Peptides mimicking HIV-1 viral epitopes in the V2 loop for the GP120 surface envelope glycoprotein
09611294 ยท 2017-04-04
Assignee
Inventors
Cpc classification
C12N7/00
CHEMISTRY; METALLURGY
A61K2039/64
HUMAN NECESSITIES
C07K16/1063
CHEMISTRY; METALLURGY
A61K39/21
HUMAN NECESSITIES
G01N2469/20
PHYSICS
C07K7/64
CHEMISTRY; METALLURGY
C07K2319/55
CHEMISTRY; METALLURGY
C07K2317/76
CHEMISTRY; METALLURGY
C07K2317/34
CHEMISTRY; METALLURGY
C12N2799/023
CHEMISTRY; METALLURGY
A61K2039/6037
HUMAN NECESSITIES
G01N2333/162
PHYSICS
C12N2740/16122
CHEMISTRY; METALLURGY
C12N2740/16134
CHEMISTRY; METALLURGY
A61K2039/545
HUMAN NECESSITIES
International classification
C07K7/64
CHEMISTRY; METALLURGY
A61K39/21
HUMAN NECESSITIES
Abstract
The present invention relates to an isolated immunogenic peptide comprising a V2 loop fragment from HIV surface envelope glycoprotein gp120. This peptide binds specifically with antibodies in blood of patients vaccinated with a vaccine that has shown protection from HIV-1 infection, does not react with blood of matched patients who did not receive the vaccine, and can, therefore, elicit anti-HIV-1 antibodies which protect against HIV-1 infection. Other aspects of the present invention relate to an isolated immunogenic polypeptide comprising the peptide inserted into an immunogenic scaffold protein, a vaccine composition comprised of the immunogenic peptide and an immunologically or pharmaceutically acceptable vehicle or excipient as well as methods of inducing an immune response against HIV-1 and methods of detecting HIV-1.
Claims
1. An isolated, cyclized immunogenic peptide consisting of the amino acid sequence of SEQ ID NO:1.
2. The isolated immunogenic peptide of claim 1, wherein the peptide consists of the amino acid sequence of SEQ ID NO: 7.
3. The isolated immunogenic peptide of claim 1, wherein the peptide consists of the amino acid sequence of SEQ ID NO: 11.
4. The isolated immunogenic peptide of claim 1, wherein the peptide consists of the amino acid sequence of SEQ ID NO: 12.
5. The isolated immunogenic peptide of claim 1, wherein the peptide consists of the amino acid sequence of SEQ ID NO: 13.
6. The isolated immunogenic peptide of claim 1, wherein the peptide consists of the amino acid sequence of SEQ ID NO: 14.
7. The isolated immunogenic peptide of claim 1, wherein the peptide consists of the amino acid sequence of SEQ ID NO: 16.
8. An immunogenic composition comprising: the cyclized immunogenic peptide of claim 1 and an immunologically and pharmaceutically acceptable vehicle or excipient.
9. The immunogenic composition of claim 8 further comprising: an adjuvant or immunostimulatory peptide or polypeptide that is different from said immunogenic polypeptide.
10. The immunogenic composition of claim 9, wherein said immunostimulatory polypeptide is a cytokine.
11. The immunogenic composition of claim 9, wherein the adjuvant is selected from the group consisting of: (a) ISAF-1 (5% squalene, 2.5% pluronic L121, 0.2% Tween 80) in phosphate buffered solution with 0.4 mg of threonyl-muramyl dipeptide; (b) de-oiled lecithin dissolved in an oil; (c) aluminum hydroxide gel; (d) a mixture of (b) and (c); (e) QS-21; (f) monophosphoryl lipid A adjuvant; and (g) incomplete Freund's adjuvant.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
DETAILED DESCRIPTION OF THE INVENTION
(9) The present invention relates to an isolated immunogenic peptide comprising a V2 loop fragment from HIV surface envelope glycoprotein gp120. This peptide binds specifically with antibodies in blood of patients vaccinated with a vaccine that has shown protection from HIV-1 infection, does not react with blood of matched patients who did not receive the vaccine, and can, therefore, elicit anti-HIV-1 antibodies which protect against HIV-1 infection.
(10) In accordance with this aspect of the present invention, suitable isolated immunogenic peptides include peptides of the amino acid sequence X.sub.1X.sub.2DX.sub.3X.sub.4X.sub.5X.sub.6X.sub.7YX.sub.8X.sub.9X.sub.10X.sub.11X.sub.12 (SEQ ID NO: 1), where X.sub.1 is L, V, I, M, F, W or A; X.sub.2 is any amino acid; X.sub.3 is R, K or H; X.sub.4 is K, D, E, R, H, S, T, C, N, Q, Y, A, V or M; X.sub.5 is K, D, E, R, H, S, T, C, N, Q, Y or A; X.sub.6 is K, D, E, R, H, S, T, C, N, Q, Y or A; X.sub.7 is L, V, I, M, F, W, A or E; X.sub.8 is K, D, E, R, H, S, T, C, N, Q, Y or A; X.sub.9 is L, V, I, M, F, W or A; X.sub.10 is F or T, X.sub.11 is K, D, E, R, H, S, T, C, N, Q, Y or A; X.sub.12 is K, D, E, R, H, S, T, C, N, Q, Y or A. Examples of specific immunogenic peptides in accordance with the present invention include the following amino acid sequences: LRDKKQRVYSLFYK (SEQ ID NO: 7), IRDKKQRVYSLFYK (SEQ ID NO: 11), LRDKVQRVYSLFYK (SEQ ID NO: 12), LRDKKQREYSLFYK (SEQ ID NO: 13), LRDKKQRVYALFYK (SEQ ID NO: 14), or LQNKKQQVYSLFYQ (SEQ ID NO: 15).
(11) Another aspect of the present invention is an isolated immunogenic peptide including the amino acid sequence of SEQ ID NO: 2. In accordance with this aspect of the present invention, suitable isolated immunogenic peptides include peptides of the amino acid sequence of SEQ ID NO:1 with X.sub.11 as any amino acid other than Y. In particular, SEQ ID NO: 2 has the following amino acid sequence: X.sub.1X.sub.2DX.sub.3X.sub.4X.sub.5X.sub.6X.sub.7YX.sub.8X.sub.9X.sub.10X.sub.11X.sub.12, where X.sub.1 is L, V, I, M, F, W or A; X.sub.2 is any amino acid; X.sub.3 is R, K or H; X.sub.4 is K, D, E, R, H, S, T, C, N, Q, Y, A, V or M; X.sub.5 is K, D, E, R, H, S, T, C, N, Q, Y or A; X.sub.6 is K, D, E, R, H, S, T, C, N, Q, Y or A; X.sub.7 is L, V, I, M, F, W, A or E; X.sub.8 is K, D, E, R, H, S, T, C, N, Q, Y or A; X.sub.9 is L, V, I, M, F, W or A; X.sub.10 is F or T, X.sub.11 is any amino acid other than Y; X.sub.12 is K, D, E, R, H, S, T, C, N, Q, Y or A.
(12) In another aspect of the present invention, the isolated immunogenic peptide comprises the amino acid sequence of LRDKMQKVYALTYK (SEQ ID NO: 16). This is a sequence that does not occur in nature and has a mutation, relative to the amino acid sequence of SEQ ID: 1, which requires Y at position X.sub.11. This destroys a cathepsin protease cleavage site.
(13) The present invention also relates to an isolated immunogenic polypeptide of the present invention comprising the isolated immunogenic peptide described above and an immunogenic scaffold protein. The polypeptide has a conformation that is recognized by, and bound by, a broadly neutralizing anti-HIV-1 antibody.
(14) As used herein, a broadly neutralizing antibody or antibody response is an antibody or response that results in binding and neutralization of at least one group of heterologous HIV-1 viruses that are members of a different subtype or clade than that of the source of the immunizing antigen. The scaffold protein can be one that is highly immunogenic and capable of enhancing the immunogenicity of any heterologous sequences fused to/inserted in it. Suitable scaffold proteins include, without limitation, a cholera toxin and an enterotoxin.
