Prevention and treatment of mycobacterium infection
09610337 ยท 2017-04-04
Assignee
Inventors
- James Anthony Triccas (Sydney, AU)
- Rachel Pinto-Nadanachandran (Sydney, AU)
- Warwick John Britton (Sydney, AU)
Cpc classification
C07K2319/40
CHEMISTRY; METALLURGY
A61K2039/57
HUMAN NECESSITIES
A61K2039/55572
HUMAN NECESSITIES
A61K2039/545
HUMAN NECESSITIES
International classification
C12N9/12
CHEMISTRY; METALLURGY
Abstract
The invention relates to the identification of antigens, including Mycobacterium sulphate assimilation pathway components such as CysD, for preventing and treating Mycobacterium infection, especially but not exclusively Mycobacterium tuberculosis infection; to expression systems including live Mycobacterium for expression of said antigens for prevention and treatment of said infection; and to use of said antigens and expression systems for prevention and treatment of said infection.
Claims
1. A recombinant or synthetic protein including: a first region having the sequence of a CysD protein as shown in SEQ ID NO: 2; and a further region having the sequence of an Ag85B protein, having the sequence shown in SEQ ID NO: 6.
2. The recombinant or synthetic protein according to claim 1 wherein the protein has the sequence as shown in SEQ ID NO: 8.
3. A vaccine or immune stimulating composition for providing an immune response to Mycobacterium tuberculosis in an individual including: a recombinant or synthetic protein having the sequence encoded by a CysD gene wherein the protein has the sequence as shown in SEQ ID NO: 2; and an effective amount of a compound for potentiating an immune response to the recombinant or synthetic protein.
4. A vaccine or composition according to claim 3, wherein the recombinant or synthetic protein further has the sequence of a CysNC protein as shown in SEQ ID NO: 4.
5. A vaccine or composition according to claim 3, wherein the recombinant or synthetic protein includes the sequence of an Ag85B protein as shown in SEQ ID NO: 6.
6. A vaccine or composition according to claim 3, wherein the recombinant or synthetic protein has the sequence as shown in SEQ ID NO: 8.
7. The vaccine or composition according to claim 3, wherein the compound for potentiating an immune response includes an adjuvant in the form of monophosphoryllipid A (MPL) and/or dimethyl dioctadecyl ammoniumbromide (DDA).
8. The vaccine or composition according to claim 3, wherein the recombinant or synthetic protein is provided in the vaccine or composition in the form recombinant bacterial cell having the recombinant or synthetic protein expressed in the cell.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
DETAILED DESCRIPTION OF THE EMBODIMENTS
(16) Reference will now be made in detail to certain embodiments of the invention. While the invention will be described in conjunction with the embodiments, it will be understood that the intention is not to limit the invention to those embodiments. On the contrary, the invention is intended to cover all alternatives, modifications, and equivalents, which may be included within the scope of the present invention as defined by the claims.
(17) One skilled in the art will recognize many methods and materials similar or equivalent to those described herein, which could be used in the practice of the present invention. The present invention is in no way limited to the methods and materials described.
(18) It will be understood that the invention disclosed and defined in this specification extends to all alternative combinations of two or more of the individual features mentioned or evident from the text or drawings. All of these different combinations constitute various alternative aspects of the invention.
(19) All of the patents and publications referred to herein are incorporated by reference in their entirety.
(20) For purposes of interpreting this specification, terms used in the singular will also include the plural and vice versa.
(21) As described herein, the inventors show that sulphate assimilation pathway (SAP) genes and related gene products are highly immunoreactive in the sense that stimulation of lymph node derived lymphocytes from M. tubercluosis-infected mice with SAP proteins provides a strong Th1 response lasting for up to 8 weeks post infection. Further, in humans infected with M. tuberculosis, peripheral blood lymphocytes were observed to proliferate in response to SAP proteins to a greater extent than cells from M. tubercluosis negative individuals.
(22) Further to the above, the inventors show that SAP genes and proteins can be utilised to induce an antigen specific protective immune response. More specifically, the inventors show that immunisation with SAP genes and proteins provides protection to lungs and spleen in mice subsequently infected with M. tubercluosis and the protective efficacy approached that observed with BCG immunisation.
(23) Still further, the inventors show that SAP genes and gene products can be used to improve the protective immunity provided by BCG vaccination whereby, as shown in the specification, the SAP components improved the protective effect of BCG against M. tubercluosis infection which was most apparent in lung tissue.
(24) As discussed herein, these findings are unanticipated as SAP proteins are proposed to be intracellular or membrane associated proteins which, given location, should be less likely than secreted proteins to be subject to immune surveillance. In this regard it is surprising that the amount of immune activation observed in these studies is equivalent to that observed for the cell surface antigen or secreted antigen, Ag85B.
(25) A. Definitions
(26) As used herein, except where the context requires otherwise, the term comprise and variations of the term, such as comprising, comprises and comprised, are not intended to exclude further additives, components, integers or steps.
(27) Sulphate assimilation pathway or SAP generally refers to the pathway by which Mycobacteria reduce sulphur, thereby obtaining substrate for the biosynthesis of cysteine and downstream products including mycothiol. In more detail, the pathway involves the formation of adenosine 5-phosphosulfate (APS) from sulphate, from which APS reductase (encoded by CysH) may produce sulphite, and from which sulfite reductase (encoded by SirA) may produce sulphide, and from which, and with O-Acetyl-L-serine, O-Acetyl-L-Serine Sulfhydalase (encoded by CysK1) may produce cysteine. Key enzymes of SAP include ATP sulfurylase (adenylyl-transferase) (encoded by CysD), GTPase (encoded by CysN), and APS kinase. These enzymes enable the formation of PAS from sulphate, and the formation of 3 phosphoadenosine 5-phosphosulfate (PAPS) from APS.
(28) A SAP component generally refers to a protein or enzyme involved in the reduction of sulphur in Mycobacterium according to the SAP, examples of which include those encoded by CysD, CysNC, CysH, SirA, CysE, CysK1 genes.
(29) Sulphate activating complex or SAC generally refers to a heterodimeric complex formed from the association of the CysD gene product with the CysNC gene product. The CysD and CysNC genes exist together in Mycobacteria as an operon.
(30) CysD gene generally refers to a nucleic acid encoding a ATP sulfurylase. The nucleic acid may have a nucleotide sequence substantially as shown in SEQ ID No: 1 herein or otherwise having defined homology and/or identity as defined herein.
(31) CysD protein generally refers to a ATP sulfurylase. The protein may have an amino acid sequence substantially as shown in SEQ ID No: 2 herein or otherwise having defined homology and/or identity as defined herein.
(32) CysNC gene generally refers to a nucleic acid encoding a GTPase and APS kinase. The nucleic acid may have a nucleotide sequence substantially as shown in SEQ ID No: 3 herein or otherwise having defined homology and/or identity as defined herein.
(33) CysNC protein generally refers to a GTPase and APS kinase. The protein may have an amino acid sequence substantially as shown in SEQ ID No: 4 herein or otherwise having defined homology and/or identity as defined herein.
(34) Ag85B gene generally refers to a nucleic acid having a nucleotide sequence substantially as shown in SEQ ID No: 5 herein or otherwise having defined homology and/or identity as defined herein.
(35) Ag85B protein generally refers to a protein having an amino acid sequence substantially as shown in SEQ ID No: 6 herein or otherwise having defined homology and/or identity as defined herein.
(36) HspX promoter generally refers to a nucleic acid having a nucleotide sequence substantially as shown in SEQ ID No: 7 herein or otherwise having defined homology and/or identity as defined herein.
(37) 85BCysD generally refers to a protein having an amino acid sequence substantially as shown in SEQ ID No: 8 herein.
(38) pHspX85BCysD generally refers to a nucleic acid having a nucleotide sequence substantially as shown in SEQ ID No: 9 herein.
(39) B. Induction of Antigen Specific Immunity
(40) As discussed herein, and exemplified in the examples, the inventors have shown that SAP components elicit an antigen specific protective immune response. Specifically, immunisation with SAP components, and in particular, SAC components prevents the progression of Mycobacterium infection in mice later infected with M. tuberculosis. Further, the inventors show that the SAP components can be used to boost immunity arising from BCG immunisation, and that the SAP components are highly immunoreactive in M. tubercluosis infected individuals, suggesting that these components are useful for minimising development of a disease or condition caused by infection. Therefore, the invention provides methods for: (i) prophylaxis; (ii) treatment; and (iii) boosting immunity to Mycobacterium infection. It is in these contexts that the methods of the invention minimise the likelihood of development of an infection, either by preventing the infection from developing to a relevant disease or pathology, or by preventing further development of a disease or pathology once an infection has been established.
(41) Accordingly in one embodiment there is provided a method for minimising the likelihood of development of a Mycobacterium infection in an individual including: forming an immune response to a component of a Mycobacterium sulphate assimilation pathway (SAP) in an individual;
(42) thereby minimising the likelihood of a Mycobacterium infection from developing in the individual.
(43) In one embodiment, the individual may not have a detectable Mycobacterium infection and/or may not have been previously immunised against Mycobacterium. Such an individual can generally be identified by the Mantoux test which is widely used in the art.
(44) In another embodiment, the individual may be asymptomatic or have sub-clinical symptoms of infection. An asymptomatic subject more typically, has one or more symptoms (e.g., fever, cough, weight loss). Bacilli may be present and culturable, i.e., can be grown in culture from the above body fluids and individuals may have radiographically evident pulmonary lesions which may include infiltration but without cavitation.
(45) In another embodiment the individual may have obvious symptoms of infection such as cavitary lesions in the lungs. Bacilli may be culturable from smears of sputum and/or the other body fluids noted above, but also present in sufficient numbers to be detectable as acid-fast bacilli in smears of these fluids.
(46) Typically the immune response is predominantly a Th1 response. This response is determined by detecting cellular proliferation after administration of the vaccine as measured by .sup.3H thymidine incorporation, or using cellular assays in which IFN- production is assessed, such as flow cytometry and/or ELISA. The immune response can also be measured by detecting specific antibodies (at a titer in the range of 1 to 110.sup.6, preferably 110.sup.3, more preferable in the range of about 110.sup.3 to about 110.sup.6, and most preferably greater than 110.sup.6).
(47) An in vitro cellular response is determined by release of a relevant cytokine such as IFN-gamma, from lymphocytes withdrawn from an animal or human currently or previously infected with virulent mycobacteria, or by detection of proliferation of these T cells. The induction is performed by addition of the polypeptide or the immunogenic portion to a suspension comprising from 110.sup.5 cells to 310.sup.5 cells per well. The cells are isolated from either blood, the spleen, the liver or the lung and the addition of the polypeptide or the immunogenic portion of the polypeptide result in a concentration of not more than 20 ug per ml suspension and the stimulation is performed from two to five days. For monitoring cell proliferation the cells are pulsed with radioactive labelled thymidine and after 16-22 hours of incubation the proliferation is detected by liquid scintillation counting. A positive response is a response more than background plus two standard deviations. The release of IFN-gamma can be determined by the ELISA method, which is well known to a person skilled in the art. A positive response is a response more than background plus two standard deviations. Other cytokines than IFN-gamma could be relevant when monitoring an immunological response to the polypeptide, such as IL-12, TNF-.alpha., IL-4, IL-5, IL-10, IL-6, TGF-.beta. Another and more sensitive method for determining the presence of a cytokine (e.g. IFN-gamma) is the ELISPOT method where the cells isolated from either the blood, the spleen, the liver or the lung are diluted to a concentration of preferable of 1 to 410.sup.6 cells/ml and incubated for 18-22 hrs in the presence of the polypeptide or the immunogenic portion of the polypeptide resulting in a concentration of not more than 20 ug per ml. The cell suspensions are hereafter diluted to 1 to 210.sup.6/ml and transferred to Maxisorp plates coated with anti-IFN-gamma and incubated for preferably 4 to 16 hours. The IFN-gamma producing cells are determined by the use of labelled secondary anti-IFN-antibody and a relevant substrate giving rise to spots, which can be enumerated using a dissection microscope. It is also a possibility to determine the presence of mRNA coding for the relevant cytokine by the use of the PCR technique. Usually one or more cytokines will be measured utilizing for example the PCR, ELISPOT or ELISA. It will be appreciated by a person skilled in the art that a significant increase or decrease in the amount of any of these cytokines induced by a specific polypeptide can be used in evaluation of the immunological activity of the polypeptide.
(48) The immune response may be formed by providing a component of a Mycobacterium SAP in an individual in conditions for enabling formation of an immune response to said component in said individual. These components may be provided in various forms as discussed under the relevant subheadings below.
(49) Recombinant BCG and other live mycobacterium can be delivered subcutaneously or by inhalation. The dosage regimen may also be determined by the skilled person using his expertise (e.g. single administration, repeated administration (twice or more at regular or irregular intervals), etc. This will typically also depend on the disease to be treated and the individual receiving the treatment (in bladder cancer in humans, for instance, a low-dose BCG regimen has been described as 75 mg, while a standard dose is 150 mg). However, doses of BCG as low as 1 mg have been documented to effectively support an immune response for a long period of time (5 years). In tuberculosis, an example of a typical dose is much lower: 0.075 mg, corresponding to 0.3-1.2 million living mycobacteria). Roughly speaking, a typical dose may fall between 0.01 g/kg body weight and 10 mg/kg body weight. In treatment of tuberculosis, one treatment typically protects for a number of years. However, it is also envisaged that repeat doses are given (as is e.g. typically the case in treatment of bladder cancer).
(50) Where the vaccine or immune stimulating composition is peptide based, the manner of application may be varied widely. Any of the conventional methods for administration of a vaccine are applicable. These include oral, nasal or mucosal application in either a solid form containing the active ingredients (such as a pill, suppository or capsule) or in a physiologically acceptable dispersion, such as a spray, powder or liquid, or parenterally, by injection, for example, subcutaneously, intradermally or intramuscularly or transdermally applied. The dosage of the vaccine will depend on the route of administration and will vary according to the age of the person to be vaccinated and, to a lesser degree, the size of the person to be vaccinated. Currently, most vaccines are administered intramuscularly by needle injection and this is likely to continue as the standard route. However, vaccine formulations which induce mucosal immunity have been developed, typically by oral or nasal delivery. One of the most widely studied delivery systems for induction of mucosal immunity contains cholera toxin (CT) or its B subunit. This protein enhances mucosal immune responses and induces IgA production when administered in vaccine formulations. An advantage is the ease of delivery of oral or nasal vaccines. Modified toxins from other microbial species, which have reduced toxicity but retained immunostimulatory capacity, such as modified heat-labile toxin from Gram-negative bacteria or staphylococcal enterotoxins may also be used to generate a similar effect. These molecules are particularly suited to mucosal administration.
