Non-Human Animals Having Humanized FC-Gamma Receptors
20170086432 ยท 2017-03-30
Inventors
- Andrew J. Murphy (Croton-on-Hudson, NY)
- Lynn Macdonald (Harrison, NY)
- Cagan Gurer (Chappaqua, NY)
- Karolina A. Meagher (Yorktown Heights, NY, US)
- Naxin Tu (Pleasantville, NY, US)
Cpc classification
A01K2267/01
HUMAN NECESSITIES
C07K14/70535
CHEMISTRY; METALLURGY
Y02A50/30
GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
A01K2267/0387
HUMAN NECESSITIES
A01K67/0278
HUMAN NECESSITIES
International classification
Abstract
Genetically modified mice and methods and compositions for making and using the same are provided, wherein the genetic modification comprises humanization of an FcRI protein.
Claims
1. A mouse that expresses an FcRI protein comprising an extracellular portion of a human FcRI chain and an intracellular portion of a mouse FcRI chain.
2. The mouse of claim 1, wherein the extracellular portion of a human FcRI chain comprises an EC1 domain, EC2 domain, an EC3 domain, or a combination thereof.
3. The mouse of claim 2, wherein the EC1 domain is encoded by an exon at least 90% identical to exon 3 of SEQ ID NO: 3.
4. The mouse of claim 2, wherein the EC2 domain is encoded by an exon at least 90% identical to exon 4 of SEQ ID NO: 3.
5. The mouse of claim 2, wherein the EC3 domain is encoded by an exon at least 90% identical to exon 5 of SEQ ID NO: 3.
6. The mouse of claim 1, wherein the mouse does not detectably express a full-length mouse FcRI chain.
7. The mouse of claim 1, wherein the intracellular portion of an FcRI chain comprises a cytoplasmic domain of a mouse FcRI chain in whole or in part.
8. The mouse of claim 1, wherein the FcRI protein further comprises a mouse FcRI chain transmembrane domain in whole or in part.
9. The mouse of claim 1, wherein the FcRI protein is expressed on monocytes, macrophages, neutrophils or dendritic cells.
10. The mouse of claim 9, wherein the expression of the FcRI protein is increased upon administration of murine granulocyte colony stimulating factor (mG-CSF) to the mouse.
11. A mouse comprising an FcRI gene that comprises at least one exon of a human FcRI gene encoding an extracellular portion of human FcRI protein operably linked to at least one exon of a mouse FcRI gene encoding an intracellular portion of a mouse FcRI protein.
12. The mouse of claim 11, wherein the exon of the human FcRT gene is selected from the group consisting of exons 3, 4 and 5.
13. The mouse of claim 11, wherein the mouse does not express a functional mouse FcRT gene.
14. An embryonic stem cell whose genome comprises a FcRT gene that encodes an extracellular portion of a human FcRT protein and an intracellular portion of a mouse FcRT protein.
15. The cell of claim 14, wherein the FcRT gene comprises exons 3, 4, and 5 of a human FcRT gene.
16. The cell of claim 14, wherein the FcRT gene further comprises one or more human 5 untranslated regions flanking human exon 1.
17. The cell of claim 14, wherein the extracellular portion of the human FcRI protein comprises one or more of EC1, EC2, and EC3.
18. The cell of claim 14, wherein the FcRT gene comprises exon 6 of a mouse FcRT gene.
19. The cell of claim 14, wherein the intracellular portion of the mouse FcRT protein comprises the cytoplasmic domain of a mouse FcRI protein in whole or in part.
20. The cell of claim 14, wherein the FcRT gene is positioned at an endogenous FcRT locus.
21. A nucleic acid encoding an FcRT protein comprising an extracellular portion of a human FcRT chain and an intracellular portion of a mouse FcRT chain.
22. The nucleic acid of claim 21, wherein the extracellular portion of a human FcRI chain comprises an EC1 domain, EC2 domain, an EC3 domain, or a combination thereof.
23. The nucleic acid of claim 22, wherein the EC1 domain is encoded by a sequence at least 90% identical to exon 3 of SEQ ID NO: 3.
24. The nucleic acid of claim 22, wherein the EC2 domain is encoded by a sequence at least 90% identical to exon 4 of SEQ ID NO: 3.
25. The nucleic acid of claim 22, wherein the EC3 domain is encoded by a sequence at least 90% identical to exon 5 of SEQ ID NO: 3.
26. The nucleic acid of claim 21, wherein the FcRI protein comprises an FcRI chain amino acid sequence at least 90% identical to SEQ ID NO: 5.