(15) In one embodiment of the present invention, the scaffold protein is cholera toxin subunit B (CTB). CTB is highly immunogenic and has been used in fusion constructs to enhance immunogenicity of its fusion partner polypeptide or peptide (McKenzie et al., Cholera Toxin B Subunit as a Carrier to Stimulate a Mucosal Immune Response, J Immunol. 133:1818-1824 (1984); Czerkinsky et al., Oral Administration of a Streptococcal Antigen Coupled to Cholera Toxin B Subunit Evokes Strong Antibody Responses in Salivary Glands and Extramucosal Tissues, Infect Immun. 57:1072-1077 (1989), each of which is hereby incorporated by reference in its entirety). CTB has also been described as a mucosal adjuvant for vaccines (Areas et al., Expression and Characterization of Cholera Toxin B-Pneumococcal Surface Adhesin A Fusion Protein in Escherichia Coli: Ability of CTB-PsaA to Induce Humoral Immune Response in Mice, Biochem Biophys Res Commun. 321:192-196 (2004), which is hereby incorporated by reference in its entirety).
(16) In another embodiment of the present invention, the scaffold protein is an E. coli enterotoxin, preferably heat labile entertoxin. This protein is also highly immunogenic and has been used in fusion constructs to enhance immunogenicity of its fusion partner polypeptide or peptide (Lipscombe et al., Intranasal Immunization Using the B Subunit of the Escherichia Coli Heat Labile Toxin Fused to an Epitope of the Bordetella Pertussis P.69 Antigen, Mol. Microbiol. 5:1385-1392 (1991), which is hereby incorporated by reference in its entirety).
(17) An important factor for the immunogenic property of CTB and heat labile enterotoxin is their binding to GM1 ganglioside, which is present on the surface of mucosal cells. This results in its propensity to induce mucosal immunity and is highly desirable for an HIV immunogen or vaccine, because infection commonly occurs via a mucosal route. In addition, the availability of structural information of these proteins allows protein design that avoids or minimizes disruption of the GM1 binding site, thereby preserving the inherent immunogenicity of these polypeptides.
(18) In accordance with this aspect of the present invention, the immunogenic peptide can be inserted directly into the scaffold's tertiary structure. This yields a polypeptide in which an exceptionally high fraction of the molecular surface presents V2 epitopes that are recognized by broadly-reactive neutralizing anti-gp120 antibodies and can elicit anti-HIV-1 antibody responses that preferably are broadly-reactive and neutralize the virus. Molecular modeling is used to test in-silico, whether various insertion positions in the scaffold and different loop lengths result in loop conformations that present the epitopes. Specifically, there are two approaches. Firstly, the scaffold is scanned for amino-acid positions that can be superimposed on the termini of the loop as observed in the V2/antibody complex. When superposition within small tolerances (<0.5 .ANG. root mean square deviation (RMSD) for the terminal residues is achieved, the model is evaluated for the absence of clashes with the scaffold structure. Secondly, the loop is inserted in a random conformation and subjected to conformational sampling. Low energy conformations generated during sampling are compared to the desired V2 conformation as observed in the V2/antibody complex. Sampling is over a restricted energy range. When the construct is such that conformations within 1.0 .ANG. backbone RMSD of the desired V2 conformation are identified in the simulation, a model of the immunogen-antibody complex is built to ensure that the scaffold does not interfere with the V2 loop/antibody binding.
(19) The isolated immunogenic peptides described above may also exist in a cyclized form. These cyclic peptides can be synthesized and include two cysteine residues that bond via a disulfide linkage forming the cyclic peptide. Alternatively, the peptide may be cyclized by chemical means without relying upon disulfide bonding of two cysteine residues, for example, by introduction of a linker.
(20) The cyclic peptide compositions of the present invention may be synthesized using ordinary skill in the art of organic synthesis and peptide synthesis. Methods for restricting the secondary structure of peptides and proteins are highly desirable for the rational design of therapeutically useful conformationally-restricted (or locked) pharmacophores. The purely chemical approaches for restricting secondary structure often require extensive multistep syntheses (Olson, G. L., J. Am. Chem. Soc. 112:323 (1990)). An alternative approach involves installing covalent bridges in peptides. However, due to the sensitivity of the peptide backbone and side chains, this method necessitates careful protection/deprotection strategies.
(21) The general guiding principles determining the design of useful cyclic peptides are well-known in the art and are dictated by the need to maintain the antibody reactivity and immunogenicity of the V2 peptide, particularly for induction of broadly reactive, neutralizing antibodies while enhancing its stability as well as the ability to be inserted into a desired scaffold protein without disrupting the function of the latter, i.e., immunogenicity and other binding characteristics of the scaffold such as the binding of recombinant V2-CTB to the glycolipid targets of CTB. In addition to testing a cyclic peptide serologically, it may be analyzed more extensively by structural (biophysical) techniques, such as NMR spectroscopy or X-ray crystallographic methods, in solution or when bound to a characterizing broadly-reactive neutralizing monoclonal antibody such as 447-52D (see publication WO04/069863, which is hereby incorporated by reference in its entirety)
(22) The one or more peptides in the present invention can be synthesized by solid phase or solution phase peptide synthesis, recombinant expression, or can be obtained from natural sources. Automatic peptide synthesizers are commercially available from numerous suppliers, such as Applied Biosystems, Foster City, Calif. Standard techniques of chemical peptide synthesis are well known in the art (see e.g., S
(23) Recombinantly expressed peptides can be purified using any one of several methods readily known in the art, including ion exchange chromatography, hydrophobic interaction chromatography, affinity chromatography, gel filtration, and reverse phase chromatography. The peptide is preferably produced in purified form (preferably at least about 80% to 85% pure, more preferably at least about 90% or 95% pure) by conventional techniques. Depending on whether the recombinant host cell is made to secrete the peptide into growth medium (see U.S. Pat. No. 6,596,509 to Bauer et al., which is hereby incorporated by reference in its entirety), the peptide can be isolated and purified by centrifugation (to separate cellular components from supernatant containing the secreted peptide) followed by sequential ammonium sulfate precipitation of the supernatant. The fraction containing the peptide is subjected to gel filtration in an appropriately sized dextran or polyacrylamide column to separate the peptides from other proteins. If necessary, the peptide fraction may be further purified by HPLC.
(24) Another aspect of the present invention is directed to an immunogenic vaccine composition comprising the linear or cyclized isolated immunogenic peptides or polypeptides described above, and an immunologically and pharmaceutically acceptable vehicle or excipient.
(25) Suitable vehicles and excipients are described in R
(26) Vaccine compositions can also include large, slowly metabolized macromolecules such as proteins, polysaccharides such as chitosan, polylactic acids, polyglycolic acids and copolymers (such as latex functionalized sepharose, agarose, cellulose), polymeric amino acids, amino acid copolymers, and lipid aggregates (such as oil droplets or liposomes).
(27) The vaccine composition of the present invention may also be supplemented with an immunostimulatory cytokine. Preferred cytokines are GM-CSF (granulocyte-macrophage colony stimulating factor), interleukin 1, interleukin 2, interleukin 12, interleukin 18, or interferon-gamma.
(28) The vaccine composition of the present invention can further contain an adjuvant. One class of preferred adjuvants is aluminum salts, such as aluminum hydroxide, aluminum phosphate, or aluminum sulfate. Such adjuvants can be used with or without other specific immunostimulating agents such as MPL or 3-DMP, QS-21, flagellin, polymeric or monomeric amino acids such as polyglutamic acid or polylysine, or pluronic polyols. Oil-in-water emulsion formulations are also suitable adjuvants that can be used with or without other specific immunostimulating agents such as muramyl peptides (e.g., N-acetylmuramyl-L-threonyl-D-isoglutamine (thr-MDP), N-acetyl-normuramyl-L-alanyl-D-isoglutamine (nor-MDP), N-acetylmuramyl-L-alanyl-D-isoglutaminyl-L-alanine-2-(1-2dipalmitoyl-sn-glycero-3-hydroxyphosphoryloxy)-ethylamine (MTP-PE), N-acetylglucsaminyl-N-acetylmuramyl-L-Al-D-isoglu-L-Ala-dipalmitoxy propylamide (DTP-DPP) Theramide, or other bacterial cell wall components). A suitable oil-in-water emulsion is MF59 (containing 5% Squalene, 0.5% Tween 80, and 0.5% Span 85 (optionally containing various amounts of MTP-PE) formulated into submicron particles using a microfluidizer such as Model 110Y Microfluidizer (Microfluidics, Newton Mass.) as described in WO90/14837 to Van Nest et al., which is hereby incorporated by reference in its entirety. Other suitable oil-in-water emulsions include SAF (containing 10% Squalene, 0.4% Tween 80, 5% Pluronic-blocked polymer L121, and thr-MDP, either microfluidized into a submicron emulsion or vortexed to generate a larger particle size emulsion) and Ribi adjuvant system (RAS; containing 2% squalene, 0.2% Tween 80, and one or more bacterial cell wall components). Another class of suitable adjuvants are saponin adjuvants, such as Stimulon (QS-21) or particles generated therefrom such as ISCOMs (immunostimulating complexes) and ISCOMATRIX. Other suitable adjuvants include incomplete or complete Freund's Adjuvant (IFA). Such adjuvants are generally available from commercial sources.