(51) The vaccines are conventionally administered parenterally, by injection, for example, either subcutaneously or intramuscularly. Additional formulations which are suitable for other modes of administration include suppositories and, in some cases, oral formulations. For suppositories, traditional binders and carriers may include, for example, polyalkalene glycols or triglycerides; such suppositories may be formed from mixtures containing the active ingredient in the range of 0.5% to 10%, preferably 1-2%. Oral formulations include such normally employed excipients as, for example, pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate, and the like. These compositions take the form of solutions, suspensions, tablets, pills, capsules, sustained release formulations or powders and advantageously contain 10-95% of active ingredient, preferably 25-70%.
(52) Where the vaccine or immune stimulating composition is a viral vector, a carrier can be any substance that does not itself induce the production of antibodies harmful to the patient receiving the composition, and which can be administered without undue toxicity. Suitable carriers can be large, slowly metabolised macromolecules such as proteins, polysaccharides, polylactic acids, polyglycolic acids, polymeric amino acids, amino acid copolymers, and inactive virus particles. Such carriers are well known to those of ordinary skill in the art. Pharmaceutically acceptable carriers can include liquids such as water, saline, glycerol and ethanol. Auxiliary substances, such as wetting or emulsifying agents, pH buffering substances, and the like, can also be present in such vehicles. Stabilizing agents such as trehalose or substances that allow water-soluble sugar glass formation at ambient temperatures may also be present. The latter includes the use of mixed soluble glass stabilisation technology in microsphere format suspended in perfluorocarbon liquids. Liposomes are also suitable carriers. A thorough discussion of pharmaceutical carriers is available in Gennaro (2000) Remington: The Science and Practice of Pharmacy. 20th ed., ISBN: 0683306472. The pharmaceutical composition is preferably sterile. It is preferably pyrogen-free. It is preferably buffered e.g. at between pH 6 and pH 8, generally around pH 7. Preferably, the composition is substantially isotonic with humans. The compositions of the invention may be administered via a variety of different routes. Certain routes may be favoured for certain compositions, as resulting in the generation of a more effective response, or as being less likely to induce side effects, or as being easier for administration. For example, the compositions utilised in this invention may be administered by any number of routes including, but not limited to, oral, intravenous, intramuscular, intra-arterial, intramedullary, intrathecal, intraventricular, transdermal or transcutaneous applications, subcutaneous, intraperitoneal, intranasal, enteral, topical, sublingual, intravaginal or rectal means. The compositions may be prepared for intranasal administration, as nasal spray, nasal drops, gel or powder, as injectables, either as liquid solutions or suspensions; solid forms suitable for solution in, or suspension in, liquid vehicles prior to injection may also be prepared. Direct delivery of the compositions will generally be accomplished by injection, subcutaneously, intraperitoneally, intravenously or intramuscularly, intranasally, or delivered to the interstitial space of a tissue. Dosage treatment may be a single dose schedule or a multiple dose schedule.
(53) C. Determining Immunity to Mycobacterium Infection
(54) In another embodiment there is provided a method for determining whether an individual is immune to a Mycobacterium including: providing a component of a Mycobacterium SAP in an individual in conditions for enabling formation of an immune response to said component in said individual; determining whether the individual develops a protective immune response to said component;
(55) wherein development of a protective immune response determines that the individual is immune to a Mycobacterium;
(56) thereby determining whether the individual is immune to a Mycobacterium.
(57) The method is particularly useful to confirm the result of Mantoux testing, or other conventional Mycobacterium testing, or otherwise for further delineating a Mantoux test result, for example to identify key specificities in a particular immune response, or nature of the relevant immunogens on which the response is based. The various assays mentioned in the previous sub-heading for detecting formation of an immune response can be implemented here.
(58) D. Vaccines and Immune Stimulating Compositions
(59) The invention provides vaccines and immune stimulating compositions. In certain embodiments the vaccines and immune stimulating compositions are useful for providing a protective immune response to Mycobacterium infection, especially M. tubercluosis infection.
(60) Generally, four different forms of vaccine or composition are described as follows:
(61) (i) those that are acellular and that contain as an active ingredient for immune stimulation, a recombinant or synthetic SAP component.
(62) (ii) those that contain as an active ingredient for immune stimulation, a cellular extract that may be enriched for a SAP component.
(63) (iii) those that contain as an active ingredient for immune stimulation, a cell that expresses a recombinant SAP component.
(64) (iv) those that contain a nucleic acid encoding a SAP component that on administration to an individual is expressed to form the active ingredient for immune stimulation.
(65) (v) those that contain a viral vector encoding a SAP component that forms an active ingredient for immunisation.
(66) A preferred immunogen in each of these forms is the CysD gene or gene product, or fragments of homologs thereof.
(67) These forms are described in more detail below.
(68) D.1 Acellular Compositions Containing a Recombinant or Synthetic SAP Component.
(69) In one embodiment, the immune response is formed by providing a component of the SAP in the form of an acellular composition including isolated or recombinant SAP protein in the individual.
(70) Generally these compositions include two key components, the first being the immunogen in the form of the recombinant or synthetic SAP component and the second being an adjuvant for potentiating an immune response to the immunogen.
(71) Turning to the immunogen, this may include any one or more of the SAP components as described herein. Preferably the immunogen includes CysD, or an immunogenic or antigenic fragment or homolog thereof. Fragments and homologs are described in more detail below.
(72) It will be understood that the immunogen may further include other recombinant or synthetic Mycobacterium antigens or immunogens. These may be provided in a form whereby they are fused to CysD by a covalent bond, where they are non covalently associated with CysD, or where they are not bound to CysD at all. Particular examples of these antigens and immunogens include Ag85B. Others are discussed in WO2009/070700.
(73) In one embodiment, a given SAP component (such as CysD, CysNC, CysH, SirA, CysE, CysK1 proteins and their encoding genes) may have a conserved function in terms of activity in the sulphate assimilation pathway and yet have a diverged sequence. These proteins or nucleic acids are referred to as homologs.
(74) In certain embodiments a given SAP component is one having at least 75%, preferably 80%, more preferably 85%, more preferably 90%, more preferably 95%, more preferably 98% or 99% identity to a given SAP component. For example a CysD immunogen may be one having at least 75%, preferably 80%, more preferably 85%, more preferably 90%, more preferably 95%, more preferably 98% or 99% identity to a CysD protein shown in SEQ ID No: 2. The nucleic acid sequence encoding the CysD immunogen may be one having at least 75%, preferably 80%, more preferably 85%, more preferably 90%, more preferably 95%, more preferably 98% or 99% identity to a CysD gene shown in SEQ ID No: 1.
(75) Percent sequence identity is determined by conventional methods, by means of computer programs known in the art such as GAP provided in the GCG program package (Program Manual for the Wisconsin Package, Version 8, August 1994, Genetics Computer Group, 575 Science Drive, Madison, Wis., USA 53711) as disclosed in Needleman, S. B. and Wunsch, C. D., (1970), Journal of Molecular Biology, 48, 443-453, which is hereby incorporated by reference in its entirety. GAP is used with the following settings for polypeptide sequence comparison: GAP creation penalty of 3.0 and GAP extension penalty of 0.1. Sequence identity of polynucleotide molecules is determined by similar methods using GAP with the following settings for DNA sequence comparison: GAP creation penalty of 5.0 and GAP extension penalty of 0.3.
(76) In another embodiment a given SAP component is provided in the form of a fragment that is capable of forming a protective immune response. These fragments are generally of sufficient length and conformation enabling presentation by the APC on Class I or II. They may be of a length ranging generally from about 8 to 15, and about 8 to 11 for Class I presentation and 11 to 15 for Class II presentation.
(77) In order to identify relevant T-cell epitopes which are recognized during an immune response, a common method is to use overlapping peptides for the detection of MHC class II epitopes, preferably synthetic, having a length of e.g. 20 amino acid residues derived from the polypeptide. These peptides can be tested in biological assays, such as the IFN-gamma assay as described herein and those that give a positive response will be classed as immunogenic T cell epitopes. MHC class I epitopes can be identified by predicting those peptides that will bind to Class I (Stryhn, A., et al 1996 Eur. J. Immunol. 26:1911-1918) and hereafter produce these peptides synthetically and test them in relevant biological assays e.g. the IFN-gamma assay as described herein.
(78) The peptides preferably having a length of e.g. 8 to 11 amino acid residues derived from the polypeptide. B-cell epitopes can be determined by analyzing the B cell recognition to overlapping peptides covering the polypeptide of interest as e.g. described in Harboe, M., et al 1998 Infect. Immun. 66:2; 717-723
(79) Any of CysD, CysNC, CysH, SirA, CysE, CysK1 or related nucleic acid sequences can be made by solid phase synthesis or recombinant DNA technology.
(80) Turning to the adjuvant, there are many examples of adjuvants known in the art. See also Allison (1998, Dev. Biol. Stand., 92:3-11; incorporated herein by reference), Unkeless et al. (1998, Annu. Rev. Immunol., 6:251-281), and Phillips et al. (1992, Vaccine, 10:151-158). Exemplary adjuvants that can be utilized in accordance with the invention include, but are not limited to, cytokines, aluminium salts (e.g., aluminium hydroxide, aluminium phosphate, etc.; Baylor et al., Vaccine, 20:S18, 2002), gel-type adjuvants (e.g., calcium phosphate, etc.); microbial adjuvants (e.g., immunomodulatory DNA sequences that include CpG motifs; endotoxins such as monophosphoryl lipid A (Ribi et al., 1986, Immunology and Immunopharmacology of bacterial endotoxins, Plenum Publ. Corp., NY, p407, 1986); exotoxins such as cholera toxin, E. coli heat labile toxin, and pertussis toxin; muramyl dipeptide, etc.); oil-emulsion and emulsifier-based adjuvants (e.g., Freund's Adjuvant, MF59 [Novartis], SAF, etc.); particulate adjuvants (e.g., liposomes, biodegradable microspheres, etc.); synthetic adjuvants (e.g., nonionic block copolymers, muramyl peptide analogues, polyphosphazene, synthetic polynucleotides, etc.); and/or combinations thereof. Other exemplary adjuvants include some polymers (e.g., polyphosphazenes; described in U.S. Pat. No. 5,500,161), Q57, saponins (e.g., QS21, Ghochikyan et al., Vaccine, 24:2275, 2006), squalene, tetrachlorodecaoxide, CPG 7909 (Cooper et al., Vaccine, 22:3136, 2004), poly[di(carboxylatophenoxy)phosphazene] (PCCP; Payne et al., Vaccine, 16:92, 1998), interferon- (Cao et al., Vaccine, 10:238, 1992), block copolymer P1205 (CRL1005; Katz et al., Vaccine, 18:2177, 2000), interleukin-2 (IL-2; Mbwuike et al., Vaccine, 8:347, 1990), polymethyl methacrylate (PMMA; Kreuter et al., J. Pharm. ScL, 70:367, 1981), dimethyloctadecylammonium bromide (DDA), IC31 (Vann Dissel, Vaccine, 29:2100, 2011), etc.
(81) These compositions may also include diluents, excipients and carriers enabling administration of the composition, as known in the art.
(82) D.2 Cell Extracts
(83) In another embodiment, the immune response is formed by providing a component of the SAP in the form of a cell extract including an isolated or recombinant SAP protein in the individual.
(84) Cell extracts may be obtained by known techniques, including for example sonification of a Mycobacterium strain, pelleting by centrifugation and retrieving lysate for immunisation. The lysate could be further enriched for SAP components by for example immunoaffinity chromatography. This is most useful where the strain is not recombinant for a SAP component, i.e. where the strain is not otherwise an over-expressos of, or enriched for, a SAP component. Where the strain is a recombinant strain having high levels of expression of a SAP component, a chromatographic enrichment step may not be necessary.
(85) The cell extracts may be particularly useful as an in vitro reagent for testing efficacy of an immunisation protocol.
(86) D.3 Recombinant or Transformed Cells
(87) In one embodiment of the invention, the immune response is formed by providing a component of the SAP in the form of a cell including an isolated or recombinant SAP protein in the individual.
(88) It is particularly preferred that the cell is a Mycobacterium, and in particular a M. tubercluosis strain, especially an attenuated M. tuberculosis strain capable of forming a live attenuated vaccine. A live attenuated vaccine as used herein is a vaccine containing live or viable micro-organisms with reduced virulence (attenuated); as opposed to an inactivated vaccine.
(89) Other types of mycobacterium include members of the Mycobacterium tuberculosis complex (Taxon identifier 77643 in the UniProt or NCBI taxonomy database), which includes the species M. tuberculosis (the major cause of human tuberculosis), M. bovis, M. bovis BCG (the strain most often used for vaccination purposes), M. africanum, M. microti, M. canetti, and M. pinnipedii.
(90) Preferably the cell is a BCG strain. Those of skill in the art will recognize that several suitable BCG strains exist which are suitable for use in the practice of the invention, including but not limited to those designated ATCC Number:
(91) 27289 Mycobacterium bovis BCG, Chicago 1 [B; BCGT; tice]
(92) 27291 M. bovis
(93) 35731 M. bovis TMC 1002 [BCG Birkhaug]
(94) 35732 M. bovis TMC 1009 [BCG Swedish]
(95) 35735 M. bovis TMC 1012 [BCG Montreal; CIP 105920]
(96) 35736 M. bovis TMC 1013 [BCG Brazilian]
(97) 35737 M. bovis TMC 1019 [BCG Japanese]
(98) 35738 M. bovis TMC 1020 [BCG Mexican]
(99) 35739 M. bovis TMC 1021 [BCG Australian]
(100) 35741 M. bovis [BCG Glaxo]
(101) 35742 M. bovis TMC 1025 [BCG Prague]
(102) 35744 TMC 1029 [BCG Phipps]
(103) 35745 M. bovis TMC 1030 [BCG Connaught]
(104) 35746 M. bovis TMC 1101 [BCG Montreal, SM-R]
(105) 35747 M. bovis TMC 1103 [BCG Montreal, INH-R; CIP 105919]
(106) 35748 M. bovis TMC 1108 [BCG Pasteur SM-R]
(107) 27290 M. bovis [BCG Copenhagen H]
(108) 19274 M. bovis deposited as zrculosis subspecies bovis 50 [BCG]
(109) 19015 Mycobacterium sp. d<i as M. bovis Karlson and Lessel BCG
(110) 35733 M. bovis TMC 1010 [BCG Danish, SSI 1331] and
(111) 35734 M. bovis TMC 1011 [BCG Pasteur], etc.
