization assays was prepared from whole blood collected and processed in serum separator tubes (SST). Aliquots were stored at 20 C.

    [0272] Intracellular cytokine staining was performed as described before (57). T cells were stimulated with Env.BG505 peptide (Genscript) 15-mers overlapping by 11 amino acids. Two different Env.BG505 peptide pools, spanning gp120 or gp41, were used at 4 g per ml. All flow cytometry data had mock background responses subtracted.

    [0273] Infected VERO and VERO-CD4/CCR5 cells and VSV vector particles also were analyzed by flow cytometry. For infected cells, VERO or VERO-CD4/CCR5 monolayers were infected with 0.1 to 1.0 pfu per cell and incubated overnight at 37. The following day, cells were washed with PBS and then treated with Enzyme-free Cell Dissociation Buffer (Life Sciences) to produce a cell suspension. The cells were collected by centrifugation and then suspended in PBS before being incubated with Env-specific monoclonal antibodies. Flow cytometry was performed as described earlier (16).

    [0274] Env incorporated in VSV particles also was analyzed by flow cytometry (16). Typically, purified virus (10.sup.8 pfus) was bound to 100 ug Alum (Adju-Phos, Brenntag, Denmark) and the alum/virus complexes were blocked with PBS containing 3% BSA before being incubated with primary antibodies. After primary antibody incubation, the complexes were collected by centrifugation, washed using PBS containing 3% BSA, and then incubated with labeled secondary antibody. Centrifugation and washing was repeated before analysis with a LSRII flow cytometer (Becton Dickinson). The flow cytometer was set to analyze 30,000 particles with forward scatter (FSC) and side scatter (SSC) set to log 10 scale and threshold set to 4000. Data was analyzed using FlowJo software version 9.4 (Tree Star), where complexes were gated according to positivity compared to an alum only control.

    [0275] Western blotting also was used for analysis of serum antibodies. Polypeptide substrates used for the analysis were either purified VSVG-EnvG.BG505 particles (no G pseudotype, 510.sup.8 pfus) or purified Env proteins. Purified virus or protein was diluted to 162.5 L in HBSS containing 15% Trehalose before being mixed with 62.5 l LDS NuPAGE sample buffer (Novex) and 25 L of NuPAGE Sample Reducing Agent (Novex). Samples were heat denatured before being electrophoresed in a denaturing preparative gel (NuPAGE 4-12% Bis-Tris 2D, ThermoFisher), and afterwards proteins were transferred to a nitrocellulose membrane. The membrane was rinsed with PBS and then incubated at room temperature for 1 h in blocking buffer composed of StartingBlock T20 buffer (ThermoFisher) supplemented with Clear Milk (Pierce/ThermoFisher) and 1% goat serum (Sigma). The blocked membrane was transferred to a multichannel Mini Protein II MultiScreen (BioRad) device that created multiple channels for analysis of sera from individual macaques. Individual lanes were incubated for 1 h at room temperature with heat-inactivated macaque serum (diluted 1:300 in blocking buffer for a total volume of 550 L) before the solution was aspirated completely from each lane. The membrane was then removed from the multiscreen device and rinsed 5 times with miliQ water (59) and then washed 3 times for 5 minutes each with PBS containing 0.1% Tween-20. The membrane was incubated with secondary antibody (mouse anti-monkey IgG, SouthernBiotech; diluted 1:10,000 in blocking buffer) for 45 mins at room temperature after which it was washed as described above. The blot was developed with chemiluminescence reagent (SuperSignal West Femto Maximum Sensitivity Substrate, ThermoFisher) and imaged with a Biorad ChemiDoc Touch Imaging System.