(29) Another aspect of the present invention relates to a method of inducing a broadly neutralizing antibody response against a V2 epitope of HIV-1 gp120 in a subject. This method comprises administering to the subject the immunogenic peptide, cyclized peptide, or polypeptides, described above, under conditions effective to induce, in the subject, a neutralizing antibody response against the V2 epitope of the HIV-1 gp120. In a preferred embodiment of this aspect, the selected subject is HIV-1 positive.
(30) In accordance with this aspect of the present invention, a neutralizing antibody response is an antibody or response that results in binding and neutralization of at least one group of heterologous HIV-1 viruses that are members of a different subtype or clade than that of the source of the immunizing antigen. Such a response is an active response induced by administration of the immunogenic peptide or polypeptide and represents a means for vaccination against HIV-1.
(31) An MT-2 assay can be performed to measure neutralizing antibody responses. Antibody-mediated neutralization of selected strains or isolates of HIV-1 can be measured in an MT-2 cell-killing assay (Montefiori et al., Evaluation of Antiviral Drugs and Neutralizing Antibodies to Human Immunodeficiency Virus By a Rapid and Sensitive Microtiter Infection Assay, J Clin Microbiol. 26(2):2310-235 (1988), which is hereby incorporated by reference in its entirety). HIV-1.sub.IIIB and HIV-1.sub.MN induce the formation of syncytia in MT-2 cells. The inhibition of the formation of syncytia by the sera shows the activity of neutralizing antibodies present within the sera, induced by vaccination. Immunized test and control sera can be exposed to virus-infected cells (e.g. cells of the MT-2 cell line). Neutralization can be measured by any method that determines viable cells, such as staining, e.g., with Finter's neutral red. Percentage protection can be determined by calculating the difference in absorption between test wells (cells+virus) and dividing this result by the difference in absorption between cell control wells (cells only) and virus control wells (virus only). Neutralizing titers may be expressed, for example, as the reciprocal of the plasma dilution required to protect at least 50% of cells from virus-induced killing.
(32) Another aspect of the present invention relates to a method of inducing a protective and non-neutralizing antibody response against a V2 epitope of HIV-1 gp120 in a subject. This method comprises administering to the subject the immunogenic peptide, cyclized peptide, or polypeptides, as described above, under conditions effective to induce, in the subject, a protective, non-neutralizing antibody response against the V2 epitope of the HIV-1 gp120. In a preferred embodiment of this aspect, the selected subject is HIV-1 positive.
(33) In accordance with this aspect of the present invention, non-neutralizing antibodies will not impair virus entry into cells. However, a non-neutralizing antibody response will trigger antibody-dependent cell-mediated viral inhibition (ADCVI), which may be effective against HIV-1 (Asmal et al., Antibody Dependent Cell Mediated Viral Inhibition Emerges After Simian Immunodeficiency Virus SIVmac251 Infection of Rhesus Monkeys Coincident With gp140-Binding Antibodies and is Effective Against Neutralization Resistant Viruses, J. Virol. 85(11) 5465-5475 (2011), which is hereby incorporated by reference in its entirety).
(34) ADCVI can be measured by infecting polybrene-treated CEM.NKR-CCR5 cells (National Institutes of Health AIDS Research and Reference Program) with a clinical strain of HIV-1 (HIV-1.sub.92US657). The addition of effector cells from healthy donors and sera from vaccine subjects to the infected target cells can lead to ADCVI. Levels of p24, as determined by ELISA can determine the presence of ADCVI (Forthal et al., Recombinant gp120 Vaccine-Induced Antibodies Inhibit Clinical Strains of HIV-1 in the Presence of Fc Receptor Bearing Effector Cells and Correlate Inversely with HIV Infection Rate, J of Immunol. 178(10): 6596-6603 (2007), which is hereby incorporated by reference in its entirety).
(35) Another aspect of the present invention relates to a method of inducing protective antibodies against a V2 epitope of HIV-1 gp120 in a subject. This method comprises administering to the subject the immunogenic peptide, cyclized peptide, or polypeptide, as described above, under conditions effective to induce, in the subject, a protective antibody response against the V2 epitope of the HIV-1 gp120. In one embodiment, the selected subject is HIV-1 positive.
(36) The presence of a protective humoral immunological response can be determined and monitored by testing a biological sample (e.g., blood, plasma, serum, urine, saliva, feces, CSF or lymph fluid) from the subject for the presence of antibodies directed to the immunogenic component of the administered pharmaceutical composition.
(37) The immunization protocol preferably includes at least one priming dose, followed by one or multiple boosting doses administered over time. An exemplary range for an immunogenically effective amount of the present immunogenic polypeptides is about 5 to about 500 g/kg body weight. A preferred range is about 10-100 g/kg.
(38) Compositions of the present invention can be administered by parenteral, topical, intravenous, oral, subcutaneous, intraperitoneal, intranasal, or intramuscular means. The most typical route of administration for compositions formulated to induce an immune response is subcutaneous, although others can be equally effective. The next most common is intramuscular injection. This type of injection is most typically performed in the arm or leg muscles. Intravenous injections as well as intraperitoneal injections, intra-arterial, intracranial, or intradermal injections are also effective in generating an immune response.
(39) The compositions of the present invention may be formulated for parenteral administration. Solutions or suspensions of the agent can be prepared in water suitably mixed with a surfactant such as hydroxypropylcellulose. Dispersions can also be prepared in glycerol, liquid polyethylene glycols, and mixtures thereof in oils. Illustrative oils are those of petroleum, animal, vegetable, or synthetic origin, for example, peanut oil, soybean oil, or mineral oil. In general, water, saline, aqueous dextrose and related sugar solution, and glycols, such as propylene glycol or polyethylene glycol, are preferred liquid carriers, particularly for injectable solutions. Under ordinary conditions of storage and use, these preparations contain a preservative to prevent the growth of microorganisms.
(40) Vaccine formulations suitable for injectable use include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions. In all cases, the form must be sterile and must be fluid to the extent that easy syringability exists. It must be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms, such as bacteria and fungi. The carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (e.g., glycerol, propylene glycol, and liquid polyethylene glycol), suitable mixtures thereof, and vegetable oils.
(41) When it is desirable to deliver the vaccine of the present invention systemically, it may be formulated for parenteral administration by injection, e.g., by bolus injection or continuous infusion. Formulations for injection may be presented in unit dosage form, e.g., in ampoules or in multi-dose containers, with an added preservative. The compositions may take such forms as suspensions, solutions, or emulsions in oily or aqueous vehicles, and may contain formulatory agents such as suspending, stabilizing, and/or dispersing agents.
(42) Intraperitoneal or intrathecal administration of the agents of the present invention can also be achieved using infusion pump devices such as those described by Medtronic, Northridge, Calif. Such devices allow continuous infusion of desired compounds avoiding multiple injections and multiple manipulations.
(43) In addition to the formulations described previously, the agents may also be formulated as a depot preparation. Such long acting formulations may be formulated with suitable polymeric or hydrophobic materials (for example as an emulsion in an acceptable oil) or ion exchange resins, or as sparingly soluble derivatives, for example, as a sparingly soluble salt.
(44) The present invention is further directed to an isolated antibody raised against the immunogenic peptide or polypeptide of the present invention. The isolated antibody of the present invention encompasses any immunoglobulin molecule that specifically binds the V2 epitope of HIV-1 gp120. As used herein, the term antibody is meant to include intact immunoglobulins derived from natural sources or from recombinant sources, as well as immunoreactive portions (i.e., antigen binding portions) of intact immunoglobulins. The antibodies of the present invention may exist in a variety of forms including, for example, polyclonal antibodies, monoclonal antibodies, intracellular antibodies (intrabodies), antibody fragments (e.g. Fv, Fab and F(ab)2), as well as single chain antibodies (scFv), chimeric antibodies and humanized antibodies (Ed Harlow and David Lane, U
(45) Antibodies of the present invention may also be synthetic antibodies. A synthetic antibody is an antibody which is generated using recombinant DNA technology, such as, for example, an antibody expressed by a bacteriophage. Alternatively, the synthetic antibody is generated by the synthesis of a DNA molecule encoding and expressing the antibody of the present invention or the synthesis of an amino acid specifying the antibody, where the DNA or amino acid sequence has been obtained using synthetic DNA or amino acid sequence technology which is available and well known in the art.