27. The nucleic acid of claim 21, wherein the FcRI protein comprises an FcRI chain amino acid sequence of SEQ ID NO: 5.
28. The nucleic acid of claim 21, wherein the nucleic acid is a vector.
29. The nucleic acid of claim 28, wherein the vector is a targeting vector.
30. A cell comprising the nucleic acid of claim 21.
31. The cell of claim 30, wherein the cell is part of a tissue.
32. An FcRI protein comprising an extracellular portion of a human FcRI chain and an intracellular portion of a mouse FcRI chain.
33. The FcRI protein of claim 32, wherein the extracellular portion of the human FcRI chain comprises an EC1 domain, EC2 domain, an EC3 domain, or a combination thereof.
34. The FcRI protein of claim 33, wherein the EC1 domain is encoded by a sequence at least 90% identical to exon 3 of SEQ ID NO: 3.
35. The FcRI protein of claim 33, wherein the EC2 domain is encoded by a sequence at least 90% identical to exon 4 of SEQ ID NO: 3.
36. The FcRI protein of claim 33, wherein the EC3 domain is encoded by a sequence at least 90% identical to exon 5 of SEQ ID NO: 3.
37. The FcRI protein of claim 32, wherein the FcRI protein comprises an FcRI chain amino acid sequence at least 90% identical to SEQ ID NO: 5.
38. The FcRI protein of claim 32, wherein the FcRI protein comprises an FcRI chain amino acid sequence of SEQ ID NO: 5.
39. A cell comprising the FcRI protein of claim 32.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0026] The drawings included herein are for illustration purposes only not for limitation.
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
[0058]
DEFINITIONS
[0059] This invention is not limited to particular methods, and experimental conditions described, as such methods and conditions may vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting, since the scope of the present invention is defined by the claims.
[0060] Unless defined otherwise, all terms and phrases used herein include the meanings that the terms and phrases have attained in the art, unless the contrary is clearly indicated or clearly apparent from the context in which the term or phrase is used. Although any methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, particular methods and materials are now described.
[0061] The term approximately as applied herein to one or more values of interest, refers to a value that is similar to a stated reference value. In certain embodiments, the term approximately or about refers to a range of values that fall within 25%, 20%, 19%, 18%, 17%, 16%, 15%, 14%, 13%, 12%, 11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, or less in either direction (greater than or less than) of the stated reference value unless otherwise stated or otherwise evident from the context (except where such number would exceed 100% of a possible value).
[0062] The term biologically active as used herein refers to a characteristic of any agent that has activity in a biological system, in vitro or in vivo (e.g., in an organism). For instance, an agent that, when present in an organism, has a biological effect within that organism, is considered to be biologically active. In particular embodiments, where a protein or polypeptide is biologically active, a portion of that protein or polypeptide that shares at least one biological activity of the protein or polypeptide is typically referred to as a biologically active portion.
[0063] The term comparable as used herein refers to two or more agents, entities, situations, sets of conditions, etc. that may not be identical to one another but that are sufficiently similar to permit comparison there between so that conclusions may reasonably be drawn based on differences or similarities observed. Those of ordinary skill in the art will understand, in context, what degree of identity is required in any given circumstance for two or more such agents, entities, situations, sets of conditions, etc. to be considered comparable.
[0064] The term conservative is used herein to describe a conservative amino acid substitution refers to substitution of an amino acid residue by another amino acid residue having a side chain R group with similar chemical properties (e.g., charge or hydrophobicity). In general, a conservative amino acid substitution will not substantially change the functional properties of interest of a protein, for example, the ability of a receptor to bind to a ligand. Examples of groups of amino acids that have side chains with similar chemical properties include aliphatic side chains such as glycine, alanine, valine, leucine, and isoleucine; aliphatic-hydroxyl side chains such as serine and threonine; amide-containing side chains such as asparagine and glutamine; aromatic side chains such as phenylalanine, tyrosine, and tryptophan; basic side chains such as lysine, arginine, and histidine; acidic side chains such as aspartic acid and glutamic acid; and, sulfur-containing side chains such as cysteine and methionine. Conservative amino acids substitution groups include, for example, valine/leucine/isoleucine, phenylalanine/tyrosine, lysine/arginine, alanine/valine, glutamate/aspartate, and asparagine/glutamine. In some embodiments, a conservative amino acid substitution can be substitution of any native residue in a protein with alanine, as used in, for example, alanine scanning mutagenesis. In some embodiments, a conservative substitution is made that has a positive value in the PAM250 log-likelihood matrix disclosed in Gonnet et al. (1992) Exhaustive Matching of the Entire Protein Sequence Database, Science 256:1443-45, hereby incorporated by reference. In some embodiments, the substitution is a moderately conservative substitution wherein the substitution has a nonnegative value in the PAM250 log-likelihood matrix.