(112) It will be understood that the recombinant mycobacteria of the invention need not be confined to strains of BCG. Those of skill in the art will recognize that other Mycobacterium strains may also be employed, examples of which include but are not limited to: M. tuberculosis CDC1551 strain (See, e.g. Griffith et at., Am. J. Respir. Crit. Care Med. August; 152(2):808; 1995), M. tuberculosis Beijing strain (van Soolingen et al., J CHn Microbiol. December:33(12):3234-8, 1995) H37Rv strain (ATCC#:25618), M. tuberculosis pantothenate auxotroph strain (Sambandamurthy et al., supra; M. tuberculosis rpo V mutant strain (Collins et al., Proc Natl Acad Sci USA. 92(17):8036; 1995), M. tuberculosis leucine auxotroph strain (Hondalus et al., Infect. Immun. 68(5):2888; 2000), etc., or other attenuated and/or recombinant strains derived from M. tuberculosis. Other candidate bacteria include other members of the M. tuberculosis complex, other mycobacteria (e.g. M. africanum or M. avium complex bacteria), or other mycobacterial species.
(113) In this form of the invention, SAP component may be over-expressed, i.e. the protein may be expressed at a level that exceeds that of a suitable control organism, such as the same mycobacterium that has not been genetically engineered to over-express the SAP component. Those of skill in the art are well acquainted with comparative measurements of protein activity, and with the use of suitable standards and controls for such measurements.
(114) The over-expression of the SAP component may be carried out by any suitable method known in the art. Generally, the method will involve linking nucleic acid sequences encoding the SAP component to a particular promoter or other regulatory element that is activated when the strain is introduced into a cell especially an APC. Those of skill in the art will recognize that many such expression control sequences are known and would be suitable for use in the invention. For example, if constitutive expression of SAP component is desired, expression control sequences (e.g. promoters and associated sequences) including but not limited to: mycobacterium optimal promoter (mop, George et al., 1995); blaF promoter (Timm et al., 1994); hsp60, ace or msp12 promoters; etc., with or without an optimized ribosomal binding site.
(115) Alternatively, over-expression of SAP may not be constitutive but may instead be inducible, in response to an environmental cue. For example, expression of the protein may be driven by a promoter that is induced in a particular location or in response to an environmental stimulus, examples of which include but are not limited to: macrophage inducible promoter (which drives expression of genes that are specifically upregulated within the macrophage phagosome, see Schannapinger et al. JEM 2003); acetamidase promoter (Mahenthiralingam et al., J. Gen. Microbiol. 1993), and tetracycline-inducible (Blokpoel et al., Nucl. Acids Res. 33(2):e22, 2005), etc.
(116) In addition, promoters from other species maybe utilized, examples of which include but are not limited to: various viral promoters, whereby after gene therapy-like strategies (e.g. co-inoculation of mycobacteria, and an engineered virus) the Mtb antigens are expressed in selected tissues infected by the co-administered virus; etc.
(117) As a further alternative, native or naturally occurring SAP promoters may be altered by mutation to cause over-expression of SAP component.
(118) Those of skill in the art will recognize that several avenues are available to introduce nucleic acid sequences encoding the SAP component, in operable linkage with one or more expression control sequences, into a mycobacterial host where over-expression will occur. For example, the sequences may be included in a vector that is subsequently introduced into the mycobacterium. Many vectors suitable for containing and expressing genes are known, and include but are not limited to various extra-chromosomal elements such as plasmids, e.g. those comprising the pAL500 origin of replication, modified to augment their copy number; or other plasmids with origins of replication that are or will be developed; or extrachromosomal elements that do not replicate or integrate into mycobacterial genome but provide a suicidal source for homologous recombination to occur; etc. Introduction of such a vector into a mycobacterium may be carried out by any of several known methods suitable for that particular vector, including but not limited to electroporation and mycobacteriophage-mediated transduction for homologous recombination. In a preferred embodiment, the vector is a plasmid and the method that is used is electroporation.
(119) In other embodiments of the invention, the SAP component is over-expressed from the M. tuberculosis chromosome. Those of skill in the art will recognize that various molecular biology strategies exist for generating a mycobacterium with this property. For example, various mutations may be introduced into the chromosome (randomly or in a directed fashion) that result in over-production of the SAP component by the bacterium. Alternatively, nucleic acid sequences that include one or more expression control sequences operably linked to nucleic acid sequences encoding the SAP component may be introduced into the bacterial chromosome, e.g. by transduction with a suicide plasmid with or without a means for counter-selection, to provide sequences for homologous recombination.
(120) In a particularly preferred embodiment of the invention, there is provided an expression vector including: a nucleic acid encoding a Mycobacterium antigen for providing an antigen specific immune response to Mycobacterium infection; a promoter operably linked to the nucleic acid for expression of the nucleic acid when the strain is introduced into an APC, said promoter having a sequence of a Mycobacterium promoter that causes immediate and sustained expression of a Mycobacterium antigen when said promoter is introduced into an APC.
(121) In the above described embodiments, the Mycobacterium HspX promoter is a preferred promoter for use as a promoter having the sequence of a Mycobacterium promoter that causes expression of a Mycobacterium ATP independent chaperone. Specifically, as exemplified in Example 2 here, this promoter is capable of inducing high and sustained expression of a SAP component in a BCG strain. Other examples of promoters useful in the invention include Rv0962c. Rv0971c. Rv0983. Rv0986. Rv2428.Rv1130.Rv2626c as described in Fontan et al. 2008 Infect. & Immun. 76:pp 717.
(122) Vaccine formulation under this subheading involves studies to determine maximum bacterial viability and stability throughout the manufacturing process. This includes determination of maximum organism viability (live to dead) during culture utilizing a variety of commonly used medium for the culture of Mycobacteria to include the addition of glycerol, sugars, amino acids, and detergents or salts. After culture cells are harvested by centrifugation or tangential flow filtration and resuspended in a stabilizing medium that allows for protection of cells during freezing or freeze-drying process. Commonly used stabilizing agents include sodium glutamate, amino acids or amino acid derivatives, glycerol, sugars or commonly used salts. The final formulation will provide sufficient viable organisms to be delivered by intradermal, percutaneous injection, perfusion or oral delivery with sufficient stability to maintain and adequate shelf life for distribution and use.
(123) Prior to administration to humans as a vaccine, the BCG strains described under this subheading are tested according to methods that are well-known to those of skill in the art. For example, tests for toxicity, virulence, safety, etc. are carried out in suitable animal models, e.g. in mice, guinea pigs, etc., some of which are immunocompromised. The ability of the vaccine preparations to elicit an immune response is likewise typically tested in suitable animal models, e.g. mice, guinea pigs, etc. In addition, protection studies involving vaccination, boosting, and subsequent challenge with live Mtb may be carried out using suitable animal models such as mice, guinea pigs, and non-human primates. Finally, those of skill in the art are familiar with the arrangements for carrying out clinical trials in consenting humans, in order to test the efficacy of the vaccine preparations. For details, see, for example, U.S. Pat. No. 7,625,572 (Sun et al.) and references cited therein.
(124) D.4 Nucleic Acid Vaccines
(125) In another embodiment, the immune response is formed by providing a component of the SAP in the form of or a nucleic acid encoding a SAP protein in the individual.
(126) In particular, as exemplified Example 1, the inventors have shown that protective immunity can be provided by administering a DNA vaccine containing a gene encoding CysD in mice challenged with M. tubercluosis.
(127) The nucleic acid may be provided in linearised or circular form for injection. Generally the nucleic acid will have a promoter enabling expression of the SAP component in the relevant cell. For example, where the administration is to muscle tissue, the vector will contain a promoter capable of activation by muscle transcription factors and enhancers. In these embodiments, it is generally understood that the muscle cell will produce the relevant SAP component which will then be phagocytosed by an APC such as a dendritic cell for presentation to a T cell, upon which immunity is established.
(128) D.5 Viral Vectors
(129) In another embodiment, the immune response is formed by providing a component of the SAP in the form of a viral vector that contains a nucleic acid that encodes the component, or that expresses a component of the SAP.
(130) Examples of suitable vectors include those based on a vaccinia genome and those based on an adenovirus genome.
(131) Some of the compositions described under the above subheadings may be formulated as liquid solutions or suspensions, however solid forms such as tablets, pills, powders and the like are also contemplated. Solid forms suitable for solution in, or suspension in, liquids prior to administration may also be prepared. The preparation may also be emulsified. The active ingredients may be mixed with excipients which are pharmaceutically acceptable and compatible with the active ingredients. Suitable excipients are, for example, water, saline, dextrose, glycerol, ethanol and the like, or combinations thereof. In addition, the composition may contain minor amounts of auxiliary substances such as wetting or emulsifying agents, pH buffering agents, and the like. If it is desired to administer an oral form of the composition, various thickeners, flavorings, diluents, emulsifiers, dispersing aids or binders and the like may be added. The composition of the present invention may contain any such additional ingredients so as to provide the composition in a form suitable for administration.
(132) It will be understood that the invention disclosed and defined in this specification extends to all alternative combinations of two or more of the individual features mentioned or evident from the text or drawings. All of these different combinations constitute various alternative aspects of the invention.
EXAMPLES
Example 1
(133) M. tuberculosis can survive in a broad spectrum of environments, including high levels of oxidative stress, low pH and nutrient deprivation ((Nathan, 2000 #29). Exposure and adaption of M. tuberculosis to these conditions during infection requires the coordinated regulation of gene expression ((Timm, 2003 #93). Genes involved in the metabolism of sulphur have consistently been identified as up-regulated in conditions that mimic the macrophage environment ((Pinto, 2004 #14; #35; Muttucumaru, 2004 #34; Manganelli, 2002 #75; Hampshire, 2004 #33; Betts, 2002 #49) and during macrophage infection ((Schnappinger, 2003 #31). These genes encode enzymes of the sulphate assimilation pathway (SAP) of M. tubercluosis, required for the reduction of sulphur. Indeed, sulphur-containing compounds are fundamental in a wide range of biological activities. In its reduced form sulphur is used in the biosynthesis of the amino acid cysteine, one of the prime targets for reactive nitrogen intermediates encountered by M. tubercluosis in the intracellular environment ((Rhee, 2005 #92). Cysteine can be subsequently incorporated into mycothiol which functions analogously to glutathione ((Fan, 2009 #197) and is crucial to M. tubercluosis within the granuloma in regulating the redox balance upon encountering free radicals released by host cells. Mutants of Mycobacterium smegmatis in which mycothiol biosynthesis has been abrogated exhibit high-level resistance to isoniazid and are more susceptible than wild-type strains to oxidative stress and antibiotics ((Rawat, 2002 #82; Buchmeier, 2003 #85). This first line of defence by M. tuberculosis therefore is linked to the availability of cysteine and as such has been shown to be required for the organism's surivial ((Sareen, 2003 #84; Buchmeier, 2006 #83; Newton, 2002 #81). Reinforcing this increased need for cysteine in the macrophage environment, is the up-regulation of ATP sulfurylase, the first enzyme in the SAP, upon exposure to oxidative stress ((Pinto, 2004 #14; #35; Schnappinger, 2003 #31). Disabling the biosynthesis of cysteine attenuates bacterial virulence and persistence during the chronic phase of infection in mice ((Senaratne, 2006 #3).
(134) Although members of the SAP appear to be highly expressed under conditions presumably encountered within the host, it is not known if these proteins constitute immunogenic components of M. tuberculosis. Most focus has been on secreted proteins of mycobacteria, as these are predicted to be recognized by early host immune responses ((Andersen, 1992 #202; Roberts, 1995 #203). Sulphate reduction takes place within the cell and for this reason SAP enzymes are either intracellular or membrane bound components ((de Souza, 2011 #206; Bhave, 2007 #205; Schelle, 2006 #204) and would not be detected in screens for immunogenic secreted antigens of M. tubercluosis ((Andersen, 1992 #202). In this report we demonstrate that members of the SAP are highly immunogenic components of M. tubercluosis, being recognised by M. tubercluosis infected individuals and conferring protective immunity in a murine model of TB. Our results suggest that SAP members are potential candidates for inclusion into new TB vaccines.
(135) Materials and Methods
(136) Bacterial Strains and Growth Conditions.
(137) Escherichia coli K-12 and BL21 (DE3) were grown in Luria-Bertani (LB) broth or agar (Sigma-Aldrich). M. tubercluosis H37Rv or strain MT103 ((Jackson, 1999 #208) were grown in Middlebrook 7H9 medium (Difco Laboratories) supplemented with 0.5% glycerol, 0.05% Tween 80, and 10% albumin-dextrose-catalase (ADC) or on solid Middlebrook 7H11 medium (Difco Laboratories) supplemented with oleic acidADC. All cultures were grown at 37 C. with or without shaking. Antibiotics were added to media when required at 25 g/mL for kanamycin and 100 g/mL for ampicillin. Non-replicating persistence of in vitro grown M. tubercluosis was achieved by adding daily 50 M of the nitric oxide-donating compound 2,2-(Hydroxynitrosohydrazono)bis-ethanimine (DETA-NO) (Sigma) using the method of ((Bryk, 2008 #36). At day 0, 1, 3 and 7 bacterial counts were determined for these cultures and at day 7, RNA was extracted from both cultures for real-time (RT) PCR analysis.
(138) Protein Antigens and DNA Vaccines
(139) Culture Filtrate protein (CFP) was obtained from the NIH Biodefense and Emerging Infections Research Resources Repository (NR-14825). Concavalin A (ConA) was purchased from Sigma-Aldrich. Purification of SAP protein antigens and construction of DNA vectors encoding SAP genes are described in supplementary table 1.