(46) Methods for monoclonal antibody production may be carried out using the techniques described herein or other well-known in the art (M
(47) The antibody-secreting lymphocytes are then fused with myeloma cells or transformed cells, which are capable of replicating indefinitely in cell culture, thereby producing an immortal, immunoglobulin-secreting cell line. Fusion with mammalian myeloma cells or other fusion partners capable of replicating indefinitely in cell culture is achieved by standard and well-known techniques, for example, by using polyethylene glycol (PEG) or other fusing agents (Milstein and Kohler, Derivation of Specific Antibody-Producing Tissue Culture and Tumor Lines by Cell Fusion, Eur J Immunol 6:511 (1976), which is hereby incorporated by reference in its entirety). The immortal cell line, which is preferably murine, but may also be derived from cells of other mammalian species, is selected to be deficient in enzymes necessary for the utilization of certain nutrients, to be capable of rapid growth, and have good fusion capability. The resulting fused cells, or hybridomas, are cultured, and the resulting colonies screened for the production of the desired monoclonal antibodies. Colonies producing such antibodies are cloned, and grown either in vivo or in vitro to produce large quantities of antibody.
(48) Alternatively monoclonal antibodies can be made using recombinant DNA methods as described in U.S. Pat. No. 4,816,567 to Cabilly et al, which is hereby incorporated by reference in its entirety. The polynucleotides encoding a monoclonal antibody are isolated from mature B-cells or hybridoma cells, for example, by RT-PCR using oligonucleotide primers that specifically amplify the genes encoding the heavy and light chains of the antibody. The isolated polynucleotides encoding the heavy and light chains are then cloned into suitable expression vectors, which when transfected into host cells such as E. coli cells, simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, monoclonal antibodies are generated by the host cells. Also, recombinant monoclonal antibodies or fragments thereof of the desired species can be isolated from phage display libraries (McCafferty et al., Phage Antibodies: Filamentous Phage Displaying Antibody Variable Domains, Nature 348:552-554 (1990); Clackson et al., Making Antibody Fragments using Phage Display Libraries, Nature 352:624-628 (1991); and Marks et al., By-Passing Immunization. Human Antibodies from V-Gene Libraries Displayed on Phage, J. Mol. Biol. 222:581-597 (1991), which are hereby incorporated by reference in their entirety).
(49) The polynucleotide(s) encoding a monoclonal antibody can further be modified using recombinant DNA technology to generate alternative antibodies. For example, the constant domains of the light and heavy chains of a mouse monoclonal antibody can be substituted for those regions of a human antibody to generate a chimeric antibody. Alternatively, the constant domains of the light and heavy chains of a mouse monoclonal antibody can be substituted for a non-immunoglobulin polypeptide to generate a fusion antibody. In other embodiments, the constant regions are truncated or removed to generate the desired antibody fragment of a monoclonal antibody. Furthermore, site-directed or high-density mutagenesis of the variable region can be used to optimize specificity and affinity of a monoclonal antibody.
(50) The monoclonal antibody of the present invention can be a humanized antibody. Humanized antibodies are antibodies that contain minimal sequences from non-human (e.g., murine) antibodies within the variable regions. Such antibodies are used therapeutically to reduce antigenicity and human anti-mouse antibody responses when administered to a human subject. In practice, humanized antibodies are typically human antibodies with minimal to no non-human sequences. A human antibody is an antibody produced by a human or an antibody having an amino acid sequence corresponding to an antibody produced by a human.
(51) Procedures for raising polyclonal antibodies are also well known. Typically, such antibodies can be raised by administering the peptide or polypeptide containing the epitope of interest (i.e. polymerized first or second peptides or fusion peptides) subcutaneously to rabbits (e.g. New Zealand white rabbits), goats, sheep, swine or donkeys which have been bled to obtain pre-immune serum. The antigens can be injected in combination with an adjuvant. The rabbits are bled approximately every two weeks after the first injection and periodically boosted with the same antigen three times every six weeks. Polyclonal antibodies are recovered from the serum by affinity chromatography using the corresponding antigen to capture the antibody. This and other procedures for raising polyclonal antibodies are disclosed in Ed Harlow and David Lane, U
(52) In addition to whole antibodies, the present invention encompasses binding portions of such antibodies. Such binding portions include the monovalent Fab fragments, Fv fragments (e.g., single-chain antibody, scFv), and single variable V.sub.H and V.sub.L domains, and the bivalent F(ab).sub.2 fragments, Bis-scFv, diabodies, triabodies, minibodies, etc. These antibody fragments can be made by conventional procedures, such as proteolytic fragmentation procedures, as described in James Goding, M
(53) It may further be desirable, especially in the case of antibody fragments, to modify the antibody in order to increase its serum half-life. This can be achieved, for example, by incorporation of a salvage receptor binding epitope into the antibody fragment by mutation of the appropriate region in the antibody fragment or by incorporating the epitope into a peptide tag that is then fused to the antibody fragment at either end or in the middle (e.g., by DNA or peptide synthesis).
(54) Antibody mimics are also suitable for use in accordance with the present invention. A number of antibody mimics are known in the art including, without limitation, those known as monobodies, which are derived from the tenth human fibronectin type III domain (.sup.10Fn3) (Koide et al., The Fibronectin Type III Domain as a Scaffold for Novel Binding Proteins, J. Mol Biol 284:1141-1151 (1998); Koide et al., Probing Protein Conformational Changes in Living Cells by Using Designer Binding Proteins: Application to the Estrogen Receptor, Proc Natl Acad Sci USA 99:1253-1258 (2002), each of which is hereby incorporated by reference in its entirety); and those known as affibodies, which are derived from the stable alpha-helical bacterial receptor domain Z of staphylococcal protein A (Nord et al., Binding Proteins Selected from Combinatorial Libraries of an alpha-helical Bacterial Receptor Domain, Nature Biotechnol 15(8):772-777 (1997), which is hereby incorporated by reference in its entirety).
(55) The present invention is further directed to a method of detecting whether a subject is infected with HIV-1. This method includes providing a sample from the subject. The sample is contacted with the immunogenic peptide described above under conditions effective to cause an immunogenic reaction between antibodies in the sample and the immunogenic peptide. Any subject, where the contacting results in the immunogenic reaction, is identified as being infected with HIV-1. The diagnosis of HIV-1 is based on the detection of V2-specific antibodies in the subject. The presence of antibodies reactive with the V2-specific peptides can be detected using standard electrophoretic and immunodiagnostic techniques, including immunoassays such as competition, direct reaction, or sandwich type assays. Such assays include, but are not limited to: western blots; agglutination tests; enzyme-labeled and mediated immunoassays, such as ELISAs; biotin/avidin type assays; radioimmunoassays; immunoelectrophoresis; immunoprecipitation, etc. The reactions generally involve using labels such as fluorescent, chemiluminescent, radioactive, or enzymatic labels or dye molecules, or other methods for detecting the formation of a complex between the antigen and the antibody.
EXAMPLES
(56) The following examples are provided to illustrate embodiments of the present invention but they are by no means intended to limit its scope.
Materials and Methods for Examples 1-4
(57) Specimens.
(58) The initial pilot studies were performed using various sets of plasma from the RV144 participants which were selected randomly, evenly balanced for men and women, and derived from participants at visit 1 (pre-bleed), visit 8 (week 26 after the first immunization [two weeks after the last immunization]), and visit 9 (52 weeks). The pilot studies were performed with plasma sets C (SZP, PB), A and L (GT, BH), and Z (MR, NK). Subsequently, case-control plasma specimens, described above, were tested for the primary and secondary variables selected as described above and in Haynes et al., Immune Correlates Analysis of the ALVAC-AIDSVAX HIV-1 Vaccine Efficacy Trial, N Engl J Med. 366:1275-1286 (2012), which is hereby incorporated by reference in its entirety.