    REFERENCES AND NOTES

    [0276] 1. UNAIDS, Fact Sheet 2016 UNAIDS. http://www.unaids.org/sites/default/files/media_asset/UNAIDS_FactSheet_en_pdf. 2016. [0277] 2. T. M. Harmon et al., Exploring the Potential Health Impact and Cost-Effectiveness of AIDS Vaccine within a Comprehensive HIV/AIDS Response in Low- and Middle-Income Countries. PLoS ONE 11, e0146387 (2016). [0278] 3. M. A. Checkley, B. G. Luttge, E. O. Freed, HIV-1 envelope glycoprotein biosynthesis, trafficking, and incorporation. Journal of Molecular Biology 410, 582-608 (2011). [0279] 4. D. R. Burton, J. R. Mascola, Antibody responses to envelope glycoproteins in HIV-1 infection. Nature immunology 16, 571-576 (2015). [0280] 5. P. D. Kwong, J. R. Mascola, G. J. Nabel, Broadly neutralizing antibodies and the search for an HIV-1 vaccine: the end of the beginning. Nat Rev Immunol 13, 693-701 (2013). [0281] 6. A. B. Ward, I. A. Wilson, Insights into the trimeric HIV-1 envelope glycoprotein structure. Trends Biochem Sci 40, 101-107 (2015). [0282] 7. R. J. O'Connell, J. H. Kim, L. Corey, N. L. Michael, Human immunodeficiency virus vaccine trials. Cold Spring Harb Perspect Med 2, a007351 (2012). [0283] 8. J. H. Kim, J. L. Excler, N. L. Michael, Lessons from the RV144 Thai phase III HIV-1 vaccine trial and the search for correlates of protection. Annual review of medicine 66, 423-437 (2015). [0284] 9. S. A. Plotkin, Correlates of protection induced by vaccination. Clin Vaccine Immunol 17, 1055-1065 (2010). [0285] 10. C. L. Parks, L. J. Picker, C. R. King, Development of replication-competent viral vectors for HIV vaccine delivery. Curr Opin HIV AIDS 8, 402-411 (2013). [0286] 11. M. F. Bachmann, G. T. Jennings, Vaccine delivery: a matter of size, geometry, kinetics and molecular patterns. Nat Rev Immunol 10, 787-796 (2010). [0287] 12. E. Boritz, J. Gerlach, J. E. Johnson, J. K. Rose, Replication-competent rhabdoviruses with human immunodeficiency virus type 1 coats and green fluorescent protein: entry by a pH-independent pathway. J Virol 73, 6937-6945 (1999). [0288] 13. S. M. Jones et al., Live attenuated recombinant vaccine protects nonhuman primates against Ebola and Marburg viruses. Nature medicine 11, 786-790 (2005). [0289] 14. A. M. Henao-Restrepo et al., Efficacy and effectiveness of an rVSV-vectored vaccine expressing Ebola surface glycoprotein: interim results from the Guinea ring vaccination cluster-randomised trial. Lancet 386, 857-866 (2015). [0290] 15. S. T. Agnandji et al., Phase 1 Trials of rVSV Ebola Vaccine in Africa and Europe. The New England journal of medicine 374, 1647-1660 (2016). [0291] 16. S. Rabinovich et al., A novel, live-attenuated vesicular stomatitis virus vector displaying conformationally intact, functional HIV-1 envelope trimers that elicits potent cellular and humoral responses in mice. PLoS ONE 9, e106597 (2014). [0292] 17. E. Hastie, M. Cataldi, I. Marriott, V. Z. Grdzelishvili, Understanding and altering cell tropism of vesicular stomatitis virus. Virus Res 176, 16-32 (2013). [0293] 18. R. W. Sanders et al., A next-generation cleaved, soluble HIV-1 Env trimer, BG505 SOSIP.664 gp140, expresses multiple epitopes for broadly neutralizing but not non-neutralizing antibodies. PLoS Pathog 9, e1003618 (2013). [0294] 19. E. Falkowska et al., Broadly Neutralizing HIV Antibodies Define a Glycan-Dependent Epitope on the Prefusion Conformation of gp41 on Cleaved Envelope Trimers. Immunity, (2014). [0295] 20. Y. Li et al., HIV-1 neutralizing antibodies display dual recognition of the primary and coreceptor binding sites and preferential binding to fully cleaved envelope glycoproteins. J Virol 86, 11231-11241 (2012). [0296] 21. P. L. Moore et al., Nature of nonfunctional envelope proteins on the surface of human immunodeficiency virus type 1. J Virol 80, 