(140) Macrophage Infection and Real-Time PCR
(141) The RAW264.7 mouse macrophage cell line was grown in RPMI (Gibco-BRL) supplemented with 10% fetal calf serum (FCS; Gibco-BRL) and 2 mM L-glutamine (Invitrogen) (Complete RPMI), at 37 C. in 5% CO.sub.2. Adhered RAW264.7 cells were infected with M. tubercluosis at a multiplicity of infection of 1:1. Four hours post-infection, macrophage monolayers were washed with phosphate buffered saline (PBS), cells were incubated for an additional 48 hours in fresh medium and total RNA was extracted for RT PCR analysis.
(142) M. tubercluosis pellets from broth culture or M. tubercluosis-infected macrophages were resuspended in TRI reagent (Invitrogen) and disrupted with 0.1-mm zirconia/silica beads in a BioSpec Products Bead Beater. RNA was extracted, treated with TURBO DNase (Ambion) and resuspended in DPEC-treated water (Invitrogen) as described previously ((Muttucumaru, 2004 #34). cDNA was synthesised from 1 g of total RNA by using Superscript III reverse transcriptase (Invitrogen). Quantitive RT-PCR was performed using 4 L of cDNA, SYBR green I PCR Master Mix (Qiagen) and 5 M of the gene-specific primer pair (supplementary table 1) in a reaction volume of 25 L. PCR reactions were run on a Rotogene 6000-series sequence detector (Corbett research) in triplicate per primer pair. Relative expression levels were determined using the comparative threshold cycle method of Livak and Schmittgen ((Livak, 2001 #99) using the non-induced M. tubercluosis 16S rRNA (encoded by rrs) asB the control ((Banaiee, 2006 #101).
(143) Human Studies
(144) Subjects:
(145) 15 M. tubercluosis-infected, HIV negative patients were recruited from the TB clinic at Royal Prince Alfred Hospital, Missenden Rd, NSW, Australia. Peripheral blood mononuclear cells (PBMCs) were obtained from biopsy or culture-proven patients of varying ages and gender that had or had not yet started anti-TB treatment. Ethical approval for this study was given by Sydney South West Area Health Service (protocol number: X06-0248). Patients were compared with 11 healthy tuberculin skin test negative (TST-ve) individuals.
(146) T Cell Proliferation Assay:
(147) PBMCs from whole blood were isolated on a Ficoll gradient (Histopaque-1077, Sigma Aldrich). 2.510.sup.5 cells/well of PBMCs were incubated at 37 C. in 5% CO.sub.2 for 5 days in the presence of 10 g/mL of the SAP proteins, 10 g/mL of CFP, Ag-85B or 3 g/mL of ConA. T cell proliferation was assayed by .sup.3H-thymidine incorporation (MP Biomedicals, 1 Ci/well) at day 5 using liquid scintillation spectroscopy (Microbeta Luminescence Counter, Wallace). The lymphocyte stimulation index (SI) was calculated using the following formula: average counts per minute (cpm) in the presence of antigen/average cpm in the absence of antigen. A SI of greater than or equal to 3 was considered a positive response to antigen. Murine studies
(148) Six- to eight-week-old female C57BL/6 mice were obtained from Animal Resources Centre (Perth, Australia) and maintained in specific pathogen-free conditions. For determination of immunogenicity, mice (4/group) were infected via the intra-nasal (i.n) route with 510.sup.4 colony forming units (CFU) of M. tuberculosis Mt103. Three and 8 weeks post-infection single cell suspensions were prepared from the mediastinal lymph node (MLN) of immunized mice in complete RPMI medium and the number of interferon (IFN)--producing cells was determined by ELISpot as described previously ((Palendira, 2002 #210) using SAP enzymes, CFP and Ag85B at a concentration of 10 g/ml with ConA used at 3 g/ml. For the analysis of protective efficacy, mice (5/group) were immunised subcutaneously (s.c) once with either 510.sup.5 CFU of M. bovis BCG, or 3 times at 2 week intervals with 10 g of CysDNC protein co-administered with dimethyl dioctadecyl ammoniumbromide (DDA) (1.25 mg/ml) and monophosphoryl lipid A (MPL) (125 g/ml) or intramuscularly (i.m) with 100 g DNA vaccine per injection. Eight weeks after the final vaccination, mice were challenged with aerosol M. tuberculosis Mt103 using an inhalation exposure apparatus (Glas-Col) with an infective dose of 100 viable bacilli per lung. Bacterial load was determined 4 weeks after challenge by plating homogenates of lung and spleen.
(149) Statistical Analysis
(150) For assessment of protective efficacy, the significance of differences was evaluated by one-way ANOVA with pair-wise comparison of multi-grouped data sets achieved using the Bonferroni post hoc test. For assessment of induction of host immune responses by SAP enzymes of infected mice or M. tuberculosis infected individuals compared to uninfected mice or TST-ve individuals respectively, the Mann-Whitney's U test was used (*P<0.05).
(151) Results
(152) Induction of M. Tubercluosis ATP Sulfurylase mRNA in the Intracellular Environment Correlates with Potent Antigen-Specific Immunity.
(153) The sulphate activating complex (SAC) of M. tuberculosis is the first step in the SAP (
(154) As CysDNC was induced at high levels within the intracellular environment and in non-replicating bacteria, we hypothesized that the enzyme may be recognized by the immune response during M. tuberculosis infection. To test this, we intranasally infected mice with M. tubercluosis and examined the frequency of IFN- secreting cells in the mediasteinal lymph nodes (MLN). At three weeks post infection, stimulation of MLN cells with CysDNC ex vivo resulted in a strong induction of IFN- secreting T cells, which was similar to levels induced by the immuno-dominant secreted Ag85B protein of M. tubercluosis (
(155) Protective Immunity Against Virulent M. Tubercluosis Challenge Following Vaccination with DNA Encoding ATP Sulfurylase.
(156) The enhanced expression of the genes encoding ATP sulfurylase in the intracellular environment (
(157) Downstream Enzymes of M. Tubercluosis Sulphate Assimilation Pathway (SAP) are Immunogenic Components of M. Tubercluosis.
(158) The promising results obtained with M. tubercluosis ATP sulfurylase (CysDNC) led us to question whether other members of the SAP are targets of the host immune response. We found that all SAP proteins tested were significantly up-regulated in the intracellular environment, with CysK1 mRNA displaying the highest induction of approximately 6.7 fold (
(159) As expression of all SAP enzymes was up-regulated in vivo and the proteins were recognized in mice and humans, we assessed if they could improve the protective efficacy afforded by DNA-CysDNC. When mice were vaccinated with DNA-CysDNC together with DNA encoding cysH, sirA, cysK1 and cysE, we did not observe increases in protective efficacy compared to DNA-CysDNC: alone both in the lung (
(160) Boosting BCG Vaccinated Mice with ATP Sulfurylase Improves Protection Afforded by BCG in the Lung Against Challenge with M. Tubercluosis.
(161) Considering the strong recognition of C ATP sulfurylase by TB patients and its protective effect in mice, we determined if this protein complex may be a suitable candidate to boost the protective effect of BCG upon M. tuberculosis challenge. After low dose, aerosol delivery of M. tubercluosis, naive mice demonstrated substantial bacterial growth in the lungs and dissemination to spleens were detected (
(162) Discussion
(163) The identification of new targets of host immunity would markedly aid efforts to develop more effective TB vaccines. In this report we identify the sulphate activation complex (SAC) of M. tuberculosis as a major antigenic component of the bacillus. The SAC is an enzyme complex with 3 catalytic activities ((Pinto, 2004 #14; Sun, 2005 #13). This complex is predicted to play a role in adaption of M. tuberculosis to the host cell environment, due to up-regulation of CysDNC within macrophages (
(164) Enhanced recognition of mycobacterial antigens by the host immune response does not always correlate protection against challenge with virulent M. tubercluosis in animal models ((Gartner, 2007 #215; Kamath, 1999 #143; Skinner, 2003 #115). We therefore assessed if CysDNC was protective in our low-dose murine model of aerosol M. tubercluosis infection. When delivered as DNA vaccines, CysD and CysNC were protective as single components in both the lung and spleen, and a combination of the two constructs achieved a level of protection similar to that induced by BCG (
(165) An important property of potential subunit vaccines is the capacity to boost protection with prior BCG immunization, as this is the proposed role for such vaccines in new TB vaccine schedules ((Kaufmann, 2011 #196). A handful of proteins have demonstrated an ability to boost BCG-induced protection in experimental M. tuberculosis infection ((Lu, 2011 #144; Dey, 2011 #145; Rouanet, 2009 #214). CysDNC can now be added to this list, as the antigen complex was able to significantly increase the protective effect of BCG alone in the lung, the primary site of infection in the model used (
(166) In addition to defining the antigenic role of the SAP proteins, this study has also expanded our knowledge of regulation of SAP gene expression during infection. All components of the SAP tested displayed up-regulation within the macrophage cell line used here. This adaptation to the phagosome environment is an indication of the bacterium's ability to supply cysteine to the cell in a timely fashion, which has been extensively reviewed by Hatzios and Bertozzi ((Hatzios, 2011 #167). It may be that enzymes in the SAP regulate the expression of each other. For instance serine acetyl transferase has been shown to associate and form a complex with the last enzyme in the pathway o-acetlyserine sulthydralase (OASS) ((Droux, 1998 #218). While this interaction negatively regulates OASS ((Mino, 2000 #222; Schnell, 2007 #87), similar to ATP-sulfurylase, it's expression and activity may depend on the requirement for cysteine ((Kredich, 1966 #219; Mino, 1999 #220; Mino, 2000 #221; Pinto, 2004 #14). Further more, E. coli ATP sulfurylase forms a tight complex with, OASS ((Wei, 2002 #96) and it is this complex that can activate sulphate to produce APS (
(167) In summary, we have identified components of the SAP as host-cell induced proteins that are major antigenic components of M. tubercluosis.
Example 2
(168) The preferred niche within the host of virulent mycobacteria and the attenuated BCG vaccine strain is the intracellular environment of the macrophage. It has been observed that mycobacteria also have the ability to infect and persist within DCs and stimulate in vivo T cell responses [8,9].
(169) We hypothesized that the targeted expression of antigen by recombinant (r) BCG within DCs may influence the subsequent generation of antigen-specific immunity. We considered that the promoter controlling expression of the M. tuberculosis hspX gene may be a suitable candidate to direct expression of antigen to APCs after vaccination with BCG.
(170) HspX, or -crystallin protein, is a member of the small molecular weight heat-shock proteins that act as ATP-independent chaperones [10,11]. The hspX promoter is rapidly induced upon entry of M. tuberculosis into cultured macrophages [12]. The gene is also up-regulated in vitro by hypoxia [12], during stationary phase of growth of aerated M. tuberculosis cultures [11] and by addition of NO donors [13], which may all represent conditions encountered by M. tubercluosis within host cells. Importantly, the hspX gene is up-regulated after infection of mice with virulent M. tuberculosis [14].
(171) In this report, we demonstrate that the hspX promoter can be used to modulate expression of antigens expressed by rBCG, and antigen expression is rapidly induced upon entry of rBCG within DCs. Use of the hspX promoter to control antigen expression resulted in accelerated priming of antigen-specific T cells and sustained in vivo generation of antigen-reactive T cells after vaccination.
(172) Materials and Methods
(173) Bacterial Strains, Media and Antigens
(174) M. tuberculosis 1437Rv (ATC27294) and M. bovis BCG (Pasteur strain) were grown on Middlebrook 7H9 medium (Difco, BD) supplemented with 0.5% glycerol, 0.05% Tween-80 and 10% ADC or on solid Middlebrook 7H11 medium (Difco, BD) supplemented with OADC. When required, the antibiotic kanamycin (Km) was added at a concentration of 20 /ml.
(175) Mice
(176) Six to eight weeks old C57BL/6 mice were obtained from. Animal Resources Centre (Perth, WA, Australia) and maintained in specific pathogen-free conditions. The p25 CD4.sup.+ TCR transgenic (specific for residues 240-254 of Ag85B) were obtained from Prof. K. Takatsu (University of Tokyo, Japan) and Prof. J. Ernst (New York University School of Medicine, NY) [15] and were backcrossed onto B6.SJL/Ptprca to obtain the p25.sup.+CD45.1.sup.+ line. Animal experiments were performed with approval of the University of Sydney Animal Care and Ethics Committee.
(177) Construction of Recombinant (r)BCG Strains
(178) BCG expressing GFP under control of the M. tubercluosis hspX promoter (BCG:P.sub.hspX-GFP) was constructed by transformation of plasmid pMV306:GFP into BCG, which was a kind gift of Professor Cliff Barry, Tuberculosis Research Section, NIAID, National Institutes of Health, Rockville, Md. To develop BCG in which the hspX promoter drives expression of the Ag85B protein, the Ag85B protein-encoding fbpB gene was amplified from M. tuberculosis genomic DNA and used to replace the gfp gene in pMV306:GFP, resulting in the intermediate vector pJEX88. The P.sub.hspX-fbpB fragment was excised by digestion with XbaI and HpaI and ligated to the shuttle-vector pMV261 [16] digested with the same enzymes. The resultant plasmid was transformed into BCG to produce BCG:P.sub.hspX-85B. Control BCG used in this study was either BCG Pasteur strain or BCG Pasteur transformed with pMV261 [16]. Construction of rBCG over-expressing the M. tubercluosis Ag85B protein under the control of the hsp60 promoter (BCG:P.sub.hsp60-85B) has been described previously [17].
(179) Dendritic Cell Infections
(180) DCs were prepared form the bone marrow of mice as described previously [18]. For DC infection, 4-day old DC cultures were incubated with rBCG strains at a multiplicity of infection of 5:1 or 1:1. After 4 h, extracellular bacteria were removed by extensive washing and at 6 and 24 h post-infection, DCs were lysed and bacteria collected for flow cytometry (LSR-II, Becton Dickinson, San Jose, Calif., USA). The fold increase in fluorescence was determined by dividing the fluorescence of bacteria populations at 6 and 24 h by the initial value (day 0). For visualisation by confocal microscopy, similar infection conditions were used, except DCs were allowed to adhere onto round 25 mm coverslips (Leica Microsystems, Wetzlar, Germany) prior to rBCG infection and then viewed under the LP5 Confocal microscope (Leica).