(59) Written informed consent and counseling was conducted as described previously (Rerks-Ngarm et al., Vaccination with ALVAC and AIDSVAX to Prevent HIV-1 Infection in Thailand, N Engl J Med 361:2209-2220 (2009); Haynes et al., Immune Correlates Analysis of the ALVAC-AIDSVAX HIV-1 Vaccine Efficacy Trial, N Engl J Med. 366:1275-1286 (2012), each of which is hereby incorporated by reference in its entirety), and the protocol was reviewed by the ethics committees of the Thai Ministry of Public Health, the Royal Thai Army, Mahidol University, and the Human Subjects Research Review Board of the U.S. Army Medical Research and Materiel Command. It was also independently reviewed and endorsed by the World Health Organization and the Joint United Nations Program on HIV/AIDS and by the AIDS Vaccine Research Working Group of the National Institute of Allergy and Infectious Diseases at the National Institutes of Health. The manufacturers were full trial collaborators and were a part of the Phase III trial steering committee.
(60) ELISA for Cyclic Peptides and Recombinant gp120 (NK).
(61) This assay was previously described (Haynes et al., Immune Correlates Analysis of the ALVAC-AIDSVAX HIV-1 Vaccine Efficacy Trial, N Engl J Med. 366:1275-1286 (2012), which is hereby incorporated by reference in its entirety). Briefly, U-bottom ELISA plates were coated with either 1 g/ml of cyclic peptide (Table 1) or with 3 g/ml of AIDSVAX recombinant gp120 immunogen A244 or MN.
(62) TABLE-US-00001 TABLE1 V2-RelatedReagentsandAssaysUsedinthePilotandCase-ControlledAnalysis Usedfor Assayand Pilot Case- Reagents/LabPI Study control ELISA/Karasavva .sup.aCyclicV2
+ + (AAs157-198) (SEQIDNO:66) Cyclicscrambled
QVLFKDIHKIVKPLYA
+ + V2crown (SEQIDNO:69) Cyclicscrambled CENLTDKMFTSR
SESRLDETNYNISC + + V2flanks (SEQIDNO:70) ELISA/Zolla-Pazner .sup.bPeptide1: LRDKKQRVYSLFYKLDVVQIN + Mostpolar (SEQIDNO:3) V2sequence (AAs165-185) Peptide2Most IRDKVQKEYALFYKLDVVPID + common40 (SEQIDNO:4) AAV2sequence Peptide3Most LRDKKQQVYSLFYRLDIEKIN + polar40 (SEQIDNO:5) AAV2sequence Peptide4 IRDKKQKEYALFYKLDVVPID + Consensus40 (SEQIDNO:6) AAV2sequence Peptide6:First LRDKKQRVYSLFYK + + 14AAofPeptide (SEQIDNO:7) 1(AAs165-178) Peptide6G:First GGGLRDKKQRVYSLFYK + 14AAofPeptide (SEQIDNO:10) 1withlinker Peptide7: KQRVYSLFYKLDVV + Central14-mer (SEQIDNO:8) ofpeptide1 Peptide8:C-term YSLFYKLDVVQIN + 13-merPeptide1 (SEQIDNO:9) Peptide17: GGGIRDKKQRVYSLFYK + L165IMutant (SEQIDNO:11) ofPeptide6 Peptide18: GGGLRDKVQRVYSLFYK + K169VMutant (SEQIDNO:12) ofPeptide6 Peptide19: GGGLRDKKQREYSLFYK + V172EMutant (SEQIDNO:13) ofPeptide6 Peptide20: GGGLRDKKQRVYALFYK + S174AMutant (SEQIDNO:14) ofPeptide6 .sup.aCyclicV2
+ + (AAs157-198) (SEQIDNO:66) qp70-V1V2 CVTLNCIDLRNATNATSNSNTTNTTSSSGGLMMEQGEIKNCSFNITTSIRDKVQ + + [fromsubtype KEYALFYKLDIVPIDNPANSTNYRLISC BCaseA2] (SEQIDNO:71) ELISA/Berman V2A244-92TH023
+ + peptide (SEQIDNO:72) V2MNpeptide ITTSIGDKMQKEYALLYKLDIEP + + (SEQIDNO:73) ELISA/Tomaras V2peptideK178 KK
KKK + (SEQIDNO:74) SPR/Rao CyclicV2
QVLFKDIHKIVKPLYA
+ + scrambledcrown (SEQIDNO:69) .sup.aCyclicV2
+ + (AAs157-198) (SEQIDNO:66) Luminex/Tomaras IgGbindingto KK
KKK + + biotinylated (SEQIDNO:74) V2peptideK178 IgAbindingto KK
KKK + + biotinylated (SEQIDNO:74) V2peptideK178 *Hotspot/ * + + Montefiori .sup.aCyclic V2 (amino acids 157-198) was used in assays in three labs as shown. Throughout this table, bold italicized V2 sequences are identical to the subtype E 92TH023 used in the prime; underlined sequences represent scrambled sequences or linkers; italicized sequences represent the sequence the central amino acidss in an extremely polar V2 in subtype A strain QB585.2102M.Ev1v5.C with individual mutations shown in bold; plain black represents sequences chosen for particular properties, as described; bold underlined sequences represent the V1V2 from subtype B Case A2 (Pinter et al., Potent Neutralization of Primary HIV-1 Isolates By Antibodies Directed Against Epitopes Present in the V1/V2 Domain of HIV-1 gp120, Vaccine 16: 1803-1811 (1998), which is hereby incorporated by reference in its entirety) and the central 23-mer of V2 from subtype B strain MN. .sup.bAll peptides were biotinylated at the N-terminus with the exception of peptide K178 and peptide V2 A244-92TH023 which were biotinylated at the C-terminus. *Multiple V2 peptides from various strains (see Table 1 and Karasavvas et al., The Thai Phase Iii Clinical Trial (RV144) Induces the Generation of Antibodies that Target a Conserved Region Within the V2 Loop of gp120; The Thai Phase Iii Clinical Trial (RV144) Induces the Generation of Antibodies that Target a Conserved Region Within the V2 Loop of gp120, Abstract OA07.08 LB; Bangkok, Thailand. pp. OA07.08 LB (2011), which is hereby incorporated by reference in its entirety).
(63) After washing, two-fold serial dilutions of plasma at an initial dilution of 1:100 or, alternatively, anti-V2 human monoclonal antibodies 2158 or 697-D (Gorny et al., Human Anti-V2 Monoclonal Antibody That Neutralizes Primary But Not Laboratory Isolates of HIV-1, J. Virol. 68:8312-8320 (1994); Pinter at al., The V1/V2 Domain of gp120 is a Global Regulator of Sensitivity of Primary Human Immunodeficiency Virus Type 1 Isolates to Neutralization by Antibodies Commonly Induced Upon Infection, J. Virol. 78:5205-5215 (2004), each of which is hereby incorporated by reference in its entirety) were used at concentrations of 0.002-10 g/ml. Color was developed with HRP-conjugated goat anti-human IgG and substrate, and read A405 nm. The background value was determined from wells that did not contain recombinant proteins or peptides.
(64) Biotinylated Linear Peptide ELISAs (SZP).
(65) This assay was previously described (Haynes et al., Immune Correlates Analysis of the ALVAC-AIDSVAX HIV-1 Vaccine Efficacy Trial, N Engl J Med. 366:1275-1286 (2012), which is hereby incorporated by reference in its entirety). Briefly, StreptaWell ELISA plates (Roche) were coated with 1 g/ml of one of several N-terminus biotinylated linear V2 peptides (Table 1); the plates were washed and incubated with RV144 plasma specimens diluted 1:100 in RPMI medium containing 15% fetal bovine sera. Alkaline phosphatase (AP)-conjugated goat anti-human IgG and diethanolamine substrate were used to develop color which was read at A405 nm. At each step, every well contained 50 l; specimens were run in duplicate in each experiment, and three experiments were performed.
(66) Binding ELISA with gp70-V1V2 (SZP).
(67) This method was previously described (Haynes et al., Immune Correlates Analysis of the ALVAC-AIDSVAX HIV-1 Vaccine Efficacy Trial, N Engl J Med. 366:1275-1286 (2012), which is hereby incorporated by reference in its entirety). Briefly, plates were coated with 1 g/ml gp70-V1V2 (Table 1 and Pinter et al., Potent Neutralization of Primary HIV-1 Isolates by Antibodies Directed Against Epitopes Present in the V1N2 Domain of HIV-1 gp120, Vaccine 16:1803-1811 (1998), which is hereby incorporated by reference in its entirety), washed, and then incubated for 1.5 h at 37 C. with RV144 plasma diluted 1:100 in RPMI containing 15% fetal bovine sera. After further washing, bound antibodies were visualized using AP-conjugated goat anti-human IgG and diethanolamine substrate, and read at 405 nm. At each step, every well contained 50 l; specimens were run in duplicate in each experiment, and three experiments were performed.