2515-2528 (2006). [0297] 22. F. Sallusto, A. Lanzavecchia, K. Araki, R. Ahmed, From vaccines to memory and back. Immunity 33, 451-463 (2010). [0298] 23. J. E. Johnson et al., Neurovirulence properties of recombinant vesicular stomatitis virus vectors in non-human primates. Virology 360, 36-49 (2007). [0299] 24. C. Selinger et al., Multiple low-dose challenges in a rhesus macaque AIDS vaccine trial result in an evolving host response that affects protective outcome. Clin Vaccine Immunol 21, 1650-1660 (2014). [0300] 25. R. R. Regoes, The role of exposure history on HIV acquisition: insights from repeated low-dose challenge studies. PLoS Comput Biol 8, e1002767 (2012). [0301] 26. M. G. Hudgens, P. B. Gilbert, Assessing vaccine effects in repeated low-dose challenge experiments. Biometrics 65, 1223-1232 (2009). [0302] 27. D. C. Montefiori, in HIV Protocols: Second Edition, vol. 485, V. R. Prasad, G. V. Kalpana, Eds. (Humana Press, New York, 2009), chap. 26, pp. 395-405. [0303] 28. Y. Fukazawa et al., Lymph node T cell responses predict the efficacy of live attenuated SIV vaccines. Nature medicine 18, 1673-1681 (2012). [0304] 29. B. F. Haynes et al., Immune-correlates analysis of an HIV-1 vaccine efficacy trial. The New England journal of medicine 366, 1275-1286 (2012). [0305] 30. G. D. Tomaras et al., Initial B-cell responses to transmitted human immunodeficiency virus type 1: virion-binding immunoglobulin M (IgM) and IgG antibodies followed by plasma anti-gp41 antibodies with ineffective control of initial viremia. J Virol 82, 12449-12463 (2008). [0306] 31. J. Carter et al., Fusion partners can increase the expression of recombinant interleukins via transient transfection in 2936E cells. Protein Sci 19, 357-362 (2010). [0307] 32. R. Gottardo et al., Plasma IgG to linear epitopes in the V2 and V3 regions of HIV-1 gp120 correlate with a reduced risk of infection in the RV144 vaccine efficacy trial. PLoS ONE 8, e75665 (2013). [0308] 33. D. H. Barouch et al., Protective efficacy of adenovirus/protein vaccines against SIV challenges in rhesus monkeys. Science 349, 320-324 (2015). [0309] 34. D. H. Barouch et al., Protective efficacy of a global HIV-1 mosaic vaccine against heterologous SHIV challenges in rhesus monkeys. Cell 155, 531-539 (2013). [0310] 35. Q. Li et al., Live simian immunodeficiency virus vaccine correlate of protection: local antibody production and concentration on the path of virus entry. J Immunol 193, 3113-3125 (2014). [0311] 36. M. Shingai et al., Passive transfer of modest titers of potent and broadly neutralizing anti-HIV monoclonal antibodies block SHIV infection in macaques. J Exp Med 211, 2061-2074 (2014). [0312] 37. C. J. Henry Dunand et al., Both Neutralizing and Non-Neutralizing Human H7N9 Influenza Vaccine-Induced Monoclonal Antibodies Confer Protection. Cell host & microbe 19, 800-813 (2016). [0313] 38. H. M. Yassine et al., Hemagglutinin-stem nanoparticles generate heterosubtypic influenza protection. Nature medicine 21, 1065-1070 (2015). [0314] 39. M. K. Slifka, I. Amanna, How advances in immunology provide insight into improving vaccine efficacy. Vaccine 32, 2948-2957 (2014). [0315] 40. N. Honke et al., Enforced viral replication activates adaptive immunity and is essential for the control of a cytopathic virus. Nature immunology 13, 51-57 (2012). [0316] 41. C. E. Mire et al., A Single-Vector, Single-Injection Trivalent Filovirus Vaccine: Proof of Concept Study in Outbred Guinea Pigs. J Infect Dis 212 Suppl 2, S384-388 (2015). [0317] 42. C. E. Mire et al., Recombinant vesicular stomatitis virus vaccine vectors expressing filovirus glycoproteins lack neurovirulence in nonhuman primates. PLoS Negl Trop Dis 6, e1567 (2012). [0318] 43. D. S. Lyles, I. Kuzmin, C. E. Rupprecht, in Fields Virology, D. M. Knipe, P. M. Howley, Eds. (Lippincott