(181) In Vitro Immunogenicity Assays
(182) Four-day DC culture (1105 cells) were infected with Rbcg strains at an MOI of 5:1. CD4 T cells were purified from p25.sup.+CD45.1.sup.+ mice by autoMACS separation (Miltenyi Biotec, Bergisch Gladbach, Germany) and 5105 purified T cells cultured with infected DCs. Three days following co-incubation, supernatant were assayed for IFN- by ELISA as described previously [19] and T cell proliferation was measured by [3H]-thymidine uptake.
(183) In Vivo Immune Response
(184) To detect GFP expression in vivo, C57BL/6 mice were inoculated with 1107 CFUs of fluorescent rBCG strains subcutaneously in the footpads. Tissue of the local inflammatory site was obtained immediately after infection or at days 1, 3 or 7 post-infection. Tissues were digested with collagenase and DNAse for at least 1 h and then strained to recover cells. Cells were stained with CD45-APCCy7, CD11b-APC and CD11c-PE-Cy7 (BD Pharmingen). Stained cells were analysed using the LSR-II flow cytometer (BD).
(185) For determination of T cell priming after rBCG delivery, lymph node cells from p25.sup.+CD45.1.sup.+ mice were prepared and labelled with Carboxyfluorescein succinimidyl ester (CFSE; Molecular Probes, Invitrogen, USA). C57BL16 mice received 5105 CFSE-labelled p25 lymph node cells i.v. and the next day were immunized subcutaneously with 5105 CFU rBCG strains. At 3 or 7 days postvaccination organs were processed and the CFSE profile of dividing cells analysed.
(186) For determination of rBCG immunogenicity, C57BL/6 mice were subcutaneously vaccinated with 5105 CFUs of rBCG strains. At 3 and 12 weeks post-vaccination, splenocytes were recovered and 2105 splenocytes were cultured with p25 peptide (3 g/ml) at 37 C. in 5% CO.sub.2. Eighteen hours following co-incubation, the number of IFN- secreting cells was determined by ELIspot as described previously [19] and at 72 h following the antigen challenge, T cell proliferation was assessed by [3H]-thymidine uptake.
(187) Protective Efficacy
(188) For assessment of protective efficacy, C57BL/6 mice (5 per group) were immunised with 5105 CFU of BCG strains and at 12 weeks post-vaccination mice were challenged with aerosol M. tuberculosis H37Rv using a Middlebrook airborne infection apparatus (Glas-Col, Terre Haute, Ind., USA) with an infective dose of approximately 100 viable bacilli per lung. Four weeks after the challenge the number of bacteria within the lung and spleen was enumerated on Middlebrook 7H11 Bacto agar.
(189) Statistical Analysis
(190) The significance of differences for linear and log-transformed assays was determined by analysis of variance (ANOVA) using Bonferroni's Multiple Comparison test was used for pair-wise comparison of multi-grouped data sets. Differences with p<0.05 were considered significant.
(191) Results
(192) Induction of the M. Tuberculosis hspX Promoter within Dendritic Cells
(193) We hypothesized that targeting antigen expression to DCs during mycobacterial infection would have a positive effect on the resultant immune response directed towards the antigen. In order to induce expression of foreign genes within DCs, we constructed BCG strains in which the M. tubercluosis hspX promoter (P.sub.hspX) controlled gene expression. BCG:P.sub.hspX-GFP, in which gfp was expressed using P.sub.hspX, displayed marked up-regulation of GFP fluorescence only when grown in non-aerated cultures, confirming up-regulation of the hspX promoter under low oxygen tension (
(194) Early In Vivo Induction of hspX-Induced Expression after Vaccination
(195) In order to determine if the hspX promoter could be used to drive antigen expression in vivo, mice were vaccinated with BCG:P.sub.hspXGFP and the presence of GFP host cells determined. GFP.sup.+ cells were detected as early as 1 day post-vaccination, and were prominent at days 3 and 7 post-vaccination (
(196) Use of the hspX Promoter to Drive Expression of Foreign Antigens in BCG
(197) To determine if the hspX promoter could be used to modulate immunity to defined antigens, we expressed the gene encoding the immunodominant M. tubercluosis Ag85B antigen under the control of this promoter. Although a homologue of this protein is expressed by BCG, improved anti-Ag85B immunity is conferred on BCG by constitutive over-expression of the antigen [17.] The BCG:P.sub.hspX-85B strain displayed up-regulation of Ag85B expression in cultures grown under conditions of limited aeration (data not shown). To determine if hspX-mediated expression influences presentation of Ag85B by DCs, in vitro cultured DCs from mouse bone marrow were infected with BCG:P.sub.hspX-85B, BCG alone or BCG:P.sub.hsp60-85B, in which Ag85B is constitutively expressed under the control of the strong hsp60 promoter [17]. Infected cells were cultured with transgenic Ag85B-specific CD4.sup.+ T cells (p25 T cells [15]) and proliferation and cytokines release examined. DCs infected with all 3 strains induced p25 T cell proliferation (
(198) Augmented In Vivo T Cell Immunity Induced by Vaccination with BCG:P.sub.hspX-85B
(199) The in vitro immunogenicity experiments suggested that use of the hspX promoter might be able to modify BCG-induced immunity in vivo. Considering the rapid induction of expression driven by the hspX promoter after vaccination (
(200) We next assessed the long-term T cell responses by vaccinating mice with the three BCG strains and examining the generation of Ag85B-sepecific T cells at either 3 or 12 weeks post-vaccination. At 3 weeks post-vaccination, both BCG:P.sub.hsp60-85B and BCG:P.sub.hspX-85B led to the increased generation of Ag85B-specific IFN--secreting cells compared to BCG alone, with BCG:P.sub.hspX-85B in particular increasing the number of responding cells by approximately 5-fold compared to control BCG (
(201) Since Ag85B is an immunodominant antigen of M. tuberculosis, we determined if rBCG expressing Ag85B under control of the hspX promoter can improve the protective effect of BCG against M. tuberculosis infection. Twelve weeks post-vaccination, mice were challenged with low dose M. tuberculosis strain H37Rv via the aerosol route. The bacterial load in both the lungs (
(202) Discussion
(203) The BCG vaccine displays variable protective efficacy against tuberculosis, however the vaccine can be engineered to express foreign molecules in a functional form, and this has driven the development of BCG as a recombinant vector to protect against infectious diseases and malignancies such as cancer [20]. Critical to the success of such approaches is the ability to modulate BCG-induced immunity to generate the desired immune response. In this report, we show that the M. tuberculosis hspX promoter can be used to modulate expression of recombinant antigens produced in BCG. We demonstrate that the hspX promoter is rapidly induced in vitro within DCs (
(204) In order to determine the antigen-specific effects of P.sub.hspX-driven expression, we made use of the hspX promoter to modulate expression of M. tuberculosis Ag85B, a secreted mycobacterial protein that is a component of a number of candidate tuberculosis vaccines [24]. We observed that the early recruitment of DCs to the infection site and rapid phagocytosis of BCG (
(205) Ag85B in BCG does not improved the protective effect of BCG, despite increasing anti-Ag85B immunity in vaccinated mice [17]. This suggests that other antigens may need to be assessed in this system to determine the effect of P.sub.hspX-driven expression in BCG to protect against M. tubercluosis infection, or alternatively BCG:P.sub.hspX-85B should be assessed in other pre-clinical models of tuberculosis where Ag85B expression doe impart some level of improved protective efficacy when expressed in rBCG [25].
(206) The mechanism of improved and sustained immunity due to up-regulation of antigen via the hspX promoter is unclear. Constitutive over-expression of Ag85B using the mycobacterial hsp60 promoter leads to very strong expression levels in rBCG as detected by western blotting [17] and is superior to BCG alone at stimulating antigen specific T cell immunity early after vaccination, however this effect is not sustained long-term (
(207) The results presented in the current study demonstrate that the capacity to induce antigen expression using rBCG as the carrier leads to significant and sustained generation of cellular immune responses. This has clear implications for diseases that require Th1 like responses for their control, such as tuberculosis.
Example 3
(208) Methods
(209) C57BL/6 mice (n=5) were immunized 3 times by s.c injection with either adjuvant (MPL/DDA), Ag85B-CysD fusion protein (10 mg) or Ag85B (10 mg). At the time of the first injection of protein vaccines, mice were immunized once by s.c injection with 510.sup.5 CFU of BCG. Four weeks following the third immunization, mice were challenged with aerosol M. tubercluosis with an infective dose of 100 viable bacilli per lung.
(210) Results
(211) Bacterial load was determined in the lung (
(212) Vaccination with Ag85B-CysD resulted in protection equivalent to the existing BCG vaccine. This is a remarkable result considering BCG expresses a large number of antigenic targets, yet our fusion of two antigens is equally protective (
REFERENCES
(213) 1. Dye, C. and B. G. Williams, The population dynamics and control of tuberculosis. Science, 2010. 328(5980): p. 856-61. 2. Kaufmann, S. H., Fact and fiction in tuberculosis vaccine research: 10 years later. The Lancet infectious diseases, 2011. 11(8): p. 633-40. 4. Timm, J., et al., Differential expression of iron-, carbon-, and oxygen-responsive mycobacterial genes in the lungs of chronically infected mice and tuberculosis patients. Proc Natl Acad Sci USA, 2003. 100(24): p. 14321-6. 5. Pinto, R., et al., The Mycobacterium tuberculosis cysD and cysNC genes form a stress-induced operon that encodes a tri-functional sulfate-activating complex. Microbiology, 2004. 150(Pt 6): p. 1681-6. 6. Banaiee, N.; W. R. Jacobs, Jr., and J. D. Ernst, Regulation of Mycobacterium tuberculosis whiB3 in the mouse lung and macrophages. Infect Immun, 2006. 74(11): p. 6449-57. 7. Muttucumaru, D. G., et al., Gene expression profile of Mycobacterium tuberculosis in a non-replicating state . Tuberculosis (Edinb), 2004. 84(3-4): p. 239-46. 8. Manganelli, R., et al., Role of the extracytoplasmic-function sigma factor sigma(H)in Mycobacterium tuberculosis global gene expression. Mol Microbiol, 2002. 45(2): p. 365-74. 9. Hampshire, T., et al., Stationary phase gene expression of Mycobacterium tuberculosis following a progressive nutrient depletion: a model for persistent organisms? Tuberculosis (Edinb), 2004. 84(3-4): p. 228-38. 10. Betts, J. C., et al., Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Mol Microbiol, 2002. 43(3): p. 717-31. 11. Schnappinger, D., et al., Transcriptional Adaptation of Mycobacterium tuberculosis within Macrophages: Insights into the Phagosomal Environment. J Exp Med, 2003. 198(5): p. 693-704. 12. Rhee, K. Y., et al., S-nitroso proteome of Mycobacterium tuberculosis: Enzymes of intermediary metabolism and antioxidant defense. Proc Natl Acad Sci USA, 2005. 102(2): p. 467-72. 13. Fan, F., et al., Structures and mechanisms of the mycothiol biosynthetic enzymes. Current opinion in chemical biology, 2009. 13(4): p. 451-9. 14. Rawat, M., et al., Mycothiol-deficient Mycobacterium smegmatis mutants are hypersensitive to alkylating agents, free radicals, and antibiotics. Antimicrob Agents Chemother, 2002. 46(11): p. 3348-55. 15. Buchmeier, N. A., et al., Association of mycothiol with protection of Mycobacterium tuberculosis from toxic oxidants and antibiotics. Mol Microbiol, 2003. 47(6): p. 1723-32. 16. Sareen, D., et al., Mycothiol is essential for growth of Mycobacterium tuberculosis Erdman. J Bacteriol, 2003. 185(22): p. 6736-40. 17. Buchmeier, N. and R. C. Fahey, The mshA gene encoding the glycosyltransferase of mycothiol biosynthesis is essential in Mycobacterium tuberculosis Erdman. FEMS Microbiol Lett, 2006. 264(1): p. 74-9. 18. Newton, G. L. and R. C. Fahey, Mycothiol biochemistry. Arch Microbiol, 2002. 178(6): p. 388-94. 19. Senaratne, R. H., et al., 5-Adenosinephosphosulphate reductase (CysH) protects Mycobacterium tuberculosis against free radicals during chronic infection phase in mice. Mol Microbiol, 2006. 59(6): p. 1744-53. 20. Andersen, P., et al., Identification of immunodominant antigens during infection with Mycobacterium tuberculosis. Scandinavian journal of immunology, 1992. 36(6): p. 823-31. 