(68) V2 Linear Peptide ELISA (PB).
(69) These assays were performed as previously described (Gilbert et al., Correlation Between Immunologic Responses to a Recombinant Glycoprotein 120 Vaccine and Incidence of HIV-1 Infection in a Phase 3 HIV-1 Preventative Vaccine Trial, J Infect Dis. 191:666-677 (2005), which is hereby incorporated by reference in its entirety). Briefly, plates were coated with 0.5 g/well of peptide (Table 1) and incubated overnight at 4 C. Three-fold dilutions of test sera were run in duplicate using a starting dilution of 1:30. HRP-labeled anti-human IgG and substrate (OPD) were used to develop color.
(70) ELISAs of Linear and Cyclic Peptides and gp70-V1V2 (GT).
(71) Direct binding ELISAs were conducted as previously described (Haynes et al., Immune Correlates Analysis of the ALVAC-AIDSVAX HIV-1 Vaccine Efficacy Trial, N Engl J Med. 366:1275-1286 (2012), which is hereby incorporated by reference in its entirety) in 384-well ELISA plates coated with 2 g/ml of linear or cyclic V2 peptides or gp70-V1V2 and incubated with three-fold serial dilutions of plasma at a starting dilution of 1:50, followed by washing and incubation with 10 l of HRP-conjugated goat anti-human Ig secondary antibody and substrate (SureBlue Reserve) Plates were read at 450 nm.
(72) Overlapping Peptide Microarray Assay (DM).
(73) The arrays measured reactivity with 15-mer peptides with 12 residue overlaps. Raw peptide microarray data were processed and analyzed as described in Tomaras et al. Initial B-cell Responses to Transmitted Human Immunodeficiency Virus Type 1: Virion-Binding Immunoglobulin M (IgM) and IgG Antibodies Followed by Plasma Anti-gp41 Antibodies With Ineffective Control of Initial Viremia, J. Virol. 82:12449-12463 (2008), which is hereby incorporated by reference in its entirety. Peptide sequences were provided by LANL to cover the entire gp160 HIV Env from six HIV-1 Group M subtypes (A, B, C, D, CRF01_AE and CRF02_AG) for a total of 1423 peptides. The specific peptides were determined by LANL's method for generating the mosaic peptide set (Ngo et al., Identification and Testing of Control Peptides for Antigen Microarrays, Journal of Immunological Methods. 343:68-78 (2009), which is hereby incorporated by reference in its entirety) and were manufactured by JPT Peptide Technologies (Berlin, Germany).
(74) Surface Plasmon Resonance (MR).
(75) Measurements were conducted with a Biacore T100 as previously described (Haynes et al., Immune Correlates Analysis of the ALVAC-AIDSVAX HIV-1 Vaccine Efficacy Trial, N Engl J Med. 366:1275-1286 (2012), which is hereby incorporated by reference in its entirety). Briefly, lysozyme (reference surface) and streptavidin (for peptide capture) were immobilized onto CM5 chips. Biotinylated V2 peptides (1 M) (Table 1) were manually injected over the streptavidin-coated chip surface. Heat-inactivated plasma samples diluted 1:50 were injected over the chip surface followed by a dissociation period, after which a 50 nM solution of affinity-purified -chain-specific sheep anti-human IgG was passed over the peptide coated-Ig bound surface. Non-specific binding was subtracted and data analysis was performed using BIAevaluation 4.1 software. Case-control samples were run in triplicate.
(76) IgG and IgA Binding Multiplex Assays (GT). These assays were performed as previously described (Haynes et al., Immune Correlates Analysis of the ALVAC-AIDSVAX HIV-1 Vaccine Efficacy Trial, N Engl J Med. 366:1275-1286 (2012); Tomaras et al., Initial B-cell Responses to Transmitted Human Immunodeficiency Virus Type 1: Virion-Binding Immunoglobulin M (IgM) and IgG Antibodies Followed by Plasma Anti-gp41 Antibodies With Ineffective Control of Initial Viremia, J. Virol. 82:12449-12463 (2008), each of which is hereby incorporated by reference in its entirety) using peptide K178 which represents a linear portion of V2 from immunogens A244 and 92TH023 (Table 1). HIV-specific antibody isotypes were detected with goat anti-human IgA and mouse anti-human IgG.
(77) Statistical Analyses.
(78) Immune biomarkers measured two weeks after the last immunizing dose were assessed as correlates of subsequent infection risk using the previously described statistical analysis plan (Haynes et al., Immune Correlates Analysis of the ALVAC-AIDSVAX HIV-1 Vaccine Efficacy Trial, N Engl J Med. 366:1275-1286 (2012), which is hereby incorporated by reference in its entirety). Briefly, for each immune biomarker, logistic regression accounting for the sampling design was used to estimate the odds ratio (OR) of infection, controlling for gender and baseline behavioral risk. The OR was estimated both for the immune biomarker as a categorical variable and for variables with greater than 50% of vaccines exhibiting a positive response, as a quantitative variable (scaled to have a SD=1). For the categorical analysis, if the positive response rate is less than 50%, then the OR compares positive vs. negative responders. If the positive response rate is 50-85%, then the OR compares high vs. negative where high is above the median of the positive responders. For positive response rates >85%, the OR compares high vs. low where high and low are the upper and bottom tertiles of the response for vaccine recipients. The statistical analysis plan was finalized before data analysis and is described in detail in Haynes et al., Immune Correlates Analysis of the ALVAC-AIDSVAX HIV-1 Vaccine Efficacy Trial, N Engl J Med. 366:1275-1286 (2012), which is hereby incorporated by reference in its entirety.
(79) The lasso model selection procedure (Friedman et al., Regularization Paths for Generalized Linear Models Via Coordinate Descent, J Stat Softw. 33:1-22 (2010), which is hereby incorporated by reference in its entirety) as implemented in the R software package was used to assess the ability of 12 V2 variables from Table 2 to predict infection when included in a multivariate logistic model adjusting for gender and behavioral risk score.
(80) TABLE-US-00002 TABLE 2 Response Rate and Odds Ratios (ORs) Calculated From the Case Control Specimens Tested With 13 V2 Variables. Quantitative Categorical Assay Investigator Institution OR.sup.1,2 P value OR.sup.1,3 P value V2 cyclic Nicos AFRIMS peptides - Karasavvas ELISA Cyclic V2 NA NA 0.82 0.63 (AAs 157-198) Cyclic V2 NA NA NA NA scrambled crown Cyclic V2 0.76 0.10 0.84 0.66 scrambled flanks V2 cyclic Mangala USMHRP peptides - SPR Rao Cyclic V2 0.79 0.18 0.90 0.80 scrambled crown Cyclic V2 0.81 0.24 0.84 0.66 (AAs 157-198) V2 reagents - Susan New York ELISA Zolla- University Pazner Cyclic V2 0.82 0.26 0.65 0.31 (AAs 157-198) Biotin V2 0.95 0.80 0.85 0.76 Peptide 6 (AAs 165-178) gp70-V1V2 0.70 0.06 0.43 0.06 V2 linear Philip University peptides - Berman of ELISA California, Santa Cruz V2 MN NA NA 0.41 0.25 peptide V2 A244- 0.90 0.57 0.88 0.74 92TH023 peptide IgA and IgG Georgia Duke Abs vs. Tomaras University V2 peptide - Luminex IgA V2 A244 NA NA 0.79 0.77 K178 peptide IgG V2 A244 NA NA 1.02 0.95 K178 peptide Peptide David Duke Microarray Montefiori University V2 Hotspot 0.64 0.03 0.32 0.02 analysis .sup.1Estimated odds ratios are computed using a logistic regression model accounting for the sampling design and adjusting for gender and behavioral risk score, as described in Haynes et al., Immune Correlates Analysis of the ALVAC-AIDSVAX HIV-1 Vaccine Efficacy Trial, N Engl J Med. 366:1275-1286 (2012), which is hereby incorporated by reference in its entirety. .sup.2Estimated odds ratio per one standard deviation increment in the immune biomarker; not available (NA) if response rates, when applicable, are less than 50%. For example, the OR of 0.70 (ELISA binding to gp70-V1V2) means that for every higher SD value, the rate of infection is 10 reduced by 30%, while the OR of 0.43 means that vaccinees with responses in the upper third had an infection rate 57% lower than vaccinees with responses in the lower third. .sup.3Estimated odds ratios comparing subgroups defined by high vs. low responses except for two (IgA V2 A244 K178 and V2 MN) which compare positive vs. negative response and one (biotin V2 peptide 6) which compares high vs. negative; not available (NA) for Cyclic V2 scrambled crown (ELISA) which has no positive responses.