Williams and Wilkins, Philadelphia, 2013), vol. 1, chap. 31, pp. 885-922. [0319] 44. J. E. Johnson, M. J. Schnell, L. Buonocore, J. K. Rose, Specific targeting to CD4+ cells of recombinant vesicular stomatitis viruses encoding human immunodeficiency virus envelope proteins. J Virol 71, 5060-5068 (1997). [0320] 45. A. De Milito, B lymphocyte dysfunctions in HIV infection. Curr HIV Res 2, 11-21 (2004). [0321] 46. S. E. Witko et al., An efficient helper-virus-free method for rescue of recombinant paramyxoviruses and rhadoviruses from a cell line suitable for vaccine development. J Virol Methods 135, 91-101 (2006). [0322] 47. P. J. Lopez, J. Guillerez, R. Sousa, M. Dreyfus, The low processivity of T7 RNA polymerase over the initially transcribed sequence can limit productive initiation in vivo. Journal of molecular biology 269, 41-51 (1997). [0323] 48. K. Inoue et al., An improved method for recovering rabies virus from cloned cDNA. J Virol Methods 107, 229-236 (2003). [0324] 49. S. Hoffenberg et al., Identification of an HIV-1 clade A envelope that exhibits broad antigenicity and neutralization sensitivity and elicits antibodies targeting three distinct epitopes. J Virol 87, 5372-5383 (2013). [0325] 50. X. Wu et al., Neutralization escape variants of human immunodeficiency virus type 1 are transmitted from mother to infant. J Virol 80, 835-844 (2006). [0326] 51. S. K. Sharma et al., Cleavage-Independent HIV-1 Env Trimers Engineered as Soluble Native Spike Mimetics for Vaccine Design. Cell Rep 11, 539-550 (2015). [0327] 52. P. de Felipe et al., E unum pluribus: multiple proteins from a self-processing polyprotein. Trends Biotechnol 24, 68-75 (2006). [0328] 53. J. J. Hansen et al., Genomic structure of the human mitochondrial chaperonin genes: HSP60 and HSP10 are localised head to head on chromosome 2 separated by a bidirectional promoter. Hum Genet 112, 71-77 (2003). [0329] 54. N. F. Rose et al., An effective AIDS vaccine based on live attenuated vesicular stomatitis virus recombinants. Cell 106, 539-549 (2001). [0330] 55. A. Morner et al., Primary human immunodeficiency virus type 2 (HIV-2) isolates, like HIV-1 isolates, frequently use CCR5 but show promiscuity in coreceptor usage. J Virol 73, 2343-2349 (1999). [0331] 56. P. J. Goulder, D. I. Watkins, Impact of MHC class I diversity on immune control of immunodeficiency virus replication. Nat Rev Immunol 8, 619-630 (2008). [0332] 57. N. Winstone et al., Enhanced control of pathogenic Simian immunodeficiency virus SIVmac239 replication in macaques immunized with an interleukin-12 plasmid and a DNA prime-viral vector boost vaccine regimen. J Virol 85, 9578-9587 (2011). [0333] 58. N. L. Yates et al., Vaccine-induced Env V1-V2 IgG3 correlates with lower HIV-1 infection risk and declines soon after vaccination. Sci Transl Med 6, 228ra239 (2014). [0334] 59. M. Wu, P. G. Stockley, W. J. Martin, 2nd, An improved western blotting technique effectively reduces background. Electrophoresis 23, 2373-2376 (2002). [0335] 60. T. L. Nolen, M. G. Hudgens, P. K. Senb, G. G. Koch, Analysis of repeated low-dose challenge studies. Stat Med 34, 1981-1992 (2015). [0336] 61. J. E. Johnson et al., In vivo biodistribution of a highly attenuated recombinant vesicular stomatitis virus expressing HIV-1 Gag following intramuscular, intranasal, or intravenous inoculation. Vaccine 27, 2930-2939 (2009). [0337] 62. Y. Huang, P. B. Gilbert, D. C. Montefiori, S. G. Self, Simultaneous Evaluation of the Magnitude and Breadth of a Left and Right Censored Multivariate Response, with Application to HIV Vaccine Development. Statistics in biopharmaceutical research 1, 81-91 (2009). [0338] 63. H. X. Liao et al., Co-evolution of a broadly neutralizing HIV-1 antibody and founder virus. Nature 496, 469-476 (2013).