21. Roberts, A. D., et al., Characteristics of protective immunity engendered by vaccination of mice with purified culture filtrate protein antigens of Mycobacterium tuberculosis. Immunology, 1995. 85(3): p. 502-8. 22. de Souza, G. A., et al., Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Journal of proteomics, 2011. 23. Bhave, D. P., W. B. Muse, 3rd, and K. S. Carroll, Drug targets in mycobacterial sulfur metabolism. Infectious disorders drug targets, 2007. 7(2): p. 140-58. 24. Schelle, M. W. and C. R. Bertozzi, Sulfate metabolism in mycobacteria. Chembiochem: a European journal of chemical biology, 2006. 7(10): p. 1516-24. 25. Jackson, M., et al., Persistence and protective efficacy of a Mycobacterium tuberculosis auxotroph vaccine. Infection and immunity, 1999. 67(6): p. 2867-73. 26. Bryk, R., et al., Selective killing of nonreplicating mycobacteria. Cell Host Microbe, 2008. 3(3): p. 137-45. 27. Livak, K. J. and T. D. Schmittgen, Analysis of relative gene expression data using real-time quantitative PCR and the 2(-Delta Delta C(T)) Method. Methods, 2001. 25(4): p. 402-8. 28. Palendira, U., et al., Coexpression of interleukin-12 chains by a self-splicing vector increases the protective cellular immune response of DNA and Mycobacterium Bovis BCG vaccines against Mycobacterium tuberculosis. Infection and immunity, 2002. 70(4): p. 1949-56. 29. Cole, S. T., et al., Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence. Nature, 1998. 393(6685): p. 537-44. 30. Schnell, R., et al., Structural insights into catalysis and inhibition of O-acetlyserine sulfhydrylase from Mycobacterium tuberculosis. Crystal structures of the enzyme alpha-aminoacrylate intermediate and an enzyme-inhibitor complex. J Biol. Chem, 2007. 282(32): p. 23473-81. 31. Sun, M., et al., The trifunctional sulfate-activating complex (SAC)of Mycobacterium tuberculosis. J Biol Chem, 2005. 280(9): p. 7861-6. 32. Hatzios, S. K. and C. R. Bertozzi, The regulation of sulfur metabolism in Mycobacterium tuberculosis. PLoS pathogens, 2011. 7(7): p. e1002036. 33. McKinney, J. D., et al., Persistence of Mycobacterium tuberculosis in macrophages and mice requires the glyoxylate shunt enzyme isocitrate lyase. Nature, 2000. 406(6797): p. 735-8. 34. Voskuil, M. L, K. C. Visconti, and G. K. Schoolnik, Mycobacterium tuberculosis gene expression during adaptation to stationary phase and low-oxygen dormancy. Tuberculosis (Edinb), 2004. 84(3-4): p. 218-27. 35. Danelishvili, L., et al., Secreted Mycobacterium tuberculosis Rv3654c and Rv3655c proteins participate in the suppression of macrophage apoptosis. PLoS One, 2010. 5(5): p. e10474. 37. Heifets, L., J. Simon, and V. Pham, Capreomycin is active against non-replicating M. tuberculosis. Ann Clin Microbiol Antimicrob, 2005. 4: p. 6. 38. Tasneen, R., et al., Enhanced bactericidal activity of rifampin and/or pyrazinamide when combined with PA-824 in a murine model of tuberculosis. Antimicrob Agents Chemother, 2008. 52(10): p. 3664-8. 39. Gartner, T., et al., Mucosal prime-boost vaccination for tuberculosis based on TLR triggering OprI lipoprotein from Pseudomonas aeruginosa fused to mycolyl-transferase Ag85A. Immunology letters, 2007. 111(1): p. 26-35. 40. Kamath, A. T., et al., Co-immunization with DNA vaccines expressing granulocyte-macrophage colony-stimulating factor and mycobacterial secreted proteins enhances T-cell immunity, but not protective efficacy against Mycobacterium tuberculosis. Immunology, 1999. 96(4): p. 511-6. 41. Skinner, M. A., et al., A DNA prime-live vaccine boost strategy in mice can augment IFN-gamma responses to mycobacterial antigens but does not increase the protective efficacy of two attenuated strains of Mycobacterium bovis against bovine tuberculosis: Immunology, 2003. 108(4): p. 548-55. 42. Aagaard, C., et al., A multistage tuberculosis vaccine that confers efficient protection before and after exposure. Nature medicine, 2011. 17(2): p. 189-94. 43. Lu, J., et al., Immunogenicity and Protective Efficacy against Murine Tuberculosis of a Prime-Boost Regimen with BCG and a DNA Vaccine Expressing ESAT-6and Ag85A Fusion Protein. Clin Dev Immunol, 2011. 2011: p. 617892. 44. Dey, B., et al., Latency Antigen alpha-Crystallin Based Vaccination Imparts a Robust Protection against TB by Modulating the Dynamics of Pulmonary Cytokines. PLoS One, 2011. 6(4): p. e18773. 45. Rouanet, C., et al., Subcutaneous boosting with heparin binding haemagglutinin increases BCG-induced protection against tuberculosis. Microbes and infection/Institut Pasteur, 2009. 11(13): p. 995-1001. 47. Droux, M., et al., Interactions between serine acetyltransferase and O-acetlyserine (thiol) lyase in higher plantsstructural and kinetic properties of the free and bound enzymes. European journal of biochemistry/FEBS, 1998. 255(1): p. 235-45. 48. Mino, K., et al., Characteristics of serine acetyltransferase from Escherichia coli deleting different lengths of amino acid residues from the C-terminus. Bioscience, biotechnology, and biochemistry, 2000. 64(9): p. 1874-80. 49. Kredich, N. M. and G. M. Tomkins, The enzymic synthesis of L-cysteine in Escherichia coli and Salmonella typhimurium. The Journal of biological chemistry, 1966. 241(21): p. 4955-65. 50. Mino, K., et al., Purification and characterization of serine acetyltransferase from Escherichia coli partially truncated at the C-terminal region. Bioscience, biotechnology, and biochemistry, 1999. 63(1): p. 168-79. 51. Wei, J., et al., Cysteine biosynthetic enzymes are the pieces of a metabolic energy pump. Biochemistry, 2002. 41(26): p. 8493-8. [1] Nchinda G, Kuroiwa J, Oks M, Trumpfheller C, Park C G, Huang Y, et al. The efficacy of DNA vaccination is enhanced in mice by targeting the encoded protein to dendritic cells. J Clin Invest 2008 April; 118(4):1427-36. [2] Ryan A A, Wozniak T M, Shklovskaya E, O'Donnell M A, Fazekas de St Groth B, Britton W J, et al. Improved protection against disseminated tuberculosis by Mycobacterium bovis bacillus Calmette-Gurin secreting murine GM-CSF is associated with expansion and activation of APCs. J Immunol 2007; 179(December (12)):8418-24. [3] Lozza L, Rivino L, Guarda G, Jarrossay D, Rinaldi A, Bertoni F, et al. The strength of T cell stimulation determines IL-7 responsiveness, secondary expansion, and lineage commitment of primed human CD4(+)IL-7R(hi) T cells. Eur J Immunol 2008; 38(January (1)):30-9. [4] Ohara N, Yamada T. Recombinant BCG vaccines. Vaccine 2001; 19(30):4089-98. [5] Alexandroff A B, Jackson A M, O'Donnell M A, James K. BCG immunotherapy of bladder cancer: 20 years on. Lancet 1999; 353(9165):1689-94. [6] Ristori G, Buzzi M G, Sabatini U, Giugni E, Bastianello S, Viselli F, et al. Use of Bacille Calmette-Guerin (BCG) in multiple sclerosis. Neurology 1999; 53(October (7)):1588-9. [7] Kodama S, Davis M, Faustman D L. The therapeutic potential of tumor necrosis factor for autoimmune disease: a mechanistically based hypothesis. Cell Mol Life Sci 2005; 62(August (16)):1850-62. [8] Jiao X, Lo-Man R, Guermonprez P, Fiette L, Deriaud E, Burgaud S, et al. Dendritic cells are host cells for mycobacteria in vivo that trigger innate and acquired immunity. J Immunol 2002; 168(February (3)): 1294-301. [9] Wolf A J, Linas B, Trevejo-Nunez G J, Kincaid E, Tamura T, Takatsu K, et al. Mycobacterium tuberculosis infects dendritic cells with high frequency and impairs their function in vivo. J Immunol 2007; 179(August (4)):2509-19. [10] Chang Z, Primm T P, Jakana J, Lee I H, Serysheva I, Chiu W, et al. Mycobacterium tuberculosis 16-kDa antigen (Hsp16.3) functions as an oligomeric structure in vitro to suppress thermal aggregation. J Biol Chem 1996; 271(12):7218-23. [11] Yuan Y, Crane D D, Barry 3rd C E. Stationary phase-associated protein expression in Mycobacterium tuberculosis: function of the mycobacterial alpha-crystallin homolog. J Bacteriol 1996; 178(15):4484-92. [12] Yuan Y, Crane D D, Simpson R M, Zhu Y Q, Hickey M J, Sherman D R, et al. The 16-kDa alpha-crystallin (Acr) protein of Mycobacterium tuberculosis Is required for growth in macrophages. Proc Natl. Acad Sci USA 1998; 95(16):9578-83. [13] Garbe T R, Hibler N S, Deretic V. Response to reactive nitrogen intermediates in Mycobacterium tuberculosis: induction of the 16-kilodalton alpha-crystallin homolog by exposure to nitric oxide donors. Infect Immun 1999; 67(1):460-5. [14] Shi L, Jung Y J, Tyagi S, Gennaro M L, North R J. Expression of Th1-mediated immunity in mouse lungs induces a Mycobacterium tuberculosis transcription pattern characteristic of non-replicating persistence. Proc Natl Acad Sci USA 2003; 100(1):241-6 [15] Tamura T, Ariga H, Kinashi T, Uchara S, Kikuchi T, Nakada M, et al. The role of antigenic peptide in CD4+ T helper phenotype development in a T cell receptor transgenic model. Int Immunol 2004; 16(December (12)):1691-9. [16] Stover C K, de la Cruz V F, Fuerst T R, Burlein J E, Benson L A, Bennett L T, et al. New use of BCG for recombinant vaccines. Nature 1991; 351(6326):456-60. [17] Palendira U, Spratt J M, Britton W I, Triccas J A. Expanding the antigenic repertoire of BCG improves protective efficacy against aerosol Mycobacterium tuberculosis infection. Vaccine 2005; 23(February (14)):1680-5. [18] Demangel C, Bean A G, Martin E, Feng C G, Kamath A T, Britton W J. Protection against aerosol Mycobacterium tuberculosis infection using Mycobacterium bovis Bacillus Calmette Gurin-infected dendritic cells. Eur J Immunol 1999; 29(6):1972-9. [19] Triccas J A, Sun L, Palendira U, Britton W J. Comparative affects of plasmidencoded interleukin 12 and interleukin 18 on the protective efficacy of DNA vaccination against Mycobacterium tuberculosis. Immunol Cell Biol 2002 August; 80(4):346-50. [20] Triccas J A. Recombinant BCG as a vaccine vehicle to protect against tuberculosis. Bioeng Bugs 2001; 1(2):1-6. [21] Yuan Y, Crane D D, Simpson R M, Zhu Y Q, Hickey M J, Sherman D R, et al. The 16-kDa alpha-crystallin (Acr) protein of Mycobacterium tuberculosis is required for growth in macrophages. Proc Natl Acad Sci USA 1998; 95(16):9578-83. [22] Hickman S P, Chan J, Salgame P. Mycobacterium tuberculosis induces differential cytokine production from dendritic cells and macrophages with divergent effects on naive T cell polarization. J Immunol 2002; 168(May (9)):4636-42. [23] Giacomini E, Iona E, Ferroni L, Miettinen M, Fattorini L, Orefici G, et al. Infection of human macrophages and dendritic cells with Mycobacterium tuberculosis induces a differential cytokine gene expression that modulates T cell response. J Immunol 2001; 166(June (12)):7033-41. [24] Dietrich J, Lundberg C V, Andersen P. TB vaccine strategieswhat is needed to solve a complex problem? Tuberculosis (Edinb) 2006; 86(May-July (3-4)):163-8. [25] Horwitz M A, Harth G, Dillon B J, Maslesa-Galic S. Recombinant Bacillus Calmette-Gurin (BCG) vaccines expressing the Mycobacterium tuberculosis 30-kDa major secretory protein induce greater protective immunity against tuberculosis than conventional BCG vaccines in a highly susceptible animal model. Proc Natl Acad Sci USA 2000; 97(December (25)):13853-8. [26] Al-Zarouni M, Dale J W. Expression of foreign genes in Mycobacterium bovis BCG strains using different promoters reveals instability of the hsp60 promoter for expression of foreign genes in Mycobacterium bovis BCG strains. Tuberculosis (Edinb) 2002; 82(6):283-91. [27] Jagannath C, Lindsey D R, Dhandayuthapani S, Xu Y, Hunter Jr R L, Eissa N T. Autophagy enhances the efficacy of BCG vaccine by increasing peptide presentation in mouse dendritic cells. Nat Med 2009; 15(March (3)):267-76. [28] Hohmann E L, Oletta C A, Loomis W P, Miller S I. Macrophage-inducible expression of a model antigen in Salmonella typhimurium enhances immunogenicity. Proc Natl Acad Sci USA 1995; 92(March (7)):2904-8. [29] Dunstan S J, Simmons C P, Strugnell R A. Use of in vivo-regulated promoters to deliver antigens from attenuated Salmonella enterica var Typhimurium. Infect Immun 1999; 67(October (10)):5133-41. [30] Londono L P, Chatfield S, Tindle R W, Herd K, Gao X M, Frazer I, et al. Immunisation of mice using Salmonella typhimurium expressing human papillomavirus type 16 E7 epitopes inserted into hepatitis B virus core antigen. Vaccine 1996; 14(April (6)):545-52. Pinto R., Harrison J S, Hsu T, et al. Sulfite reduction in mycobacteria. J Bacteriol 2007; 189: 6714-22. Hara S, Payne M A, Schnackerz K D, et al A rapid purification procedure and computer-assisted sulfide ion selective electrode assay for O-acetlyserine sulfhydrylase from Salmonella typhimurium. Protein Expr Purif 1990; 1:70-6 Sun M, Leyh, T. S. Channeling in sulfate activating complexes. Biochemistry 2006; 45:11304-11.