(81) The cyclic V2 scrambled crown variable was excluded, because it had no positive responses. Two of the variables with low response rates, IgA V2 A244 K178 peptide and V2 MN peptide, were dichotomized as 1 for response and 0 for non-response, while the remaining ten variables were included on a quantitative scale. The best parsimonious model was chosen based on the average area under the receiver operating characteristic curve derived from 1,000 10-fold cross-validation splits.
Example 1
Antigenicity of the Boosting Immunogens Used
(82) In RV144, the V2 sequence in the recombinant ALVAC priming immunogen derived from subtype E strain 92TH023 was:
(83) TABLE-US-00003 (SEQIDNO:66) .sup.157CSFNMTTELRDKKQKVHALFYKLDIVPIEDNTSS.SEYRLINC.sup.198.
The V2 sequence in the protein boosting gp120 immunogen AIDSVAX E (strain A244) was
(84) TABLE-US-00004 (SEQIDNO:67) .sup.157CSFNMTTELRDKKQKVHALFYKLDIVPIEDNNDS.SEYRLINC.sup.198
The V2 sequence of the protein boosting gp120 immunogen AIDVAX B (strain MN) was:
(85) TABLE-US-00005 (SEQIDNO:68) .sup.157CSFNITTSIGDKMQKEYALLYKLDIEPI.DN.DSTS.YRLISC.sup.198
Insertion of periods in the sequences allows for alignment. Numbering shown and used throughout this report is that assigned to strain HxB2 (Ratner et al., Complete Nucleotide Sequences of Functional Clones of the AIDS Virus, AIDS Res Hum Retroviruses 3:57-69 (1987), which is hereby incorporated by reference in its entirety).
(86) The antigenic reactivity of the V2 region in AIDSVAX B and E was assessed using human anti-V2 monoclonal antibodies 697D and 2158 (Gorny et al., Human Anti-V2 Monoclonal Antibody That Neutralizes Primary But Not Laboratory Isolates of HIV-1, J. Virol. 68:8312-8320 (1994); Pinter at al., The V1/V2 Domain of gp120 is a Global Regulator of Sensitivity of Primary Human Immunodeficiency Virus Type 1 Isolates to Neutralization by Antibodies Commonly Induced Upon Infection, J Virol. 78:5205-5215 (2004), each of which is hereby incorporated by reference in its entirety). As shown in
Example 2
The V2 Antibody Response in RV144 can be Detected with Both Linear and V1V2-Scaffolded Antigens
(87) A gp70-V1V2 scaffolded protein carrying the V1 and V2 loops from a clade B strain, case A2, was previously described (Pinter et al., Potent Neutralization of Primary HIV-1 Isolates by Antibodies Directed Against Epitopes Ppresent in the V1/V2 Domain of HIV-1 gp120, Vaccine 16:1803-1811 (1998), which is hereby incorporated by reference in its entirety). When Set C plasma specimens (from 20 placebo and 80 vaccine recipients) were tested in the pilot studies at a dilution of 1:100, none of the specimens from the placebo recipients contained detectable antibodies to gp70-V1V2. In contrast, the plasma of 67 of 80 (84%) vaccine recipients contained antibodies reactive with this reagent (
(88) The frequency of V2 responses detected with pilot study specimens derived from vaccines varied with the assay used, ranging from 6% for IgA antibodies reactive with a linear V2 peptide (K178) when measured by Luminex (see Table 1 and Haynes et al., Immune Correlates Analysis of the ALVAC-AIDSVAX HIV-1 Vaccine Efficacy Trial, N Engl Med. 366:1275-1286 (2012), which is hereby incorporated by reference in its entirety) to 97% for IgG antibodies reactive with an A244 (subtype E) cyclic V2 peptide (see Table 1 and Karasavvas et al., The That Phase Iii Clinical Trial (RV144) Induces the Generation of Antibodies that Target a Conserved Region Within the V2 Loop of gp120; The Thai Phase Iii Clinical Trial (RV144) Induces the Generation of Antibodies that Target a Conserved Region Within the V2 Loop of gp120, Abstract OA07.08 LB; Bangkok, Thailand. pp. OA07.08 LB (2011), which is hereby incorporated by reference in its entirety).
(89) When reactivity to various V2 reagents were compared in parallel by ELISA, the response to the K178 peptide was significantly stronger than that to gp70-V1V2 or to cyclic V2 peptide (amino acids 157-198), as shown in
Example 3
Delineation of the Linear V2 Epitopes Recognized by Plasma Antibodies from Vaccines
(90) For fine mapping of linear V2 epitopes recognized by antibodies in the plasma of RV144 vaccines, four 21-mer peptides (Peptides 1-4 (SEQ ID NOS: 3 to 6) in Table 1 and
(91) As illustrated by the ELISA data (
(92) To distinguish the amino acids that play a critical role in determining anti-V2 antibody reactivity, a further series of peptides was designed. Results with these peptides indicated that L165I (Peptide 17 (SEQ ID NO: 11)) and S174A (Peptide 20 (SEQ ID NO: 14)) replacements had little effect on reactivity (
Example 4
Comparison of V2 Assays Run in the Case-Control Study
(93) Based on the pilot studies, six assay types were chosen for measuring 13 variables with case-control specimens (Table 2). One of these (ELISA binding to gp70-V1V2) was chosen as a primary variable. The secondary variables provided by the 12 additional V2 assays were run in exploratory analyses with case-control specimens. The primary and secondary variables were chosen to represent assays whose results did not correlate with one another. The heat map in
(94) For the univariate analysis, as in the multivariate analysis (Haynes et al., Immune Correlates Analysis of the ALVAC-AIDSVAX HIV-1 Vaccine Efficacy Trial, N Engl J Med. 366:1275-1286 (2012), which is hereby incorporated by reference in its entirety), statistical significance was approached or achieved with the primary variable of ELISA binding to gp70-V1V2 (p=0.06 and p=0.02, respectively). With one of the secondary variables (V2 hotspot), significance was achieved (p=0.03 quantitative, and p=0.02 categorical, Table 2). The ORs calculated for each V2 variable are shown in
Discussion of Examples 1-4
(95) In this study, the results achieved with the entire panel of V2 assays used in the RV144 pilot and case-control studies were probed in order to understand more fully the nature of the V2 antibody response and why the high response to epitopes in this region is associated with a lower rate of infection in vaccines. The data presented include all of the data describing the V2 antibodies induced by the vaccine and available from both the pilot and the case-control specimens.
(96) These studies document at least two types of V2 antibodies induced by the RV144 vaccine: antibodies reactive with a scaffolded V1V2 protein, gp70-V1V2, and antibodies specific for linear V2 peptides. Studies with human monoclonal antibodies suggest that these may be non-overlapping antibody populations since monoclonal antibodies such as 697D and 2158 react with conformational V1V2 epitope(s) carried by gp70-V1V2 but not with linear peptides (Gorny et al., Functional and Immunochemical Cross-Reactivity of V2-Specific Monoclonal Antibodies From Human Immunodeficiency Virus Type 1-Infected Individuals, Virology 427:198-207 (2012); Gorny et al., Human Anti-V2 Monoclonal Antibody That Neutralizes Primary but Not Laboratory Isolates of HIV-1, J Virol. 68:8312-8320 (1994), each of which is hereby incorporated by reference in its entirety), while monoclonal antibodies such as CH58 and CH59 react with linear V2 peptides but not with gp70-V1V2. The primary variable that correlated with reduced risk of infection measured antibody activity in ELISA with gp70-V1V2. This reagent retains a conformation presented in vivo during infection since it is recognized by antibodies in sera of infected individuals and was used for the selection of two monoclonal antibody-producing hybridomas from the cells of HIV-infected individuals which are broadly cross-reactive with diverse envelopes and neutralize several Tier 1 pseudoviruses (Gorny et al., Functional and Immunochemical Cross-Reactivity of V2-Specific Monoclonal Antibodies From Human Immunodeficiency Virus Type 1-Infected Individuals, Virology 427:198-207 (2012); Pinter et al., The V1/V2 Domain of gp120 is a Global Regulator of Sensitivity of Primary Human Immunodeficiency Virus Type I Isoloates to Neutralization by Antibodies Commonly Induced Upon Infection, J Virol. 78:5205-5215 (2004), each of which is hereby incorporated by reference in its entirety).