    Example 3: Using VSV Evolution to Fine Tune the Env Immunogen

    [0339] The EnvG hybrid was developed with the goal of producing an immunogen that was optimal for delivery with a live VSV vector. The Env-G design objectives were to generate a modified immunogen that enabled more abundant expression on the infected cell surface and increased incorporation in VSV particles while maintaining native Env antigenic properties and the ability to direct infection and replication in cells bearing the HIV coreceptors CD4 and CCR5 (CD4+/CCR5+ cells). Systematic evaluation of several Env domain substitutions demonstrated that replacement of the Env signal peptide (SP), transmembrane region (TM), and cytoplasmic tail (CT) with analogous domains from VSV G substantially improved expression of Env on the cell surface (FIG. 1). Moreover, the surface of cells expressing the Env-G hybrid was bound by a panel of anti-Env monoclonal antibodies demonstrating that the antigenic profile was very similar to Env expressed by cells infected with HIV. Importantly, when a chimeric VSVG-Env vector was developed in which the G gene was replaced with Env-G, replication-competent recombinant virus was isolated that replicated specifically in CD4+/CCR5+ cells demonstrating that the EnvG retained functions that are essential for cell attachment and virus replication.

    [0340] The domain swap approach enabled development of a live VSVG-Env chimera that readily propagated in CD4+/CCR5+ cells. After conducting multiple rounds of amplification in CD4+/CCR5+ cells, virus emerged that grew to higher titers suggesting that one or more mutations occurred resulting in a virus with increased replicative fitness. Genomic sequence analysis conducted on this virus strain identified three amino acid substitutions in Env, which were (amino acid numbering according to reference strain HXB2): K169T in the second variable domain of Env (V2 domain), 1307T in the V3 domain, and W672R in the membrane-proximal external region (MPER). Consistent with these substitutions being the adaptive mutations that improve replicative fitness of the virus, the three amino acid changes have been stable during numerous subsequent rounds of virus propagation. Moreover, there was a substantial difference in virus quantities produced from infected cultures; VSVG-Env.BG505 with the three substitutions routinely exceeds 110e7 PFU per ml of medium while VSVG-Env.BG505 amplified prior to adaptation produced titers closer to 110e6.

    [0341] To provide additional evidence that the three substitutions were the result of adaptive mutations that improved replicative fitness, the mutations were incorporated into the VSVG-Env.BG505 genomic DNA clone and a new recombinant virus was recovered containing the Env substitutions. This new recombinant strain grew efficiently, maintained the three amino acid substitutions during many rounds of propagation, and accrued no additional EnvG mutations. These results indicated that the three amino acid substitutions provided a replicative fitness advantage for the VSVG-Env.BG505 chimera.

    [0342] The accrual of the three amino acid substitutions that enhanced replicate fitness indicated that EnvG structure likely required some additional fine tuning to support optimal VSVG-Env.BG505 growth. The substitutions probably compensated for some structural changes in the Env complex that resulted from replacement of TM and CT with VSV G sequence. Structural changes in the Env complex are known to occur when mutations are introduced into the Env TM (1) and CT (2); thus, it is reasonable to expect that replacement of the Env TM and CT with VSV G sequence will cause some structural alteration that requires compensatory second-site mutations to achieve optimal EnvG function and virus replicative fitness.

    [0343] It was noticeable that the three Env substitutions occurred in the Env ectodomain rather than in the G TM or CT. This probably reflects strong selective pressure to maintain the wild-type G TM and CT sequence, as they are optimal for VSV particle structure, and in fact, the G CT makes contact with the underlying VSV matrix protein (3). Thus, selective pressure favored accrual of compensatory amino acid changes in the Env ectodomain rather than in the G TM or CT.

    [0344] It was also notable that the adaptive mutations occurred in three separate regions of the Env ectodomain including the gp120 (V2 K169T and V3 1307T) and gp41 (MPER W672R) subunits. The mechanism by which this combination of amino acid substitutions improves replicative fitness is unknown. Furthermore, this makes it difficult to predict what substitutions might be useful for optimizing propagation of a chimeric virus like VSVG-EnvG.BG505; thus, VSV's ability to rapidly evolve when faced with selective pressure (4) is an important tool in the overall VSVG-Env vaccine design process.

    TABLE-US-00005 TABLE EnvG amino acid substitutions in VSVG-EnvG.BG505 Amino acid substitutions that accrued after multiple rounds of amplification in two independent VSVG-Env.BG505 recombinants are shown Env amino acids VSVG-Env.BG505 vaccine 169 307 672 DNA clone K I W Adapted virus T T R Repeat virus rescue and adaption 164 440 434 494 DNA clone E Q M L Adapted virus G R T F

    [0345] To demonstrate the importance of VSV evolution in design of an optimal immunogen and chimeric virus vector, an independent VSVG-Env.BG505 recombinant was isolated that lacked adaptive mutations and it was allowed to evolved during serial rounds of propagation. The results showed that the virus did in fact accrue multiple amino acid substitutions as before, but the constellation of adaptive mutations was different. After multiple rounds of amplification, this new strain had 4 substitutions (Table). Interestingly, as before, one of the substitutions was in V2 (E164G). The other three were in constant (C) domains of Env (C4 M434T, C4 Q440R, and C5 L494F).