(214) TABLE-US-00001 TABLE1 Supplementary Primerandclonesforproteinpurificationusedinthisstudy ForReal-timePCR Gene annotation Genename Forwardprimer Reverseprimer cysDN ATPsulfurylase 5-agtcatcgccgaaac 5-ttgccatcgtcgacg tgc-3 gaa-3 cysH APSreductase 5-gacatcgcgggtgga 5-gacggaetcgatcgcatc ca-3 tc-3 sirA Sulphitereductase 5-gttcgagcacagcat 5-gtccgtcgtcgatcatct ttggt-3 gt-3 cysK1 O-Acetyl-serineSulfhydralse 5-ttctcgaacccacga 5-cccggagtgaggatgagt gcg-3 tc-3 cysE SerineAcetlysulfhydralse 5-ttcatcgaccacgcg 5-gatcggaccgaggacctt acc-3 g-3 rrs 16srRNA 5-aggcagcagtgggga 5-ctaccgtcaatccgagag ata-3 aa-3 ForDNAvaccinecloning-allgenesclonedintopcDNA3. RestrictionEnzymesiteusedincloningishighlighted. Forwardprimer Reverseprimer DNA-cysD cysDwascutoutofapET22b(Novagen)vectorusingBamHIandXhoIrestriction enzymesandclonedintopcDNA3cutwiththesameenzymes DNA-cysN cysNwascutoutofapET22bvectorusingBamHIandNotIrestrictionenzymes andclonedintopcDNA3cutwiththesameenzymes DNA-cysH 5-acgaaagcttatgagcggcgagaca-3 5-ggggggatcccgaggcgtgcaaccc-3 DNA-sirA 5-taggaagcttatgtccgcgaaggag-3 5-tcgcggtacctcgcaggtcgtcctc-3 DNA-cysK1 5-ggcgaagcttatgagcatcgccgag-3 5-gcatggatccgtcagccacgtcggc-3 DNA-cysE 5-tgacaagcttatgctgacggccatg-3 5-tattggtaccgatcgagaagtcctc-3 Forproteinpurification Description Reference CysDN Describedpreviously ((Pinto,2004;Sun,2005) CysH Describedpreviously ((Sun,2006) SirA Describedpreviously ((Pinto,2007) CysK1 ClonedintopET-23A(Noavagen)using ((Hara,1990;Wei,2002) NdeIandBamHIrestrictionenzymes andpurifiedasdescribedpreviously CysE Clonedintoadual-tagexpression ((Sun,2005) vectorderivedfrompGEXvector ((Andreassi,2004#98)usingNdeIand NotIrestrictionenzymesandwas purifiedasdescribedpreviously Ag85B ClonedintopET19b(Noavagen) expressionvectorwithNdeI&BamHI restrictionenzymesandpurification ofthisproteinwascarriedout throughstandardHis-tagpurification protocols(Qiagen)
(215) TABLE-US-00002 (CysDnucleicsequence) SEQIDNo:1 ATGGCAATAACCATAAATATGGTCAATCCTACCGGATTTATCAGGTATGAGGACGTGGAACAG GAAGCCATGACCAGCGATGTGACGGTGGGCCCCGCACCCGGCCAGTACCAACTGAGCCATCTG CGCTTGCTGGAGGCCGAAGCCATCCACGTCATCCGGGAGGTGGCCGCCGAGTTCGAGCGGCCA GTGCTGTTGTTCTCGGGGGGCAAGGACTCCATCGTCATGCTGCACCTGGCGCTGAAGGCGTTT CGGCCCGGGCGACTGCCGTTCCCGGTCATGCACGTCGACACCGGTCACAACTTCGACGAAGTT ATCGCTACCCGAGACGAGTTGGTCGCCGCGGCCGGGGTGCGGCTGGTGGTGGCGTCGGTGCAG GACGATATCGATGCCGGTCGGGTCGTCGAGACCATCCCGTCGCGAAATCCGATACAGACCGTG ACGCTGCTGCGGGCCATCCGGGAGAACCAATTCGACGCGGCATTCGGGGGAGCCCGGCGCGAC GAGGAGAAGGCCCGCGCCAAGGAGCGGGTGTTCAGCTTCCGCGACGAGTTCGGCCAGTGGGAC CCGAAGGCTCAGCGGCCGGAACTGTGGAACCTCTACAACGGACGGCACCACAAGGGCGAGCAC ATCCGGGTCTTCCCGCTGTCCAACTGGACCGAATTCGACATCTGGTCCTACATCGGCGCCGAG CAGGTCAGGCTGCCGTCCATCTATTTCGCCCACCGGCGCAAGGTGTTTCAGCGCGACGGCATG TTGCTGGCCGTGCACCGGCACATGCAACCGCGAGCCGACGAGCCGGTGTTCGAGGCCACGGTG CGATTCCGCACCGTCGGGGATGTTACCTGCACCGGGTGCGTCGAGTCGTCGGCATCGACGGTC GCGGAAGTCATCGCCGAAACTGCGGTGGCCCGCTTGACGGAGCGCGGGGCGACCAGGGCTGAC GACCGGATCTCGGAGGCTGGAATGGAAGACCGCAAGCGGCAGGGATACTTCTGA (CysDaminoacidsequence) SEQIDNo:2 MAITINMVNPTGFIRYEDVEQEAMTSDVTVGPAPGQYQLSHLRLLEAEAIHVIREVAAEFERP VLLFSGGKDSIVMLHLALKAFRPGRLPFPVMHVDTGHNFDEVIATRDELVAAAGVRLVVASVQ DDIDAGRVVETIPSRNPIQTVTLLRAIRENQFDAAFGGARRDEEKARAKERVFSFRDEFGQWD PKAQRPELWNLYNGRHHKGEHIRVFPLSNWTEFDIWSYIGAEQVRLPSIYFAHRRKVFQRDGM LLAVHRHMQPRADEPVFEATVRFRTVGDVTCTGCVESSASTVAEVIAETAVARLTERGATRAD DRISEAGMEDRKRQGYF (CysNCDNAsequence) SEQIDNo:3 ATGACGACGCTATTGCGGCTGGCGACAGCGGGTTCCGTCGACGATGGCAAGTCCACGCTGATT GGGCGGCTACTCTACGACTCCAAGGCTGTGATGGAAGACCAGTGGGCGTCGGTGGAGCAAACG TCCAAGGACCGGGGCCACGACTACACCGACCTGGCTCTGGTCACCGACGGCCTGCGGGCCGAG CGGGAACAGGGCATCACCATCGACGTTGCCTACCGCTACTTCGCCACTCCCAAGCGGAAATTC ATCATTGCCGACACCCCGGGACACATCCAATACACCCGCAACATGGTGACCGGTGCGTCCACC GCCCAACTGGTGATCGTACTGGTGGATGCCCGGCACGGCTTGCTGGAGCAATCCCGCCGGCAC GCCTTCCTGGCGTCGCTGCTGGGCATCCGCCACCTGGTGCTCGCGGTCAACAAGATGGACTTG CTTGGCTGGGACCAAGAGAAATTCGACGCGATTCGAGACGAATTCCACGCCTTCGCGGCCCGC CTCGACGTGCAGGACGTCACCTCCATCCCAATCTCCGCGCTGCACGGCGACAACGTGGTGACC AAATCCGACCAGACGCCCTGGTACGAGGGACCGTCGCTGCTGTCGCATCTCGAAGACGTCTAC ATCGCCGGTGACCGCAACATGGTCGACGTGCGATTCCCGGTCCAGTACGTCATCCGGCCGCAC ACCCTCGAGCATCAAGACCACCGCAGCTACGCGGGCACCGTGGCCAGTGGGGTAATGCGTTCA GGCGACGAAGTTGTCGTGCTGCCGATCGGTAAGACCACCCGGATCACCGCGATCGACGGCCCG AACGGCCCGGTGGCAGAAGCGTTTCCGCCGATGGCGGTTTCGGTGCGGCTCGCCGACGACATC GATATCTCGCGTGGTGACATGATCGCTCGCACCCACAACCAGCCCAGGATCACACAAGAATTC GACGCGACCGTGTGCTGGATGGCCGACAACGCGGTGCTAGAGCCCGGCCGCGACTACGTTGTC AAGCACACCACCCGAACCGTCCGCGCGAGGATAGCCGGGCTGGATTACCGGCTCGATGTCAAC ACCCTGCATCGCGACAAGACCGCAACGGCGTTGAAACTCAACGAACTGGGCCGTGTTTCGCTG CGCACCCAGGTGCCGTTGCTGCTTGACGAGTACACCCGCAACGCTAGCACCGGCTCGTTCATC CTCATTGACCCCGACACCAACGGAACGGTGGCGGCGGGCATGGTGTTACGCGACGTCTCGGCC CGCACGCCTAGCCCGAACACGGTGCGGCACAGATCGCTCGTCACTGCGCAAGATCGGCCGCCC AGGGGCAAGACGGTGTGGTTTACCGGACTGTCCGGCTCCGGCAAGTCGTCGGTGGCCATGCTG GTTGAGCGGAAGCTACTCGAAAAGGGCATCTCCGCTTACGTTCTGGACGGCGACAACCTACGG CATGGCCTCAACGCCGACCTGGGCTTTTCCATGGCCGACCGCGCGGAGAACCTGCGCCGGCTG TCGCATGTGGCCACACTGCTCGCCGATTGTGGCCACCTGGTGCTGGTGCCCGCGATCAGCCCC CTTGCTGAGCACCGTGCCCTGGCTCGTAAAGTGCACGCTGATGCGGGAATCGACTTTTTCGAG GTGTTCTGTGACACCCCGCTGCAGGACTGTGAGAGGCGTGATCCCAAAGGGTTGTACGCCAAA GCGCGTGCGGGTGAGATCACGCACTTCACCGGGATCGACAGCCCATATCAGCGGCCCAAGAAC CCAGACCTACGGCTTACGCCGGATCGCAGCATAGACGAGCAGGCGCAGGAGGTTATCGACCTG TTGGAGTCATCGTCTTAG (CysNCaminoacidsequence) SEQIDNo:4 MTTLLRLATAGSVDDGKSTLIGRLLYDSKAVMEDQWASVEQTSKDRGHDYTDLALVTDGLRAR EQGITIDVAYRYFATPKRKFIIADTPGHIQYTRNMVTGASTAQLVIVLVDARHGLLEQSRRHA FLASLLGIRHLVLAVNKMDLLGWDQEKFDAIRDEFHAFAARLDVQDVTSIPISALHGDNVVTK SDQTPWYEGPSLLSHLEDVYIAGDRNMVDVRFPVQYVIRPHTLEHQDHRSYAGTVASGVMRSG DEVVVLPIGKTTRITAIDGPNGPVAEAFPPMAVSVRLADDIDISRGDMIARTHNQPRITQEFD ATVCWMADNAVLEPGRDYVVKHTTRTVRARIAGLDYRLDVNTLHRDKTATALKLNELGRVSLR TQVPLLLDEYTRNASTGSFILIDPDTNGTVAAGMVLRDVSARTPSPNTVRHRSLVTAQDRPPR GKTVWFTGLSGSGKSSVAMLVERKLLEKGISAYVLDGDNLRHGLNADLGFSMADRAENLRRLS HVATLLADCGHLVLVPAISPLAEHRALARKVHADAGIDFFEVFCDTPLQDCERRDPKGLYAKA RAGEITHFTGIDSPYQRPKNPDLRLTPDRSIDEQAQEVIDLLESSS (Ag85Bnucleicacidsequence) SEQIDNo:5 ATGACAGACGTGAGCCGAAAGATTCGAGCTTGGGGACGCCGATTGATGATCGGCACGGCAGCG GCTGTAGTCCTTCCGGGCCTGGTGGGGCTTGCCGGCGGAGCGGCAACCGCGGGCGCGTTCTCC CGGCCGGGGCTGCCGGTCGAGTACCTGCAGGTGCCGTCGCCGTCGATGGGCCGCGACATCAAG GTTCAGTTCCAGAGCGGTGGGAACAACTCACCTGCGGTTTATCTGCTCGACGGCCTGCGCGCC CAAGACGACTACAACGGCTGGGATATCAACACCCCGGCGTTCGAGTGGTACTACCAGTCGGGA CTGTCGATAGTCATGCCGGTCGGCGGGCAGTCCAGCTTCTACAGCGACTGGTACAGCCCGGCC TGCGGTAAGGCTGGCTGCCAGACTTACAAGTGGGAAACCTTCCTGACCAGCGAGCTGCCGCAA TGGTTGTCCGCCAACAGGGCCGTGAAGCCCACCGGCAGCGCTGCAATCGGCTTGTCGATGGCC GGCTCGTCGGCAATGATCTTGGCCGCCTACCACCCCCAGCAGTTCATCTACGCCGGCTCGCTG TCGGCCCTGCTGGACCCCTCTCAGGGGATGGGGCCTAGCCTGATCGGCCTCGCGATGGGTGAC GCCGGCGGTTACAAGGCCGCAGACATGTGGGGTCCCTCGAGTGACCCGGCATGGGAGCGCAAC GACCCTACGCAGCAGATCCCCAAGCTGGTCGCAAACAACACCCGGCTATGGGTTTATTGCGGG AACGGCACCCCGAACGAGTTGGGCGGTGCCAACATACCCGCCGAGTTCTTGGAGAACTTCGTT CGTAGCAGCAACCTGAAGTTCCAGGATGCGTACAACGCCGCGGGCGGGCACAACGCCGTGTTC AACTTCCCGCCCAACGGCACGCACAGCTGGGAGTACTGGGGCGCTCAGCTCAACGCCATGAAG GGTGACCTGCAGAGTTCGTTAGGCGCCGGCTGA (Ag85Baminoacidsequence) SEQIDNo:6 MTDVSRKIRAWGRRLMIGTAAAVVLPGLVGLAGGAATAGAFSRPGLPVEYLQVPSPSMGRDIK VQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPA CGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSL SALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCG NGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMK GDLQSSLGAG (HspXpromoter) SEQIDNo:7 CTGCACCGCGCTCTTGATGACATCGGTGGTCACCATGGTGTCCGGCATGATCAACCTCCGCTG TTCGATATCACCCCGATCTTTCTGAACGGCGGTTGGCAGACAACAGGGTCAATGGTCCCCAAG TGGATCACCGACGGGCGCGGACAAATGGCCCGCGCTTCGGGGACTTCTGTCCCTAGCCCTGGC