(97) The reactivity of vaccines' antibodies with overlapping V2 peptides also correlated with reduced risk of infection (Table 2), generating the hypothesis that antibodies to linear V2 epitopes were also involved in reducing the rate of HIV infection. The observation that none of the vaccines who produced antibodies reactive with the linear subtype B MN V2 peptide were infected with HIV during the trial is intriguing, although the low power of the result reduces confidence in the significance of this observation. The data generated with various linear V2 peptides indicate that: (a) the dominant immunogenic linear V2 epitope in the RV144 vaccine encompasses residues 165 to 178; (b) the V2 antibodies were induced primarily by subtype E A244 rather than the subtype B MN gp120 boost; (c) the V2 antibodies were cross-reactive with V2 peptides derived from several subtypes, (d) the dominant linear V2 epitope was located in the C -strand of the V1V2 complex (
(98) It is noteworthy that the single primary variable showing an inverse correlate of infection risk in the RV144 case-control study was antibody reactivity with gp70-V1V2 which contains the V1V2 sequence of case A2, a subtype B strain (Pinter et al., Potent Neutralization of Primary HIV-1 Isolates by Antibodies Directed Against Epitopes Present in the V1/V2 Domain of HIV-1 gp120, Vaccine 16:1803-1811 (1998), which is hereby incorporated by reference in its entirety) which carries both the V169 and the E172 residues that reduce reactivity of vaccines' antibodies with V2 peptides. Notably, however, as shown above, vaccines' plasma do react with subtype B-derived linear V2 peptides, though with less potent and less frequent reactivity than with V2 peptides from other subtypes. The data with gp70-V1V2 and the linear peptides may suggest that the effective antibody populations are those which are broadly cross-reactive, targeting conformational and linear epitopes shared by diverse HIV-1 subtypes. Indeed, these data, together with bioinformatics data on V2 (Zolla-Pazner et al., Structure-Function Relationships of HIV-1 Envelope Sequence-Variable Regions Provide a Paradigm for Vaccine Design, Nat Rev Immunol. 10:527-535 (2010), which is hereby incorporated by reference in its entirety) and studies of the preferential gene usage of VH families by V2-specific monoclonal antibodies (Gomy et al., Functional and Immunochemical Cross-Reactivity of V2-Specific Monoclonal Antibodies From Human Immunodeficiency Virus Type 1-Infected Individuals, Virology 427:198-207 (2012), which is hereby incorporated by reference in its entirety), support the presence of conserved and immunologically cross-reactive elements in the V2 loop. The role of shared structures and antigenic determinants in the variable loops of the envelope in inducing potentially protective antibody responses is also suggested by the involvement of the V2 and V3 loops as components of the epitopes recognized by the class of potently neutralizing antibodies that target quaternary epitopes and proteoglycans on the envelope spike (Gomy et al., Identification of a New Quaternary Neutralizing Epitope on Human Immunodeficiency Virus Type I Virus Particles, J Virol. 79:5232-5237 (2005); Walker et al., Broad and Potent Neutralizing Antibodies From an African Donor Reveal a New HIV-1 Vaccine Target, Science 326:285-289 (2009); Changela et al., Crystal Structure of Human Antibody 2909 Reveals Conserved Features of Quaternary-Specific Antibodies that Potentially Neutralize HIV-1, J Virol. 85:2524-2535 (2011); Spurrier et al., Structural Analysis and Computational Modeling of Human and Macaque Monoclonal Antibodies Provide a Model for the Quaternary Neutralizing Epitope of HIV-1 gp120, Structure 19:691-699 (2011); Wu et al., Immunotypes of a Quaternary Structure of the HIV-1 Envelope Affect Viral Vulnerability to Neutralizing Antibodies, J. Virol. 85:4578-4585 (2011); Bonsignori et al., Analysis of a Clonal Lineage of HIV-1 Envelope V2/V3 Comformational Epitope-Specific Broadly Neutralizing Antibodies and Their Inferred Unmutated Common Ancestors, Journal of Virology 85:9998-10009 (2011); Walker at al., Broad Neutralization Coverage of HIV by Multiple Highly Potent Antibodies, Nature 477:466-470 (2011); Pejchal et al., A Potent and Broad Neutralizing Antibody Recognizes and Penetrates the HIV Glycan Shield, Science 334:1097-1103 (2011), each of which is hereby incorporated by reference in its entirety).
(99) The explanation for the strong induction of V2 antibodies by the A244 subtype E gp120 immunogen compared to the weak response induced by the MN subtype B gp120 despite the similar antigenicity of the two proteins has several possible explanations. It may be due to a proteolytic cleavage site in the V2 loop of MN; a cathepsin D cleavage site (QKEYALL (SEQ ID NO: 75)) exists in the V2 of MN (Yu et al., Protease Cleavage Sites in HIV-1 gp120 Recognized by Antigen Processing Enzymes are Conserved and Located at Receptor Binding Sites, J. Virol. 84:1513-1526 (2010), which is hereby incorporated by reference in its entirety), while this site is absent from the V2 of A244 (QKVHALF (SEQ ID NO: 76)). The importance of proteoloysis by lysosomal enzymes on antigen presentation and induction of immune responses to gp120 was previously described (Chien et al., Human Immunodeficiency Virus Type I Evades T-helper Responses by Expoiting Antibodies that Suppress Antigen Processing, J. Virol. 78:7645-7652 (2004), which is hereby incorporated by reference in its entirety), providing a theoretical explanation for understanding the differential antibody responses to these two gp120 immunogens. Alternatively, the immunogenicity of the V2 in the MN gp120 boosting immunogen may be less than that of the A244 immunogen, and/or the subtype E rather than the subtype B V2 region is the greater similarity of the AIDSVAX subtype E gp120 protein boost to the subtype E Env used in the prime. To address these issues, further studies of V2 responses with specimens from other vaccine trials, e.g., VAX003 and VAX004, are underway, along with assays using additional peptides, proteoglycans, and epitope-scaffolded proteins.
(100) Finally, the mechanisms by which anti-V2 antibodies may reduce HIV infection have yet to be understood. As noted, anti-V2 monoclonal antibodies can neutralize many Tier 1 pseudoviruses in the TZM.bl assay (Gorny et al., Functional and Immunochemical Cross-Reactivity of V2-Specific Monoclonal Antibodies From Human Immunodeficiency Virus Type 1-Infected Individuals, Virology 427:198-207 (2012), which is hereby incorporated by reference in its entirety). It is possible that they mediate broader neutralizing activity than is detected in this particular assay. Plasma samples from RV144 neutralized some Tier 1 viruses in the TZM-bl assay and in a more sensitive assay with A3R5 cells; however no neutralization of Tier 2 viruses was detected in either assay. Since V2 can be detected on the surface of virions (Nyambi et al., Conserved and Exposed Epitopes on Intact, Native, Primary Human Immunodeficiency Virus Type I Virions of Group M,J. Virol. 74:7096-7107 (2000), which is hereby incorporated by reference in its entirety) and infected cells (Zolla-Pazner et al., Serotyping of Primary Human Immunodeficiency Virus Type I Isolates From Diverse Geographic Locations by Flow Cytometry, J. Virol. 69:3807-3815 (1995), which is hereby incorporated by reference in its entirety), these antibodies may also mediate various other anti-viral functions such as ADCC, ADCVI, virolysis, virus opsonization, virus aggregation, etc. Along with current studies of the potential biologic functions of V2 antibodies, assessment is on-going to test several hypotheses, including those that postulate that anti-V2 antibodies prevent conformational changes in the envelope necessary for binding to CCR5, and that these antibodies may, or may not, prevent binding of the envelope to 47. Interestingly, after vaccination of non-human primates with Ad26 and MVA containing SIVsm543 inserts, a low dose intra-rectal heterologous SIVmac251 challenge identified a potential V2 correlate of protection (Barouch et al., Vaccine Protection Against Acquisition of Neutralization-Resistant SIV Challenges in Rhesus Monkeys, Nature 482:89-93 (2012), which is hereby incorporated by reference in its entirety). While the relevance of the SIV model to ALVAC-HIV and AIDSVAX B/E responses in humans may be unclear, the presence of this analogous protective response after vaccination, in addition to the results of the RV144 immune correlates analysis, may provide a means to illuminate the postulated mechanism for reducing the risk of infection.
(101) Although preferred embodiments have been depicted and described in detail herein, it will be apparent to those skilled in the relevant art that various modifications, additions, substitutions, and the like can be made without departing from the spirit of the invention and these are therefore considered to be within the scope of the invention as defined in the claims which follow.