    [0346] The VSVG-Env.BG505 vaccine containing the K169T, 1307T and W672R was found to be efficacious in the Indian Rhesus macaque SHIV challenge model.

    CITATIONS

    [0347] 1. Lovelace E, Xu H, Blish C A, Strong R, Overbaugh J. The role of amino acid changes in the human immunodeficiency virus type 1 transmembrane domain in antibody binding and neutralization. Virology. 2011; 421(2):235-44. [0348] 2. Chen J, Kovacs J M, Peng H, Rits-Volloch S, Lu J, Park D, et al. HIV-1 ENVELOPE. Effect of the cytoplasmic domain on antigenic characteristics of HIV-1 envelope glycoprotein. Science. 2015; 349(6244):191-5. [0349] 3. Ge P, Tsao J, Schein S, Green T J, Luo M, Zhou Z H. Cryo-EM model of the bullet-shaped vesicular stomatitis virus. Science. 2010; 327(5966):689-93. [0350] 4. Novella I S. Contributions of vesicular stomatitis virus to the understanding of RNA virus evolution. Curr Opin Microbiol. 2003; 6(4):399-405.

    [0351] The invention is further described by the following numbered paragraphs:

    [0352] 1. A recombinant vesicular stomatitis virus (VSV) vector wherein the gene encoding the VSV surface glycoprotein G (VSV G) is functionally replaced by functional clade A HIV Env BG505.

    [0353] 2. The vector of paragraph 1 wherein the vector contains and expresses a nucleic acid sequence encoding an amino acid sequence of an Env.BG505 immunogen encoded by the VSVG-Env.BG505.

    [0354] 3. The vector of paragraph 1, wherein the amino acid sequence of an Env.BG505 immunogen encoded by the VSVG-Env.BG505 is SEQ ID NO: 2.

    [0355] 4. The vector of paragraph 1 wherein the vector comprises the sequence of a VSVG-Env.BG505 genomic clone.

    [0356] 5. The vector of paragraph 4, wherein the sequence of a VSVG-Env.BG505 genomic clone is SEQ ID NO: 1.

    [0357] 6. The vector of any one of paragraphs 1 to 5 wherein the HIV Env is recognized by antibodies PG9, PG16, 2G12, b12, 2F5, 4E10 or Z13, or other Env-specific antibodies, including broad potent neutralizing trimer-specific antibodies.

    [0358] 7. A vaccine comprising the vector of any one of paragraphs 1 to 6.

    [0359] 8. The vaccine of paragraph 7, wherein the vaccine is a mucosal vaccine.

    [0360] 9. The vaccine of paragraph 7 or 8 wherein the vaccine is a G-pseudotyped VSVG-Env.BG505 vaccine.

    [0361] 10. A method of producing an immune response or eliciting an immune response comprising administering to a mammal the vector of any one of claims 1 to 6 or the vaccine of any one of paragraph 7 to 9.

    [0362] 11. The method of claim 10, wherein a dose is about of 210.sup.8 pfu per ml.

    [0363] 12. The method of paragraph 10 or 11, wherein the vaccine is administered to a nasal and/or oral cavity.

    [0364] 13. The method of paragraph 12, wherein the vaccine is administered to a nasal and oral cavity.

    [0365] 14. The method of paragraph 13, wherein a dose of 110.sup.8 pfu per ml is administered to each cavity.

    [0366] 15. The method of any one of paragraph 10 to 14 wherein the vaccine is administered over a vaccination schedule from about 0 to 29 weeks.

    [0367] 16. The method of paragraph 15, wherein the vaccination schedule is at 0, 4 and 29 weeks.

    [0368] Having thus described in detail preferred embodiments of the present invention, it is to be understood that the invention defined by the above paragraphs is not to be limited to particular details set forth in the above description as many apparent variations thereof are possible without departing from the spirit or scope of the present invention.