CACGATGGGCTGGTCGGATCAAAGGCATCCGTTTCCATCGATTAGGAGG (Ag85BCysDaminoacidsequence) SEQIDNo:8 MTDVSRKIRAWGRRLMIGTAAAVVLPGLVGLAGGAATAGAFSRPGLPVEYLQVPSPSMGRDIK VQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPA CGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSL SALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCG NGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMK GDLQSSLGAGGFMAITINMVNPTGFIRYEDVEQEAMTSDVTVGPAPGQYQLSHLRLLEAEAIH VIREVAAEFERPVLLFSGGKDSIVMLHLALKAFRPGRLPFPVMHVDTGHNFDEVIATRDELVA AAGVRLVVASVQDDIDAGRVVETIPSRNPIQTVTLLRAIRENQFDAAFGGARRDEEKARAKER VFSFRDEFGQWDPKAQRPELWNLYNGRHHKGEHIRVFPLSNWTEFDIWSYIGAEQVRLPSIYF AHRRKVFQRDGMLLAVHRHMQPRADEPVFEATVRFRTVGDVTCTGCVESSASTVAEVIAETAV ARLTERGATRADDRISEAGMEDRKRQGYF (pHspX85BCysDnucleicacidsequence) SEQIDNo:9 CTAGACGCCACCCTCCGGGCCGTTGCTTCGCAACGTTCAAATCCGCTCCCGGCGGATTTGTCC TACTCAGGAGAGCGTTCACCGACAAACAACAGATAAAACGAAAGGCCCAGCCTTTCGACTGAG CCTTTCGTTTTATTTGATGCCTGGCAGTTCCCTACTCTCGCATGGGGAGACCCCACACTACCA TCGGCGCTAGAGCCGACTAGACCTGCACCGCGCTCTTGATGACATCGGTGGTCACCATGGTGT CCGGCATGATCAACCTCCGCTGTTCGATATCACCCCGATCTTTCTGAACGGCGGTTGGCAGAC AACAGGGTCAATGGTCCCCAAGTGGATCACCGACGGGCGCGGACAAATGGCCCGCGCTTCGGG GACTTCTGTCCCTAGCCCTGGCCACGATGGGCTGGTCGGATCAAAGGCATCCGTTTCCATCGA TTAGGAGGAAGCTTATGACAGACGTGAGCCGAAAGATTCGAGCTTGGGGACGCCGATTGATGA TCGGCACGGCAGCGGCTGTAGTCCTTCCGGGCCTGGTGGGGCTTGCCGGCGGAGCGGCAACCG CGGGCGCGTTCTCCCGGCCGGGGCTGCCGGTCGAGTACCTGCAGGTGCCGTCGCCGTCGATGG GCCGCGACATCAAGGTTCAGTTCCAGAGCGGTGGGAACAACTCACCTGCGGTTTATCTGCTCG ACGGCCTGCGCGCCCAAGACGACTACAACGGCTGGGATATCAACACCCCGGCGTTCGAGTGGT ACTACCAGTCGGGACTGTCGATAGTCATGCCGGTCGGCGGGCAGTCCAGCTTCTACAGCGACT GGTACAGCCCGGCCTGCGGTAAGGCTGGCTGCCAGACTTACAAGTGGGAAACCTTCCTGACCA GCGAGCTGCCGCAATGGTTGTCCGCCAACAGGGCCGTGAAGCCCACCGGCAGCGCTGCAATCG GCTTGTCGATGGCCGGCTCGTCGGCAATGATCTTGGCCGCCTACCACCCCCAGCAGTTCATCT ACGCCGGCTCGCTGTCGGCCCTGCTGGACCCCTCTCAGGGGATGGGGCCTAGCCTGATCGGCC TCGCGATGGGTGACGCCGGCGGTTACAAGGCCGCAGACATGTGGGGTCCCTCGAGTGACCCGG CATGGGAGCGCAACGACCCTACGCAGCAGATCCCCAAGCTGGTCGCAAACAACACCCGGCTAT GGGTTTATTGCGGGAACGGCACCCCGAACGAGTTGGGCGGTGCCAACATACCCGCCGAGTTCT TGGAGAACTTCGTTCGTAGCAGCAACCTGAAGTTCCAGGATGCGTACAACGCCGCGGGCGGGC ACAACGCCGTGTTCAACTTCCCGCCCAACGGCACGCACAGCTGGGAGTACTGGGGCGCTCAGC TCAACGCCATGAAGGGTGACCTGCAGAGTTCGTTAGGCGCCGGCGGATCCATGGCAATAACCA TAAATATGGTCAATCCTACCGGATTTATCAGGTATGAGGACGTGGAACAGGAAGCCATGACCA GCGATGTGACGGTGGGCCCCGCACCCGGCCAGTACCAACTGAGCCATCTGCGCTTGCTGGAGG CCGAAGCCATCCACGTCATCCGGGAGGTGGCCGCCGAGTTCGAGCGGCCAGTGCTGTTGTTCT CGGGGGGCAAGGACTCCATCGTCATGCTGCACCTGGCGCTGAAGGCGTTTCGGCCCGGGCGAC TGCCGTTCCCGGTCATGCACGTCGACACCGGTCACAACTTCGACGAAGTTATCGCTACCCGAG ACGAGTTGGTCGCCGCGGCCGGGGTGCGGCTGGTGGTGGCGTCGGTGCAGGACGATATCGATG CCGGTCGGGTCGTCGAGACCATCCCGTCGCGAAATCCGATACAGACCGTGACGCTGCTGCGGG CCATCCGGGAGAACCAATTCGACGCGGCATTCGGGGGAGCCCGGCGCGACGAGGAGAAGGCCC GCGCCAAGGAGCGGGTGTTCAGCTTCCGCGACGAGTTCGGCCAGTGGGACCCGAAGGCTCAGC GGCCGGAACTGTGGAACCTCTACAACGGACGGCACCACAAGGGCGAGCACATCCGGGTCTTCC CGCTGTCCAACTGGACCGAATTCGACATCTGGTCCTACATCGGCGCCGAGCAGGTCAGGCTGC CGTCCATCTATTTCGCCCACCGGCGCAAGGTGTTTCAGCGCGACGGCATGTTGCTGGCCGTGC ACCGGCACATGCAACCGCGAGCCGACGAGCCGGTGTTCGAGGCCACGGTGCGATTCCGCACCG TCGGGGATGTTACCTGCACCGGGTGCGTCGAGTCGTCGGCATCGACGGTCGCGGAAGTCATCG CCGAAACTGCGGTGGCCCGCTTGACGGAGCGCGGGGCGACCAGGGCTGACGACCGGATCTCGG AGGCTGGAATGGAAGACCGCAAGCGGCAGGGATACTTCCAGCTGCACCACCACCACCACCACT GAGTTAACTAGCGTACGATCGACTGCCAGGCATCAAATAAAACGAAAGGCTCAGTCGAAAGAC TGGGCCTTTCGTTTTATGCCATCATGGCCGCGGTGATCAGCTAGCCACCTGACGTCGGGGGGG GGGGAAAGCGACGTTGTGTCTCAAAATCTCTGATGTTACATTGCACAAGATAAAATATATCAT CATGAACAATAAAACTGTCTGCTTACATAAACAGTAATACAAGGGGTGTTATGAGCCATATTC AACGGGAAACGTCTTGCTCGAGGCCGCGATTAAATTCCAACATGGATGCTGATTTATATGGGT ATAAATGGGCTCGCGATAATGTCGGGCAATCAGGTGCGACAATCTATCGCTTGTATGGGAAGC CCCATGCGCCAGAGTTGTTTCTGAAACATGGCAAAGGTAGCGTTGCCAATGATGTTACAGATG AGATGGTCAGACTAAACTGGCTGACGGAATTTATGCCTCTTCCGACCATCAAGCATTTTATCC GTACTCCTGATGATGCATGGTTACTCACCACTGCGATCCCCGGGAAAACAGCATTCCAGGTAT TAGAAGAATATCCTGATTCAGGTGAAAATATTGTTGATGCGCTGGCAGTGTTCCTGCGCCGGT TGCATTCGATTCCTGTTTGTAATTGTCCTTTTAACAGCGATCGCGTATTTCGTCTCGCTCAGG CGCAATCACGAATGAATAACGGTTTGGTTGATGCGAGTGATTTTGATGACGAGCGTAATGGCT GGCCTGTTGAACAAGTCTGGAAAGAAATGCATAATCTTTTGCCATTCTCACCGGATTCAGTCG TCACTCATGGTGATTTCTCACTTGATAACCTTATTTTTGACGAGGGGAAATTAATAGGTTGTA TTGATGTTGGACGAGTCGGAATCGCAGACCGATACCAGGATCTTGCCATCCTATGGAACTGCC TCGGTGAGTTTTCTCCTTCATTACAGAAACGGCTTTTTCAAAAATATGGTATTGATAATCCTG ATATGAATAAATTGCAGTTTCATTTGATGCTCGATGAGTTTTTCTAATCAGAATTGGTTAATT GGTTGTAACACTGGCAGAGCATTACGCTGACTTGACGGGACGGCGGCTTTGTTGAATAAATCG AACTTTTGCTGAGTTGAAGGATCAGATCACGCATCTTCCCGACAACGCAGACCGTTCCGTGGC AAAGCAAAAGTTCAAAATCACCAACTGGTCCACCTACAACAAAGCTCTCATCAACCGTGGCTC CCTCACTTTCTGGCTGGATGATGGGGCGATTCAGGCCTGGTATGAGTCAGCAACACCTTCTTC ACGAGGCAGACCTCACTAGTTCCACTGAGCGTCAGACCCCGTAGAAAAGATCAAAGGATCTTC TTGAGATCCTTTTTTTCTGCGCGTAATCTGCTGCTTGCAAACAAAAAAACCACCGCTACCAGC GGTGGTTTGTTTGCCGGATCAAGAGCTACCAACTCTTTTTCCGAAGGTAACTGGCTTCAGCAG AGCGCAGATACCAAATACTGTCCTTCTAGTGTAGCCGTAGTTAGGCCACCACTTCAAGAACTC TGTAGCACCGCCTACATACCTCGCTCTGCTAATCCTGTTACCAGTGGCTGCTGCCAGTGGCGA TAAGTCGTGTCTTACCGGGTTGGACTCAAGACGATAGTTACCGGATAAGGCGCAGCGGTCGGG CTGAACGGGGGGTTCGTGCACACAGCCCAGCTTGGAGCGAACGACCTACACCGAACTGAGATA CCTACAGCGTGAGCATTGAGAAAGCGCCACGCTTCCCGAAGGGAGAAAGGCGGACAGGTATCC GGTAAGCGGCAGGGTCGGAACAGGAGAGCGCACGAGGGAGCTTCCAGGGGGAAACGCCTGGTA TCTTTATAGTCCTGTCGGGTTTCGCCACCTCTGACTTGAGCGTCGATTTTTGTGATGCTCGTC AGGGGGGCGGAGCCTATGGAAAAACGCCAGCAACGCGGCCTTTTTACGGTTCCTGGCCTTTTG CTGGCCTTTTGCTCACATGTTCTTTCCTGCGTTATCCCCTGATTCTGTGGATAACCGTATTAC CGCCTTTGAGTGAGCTGATACCGCTCGCCGCAGCCGAACGACCGAGCGCAACGCGTGAGCCCA CCAGCTCCGTAAGTTCGGGTGCTGTGTGGCTCGTACCCGCGCATTCAGGCGGCAGGGGGTCTA ACGGGTCTAAGGCGGCGTGTACGGCCGCCACAGCGGCTCTTAGCGGCCCGGAAACGTCCTCGA AACGACGCATGTGTTCCTCCTGGTTGGTACAGGTGGTTGGGGGTGCTCGGCTGTCGCTGGTGT TTCATCATCAGGGCTCGACGGGAGAGCGGGGGAGTGTGCAGTTGTGGGGTGGCCCCTCAGCGA AATATCTGACTTGGAGCTCGTGTCGGACCATACACCGGTGATTAATCGTGGTTTATTATCAAG CGTGAGCCACGTCGCCGACGAATTTGAGCAGCTCTGGCTGCCGTACTGGTCCCTGGCAAGCGA CGATCTGCTCGAGGGGATCTACCGCCAAAGCCGCGCGTCGGCCCTAGGCCGCCGGTACATCGA GGCGAACCCAACAGCGCTGGCAAACCTGCTGGTCGTGGACGTAGACCATCCAGACGCAGCGCT CCGAGCGCTCAGCGCCCGGGGGTCCCATCCGCTGCCCAACGCGATCGTGGGCAATCGCGCCAA CGGCCACGCACACGCAGTGTGGGCACTCAACGCCCCTGTTCCACGCACCGAATACGCGCGGCG TAAGCCGCTCGCATACATGGCGGCGTGCGCCGAAGGCCTTCGGCGCGCCGTCGATGGCGACCG CAGTTACTCAGGCCTCATGACCAAAAACCCCGGCCACATCGCCTGGGAAACGGAATGGCTCCA CTCAGATCTCTACACACTCAGCCACATCGAGGCCGAGCTCGGCGCGAACATGCCACCGCCGCG CTGGCGTCAGCAGACCACGTACAAAGCGGCTCCGACGCCGCTAGGGCGGAATTGCGCACTGTT CGATTCCGTCAGGTTGTGGGCCTATCTTCCCGCCCTCATGCGGATCTACCTGCCGACCCGGAA CGTGGACGGACTCGGCCGCGCGATCTATGCCGAGTGCCACGCGCGAAACGCCGAATTTCCGTG CAACGACGTGTGTCCCGGACCGCTACCGGACAGCGAGGTCCGCGCCATCGCCAACAGCATTTG GCGTTGGATCACAACCAAGTCGCGCATTTGGGCGGACGGGATCGTGGTCTACGAGGCCACACT CAGTGCGCGCCATGCGGCCATCTCGCGGAAGGGCGCAGCAGCGCGCACGGCGGCGAGCACAGT TGCGCGGCGCGCAAAGTCCGCGTCAGCCATGGAGGCATTGCTATGAGCGACGGCTACAGCGAC GGCTACAGCGACGGCTACAACTGGCAGCCGACTGTCCGCAAAAAGCGGCGCGTGACCGCCGCC GAAGGCGCTCGAATCACCGGACTATCCGAACGCCACGTCGTCCGGCTCGTGGCGCAGGAACGC AGCGAGTGGTTCGCCGAGCAGGCTGCACGCCGCGAACGCATCCGCGCCTATCACGACGACGAG GGCCACTCTTGGCCGCAAACGGCCAAACATTTCGGGCTGCATCTGGACACCGTTAAGCGACTC GGCTATCGGGCGAGGAAAGAGCGTGCGGCAGAACAGGAAGCGGCTCAAAAGGCCCACAACGAA GCCGACAATCCACCGCTGTTCTAACGCAATTGGGGAGCGGGTGTCGCGGGGGTTCCGTGGGGG GTTCCGTTGCAACGGGTCGGACAGGTAAAAGTCCTGGTAGACGCTAGTTTTCTGGTTTGGGCC ATGCCTGTCTCGTTGCGTGTTTCGTTGCGTCCGTTTTGAATACCAGCCAGACGAGACGGGGTT CTACGAATCTTGGTCGATACCAAGCCATTTCCGCTGAATATCGTGGAGCTCACCGCCAGAATC GGTGGTTGTGGTGATGTACGTGGCGAACTCCGTTGTAGTGCTTGTGGTGGCATCCGTGGCGCG GCCGCGGTACCAGATCTTTAAAT Bold= hspXpromotersequence Bold&underlined= cloningsites Italic= Ag85B-CysDgene Underlined= 6histidinetag