[0065] The term disruption as used herein refers to the result of a homologous recombination event with a DNA molecule (e.g., with an endogenous homologous sequence such as a gene or gene locus. In some embodiments, a disruption may achieve or represent an insertion, deletion, substitution, replacement, missense mutation, or a frame-shift of a DNA sequence(s), or any combination thereof. Insertions may include the insertion of entire genes or fragments of genes, e.g. exons, which may be of an origin other than the endogenous sequence. In some embodiments, a disruption may increase expression and/or activity of a gene or gene product (e.g., of a protein encoded by a gene). In some embodiments, a disruption may decrease expression and/or activity of a gene or gene product. In some embodiments, a disruption may alter sequence of a gene or an encoded gene product (e.g., an encoded protein). In some embodiments, a disruption may truncate or fragment a gene or an encoded gene product (e.g., an encoded protein). In some embodiments, a disruption may extend a gene or an encoded gene product; in some such embodiments, a disruption may achieve assembly of a fusion protein. In some embodiments, a disruption may affect level but not activity of a gene or gene product. In some embodiments, a disruption may affect activity but not level of a gene or gene product. In some embodiments, a disruption may have no significant effect on level of a gene or gene product. In some embodiments, a disruption may have no significant effect on activity of a gene or gene product. In some embodiments, a disruption may have no significant effect on either level or activity of a gene or gene product.
[0066] The phrase endogenous locus or endogenous gene as used herein refers to a genetic locus found in a parent or reference organism prior to introduction of a disruption, deletion, replacement, alteration, or modification as described herein. In some embodiments, the endogenous locus has a sequence found in nature. In some embodiments, the endogenous locus is wild type. In some embodiments, the reference organism is a wild-type organism. In some embodiments, the reference organism is an engineered organism. In some embodiments, the reference organism is a laboratory-bred organism (whether wild-type or engineered).
[0067] The phrase endogenous promoter as used herein refers to a promoter that is naturally associated, e.g., in a wild-type organism, with an endogenous gene.
[0068] The term FcRI protein as used herein refers to a high affinity immunoglobulin Fc receptor comprising an chain having three extracellular domains, a transmembrane domain, and an intracellular domain.
[0069] By way of illustration, representative nucleotide and amino acid sequences of a mouse and human FcRI genes are provided in Table 3. Persons of skill upon reading this disclosure will recognize that one or more endogenous FcRI receptor genes in a genome (or all) can be replaced by one or more heterologous FcRI genes (e.g., polymorphic variants, subtypes or mutants, genes from another species, etc.).
[0070] A FcRI-expressing cell as used herein refers to a cell that expresses FcRT. In some embodiments, an FcRI-expressing cell expresses a FcRI receptor on its surface. In some embodiments, a FcRI receptor is expressed on the surface of the cell in an amount sufficient to mediate cell-to-cell interactions via the FcRI protein expressed on the surface of the cell. Exemplary FcRI-expressing cells include, lymphocytes, myeloid cells, macrophages, neutrophils, and natural killer (NK) cells. FcRI-expressing cells regulate the interaction of immune cells to regulate the immune response to various foreign antigens or pathogens. In some embodiments, non-human animals of the present invention demonstrate immune cell regulation via humanized FcRI receptors expressed on the surface of one more cells of the non-human animal.
[0071] The term heterologous as used herein refers to an agent or entity from a different source. For example, when used in reference to a polypeptide, gene, or gene product or present in a particular cell or organism, the term clarifies that the relevant polypeptide, gene, or gene product 1) was engineered by the hand of man; 2) was introduced into the cell or organism (or a precursor thereof) through the hand of man (e.g., via genetic engineering); and/or 3) is not naturally produced by or present in the relevant cell or organism (e.g., the relevant cell type or organism type).
[0072] The term host cell as used herein refers to a cell into which a heterologous (e.g., exogenous) nucleic acid or protein has been introduced. Persons of skill upon reading this disclosure will understand that such terms refer not only to the particular subject cell, but also is used to refer to the progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term host cell as used herein. In some embodiments, a host cell is or comprises a prokaryotic or eukaryotic cell. In general, a host cell is any cell that is suitable for receiving and/or producing a heterologous nucleic acid or protein, regardless of the Kingdom of life to which the cell is designated. Exemplary cells include those of prokaryotes and eukaryotes (single-cell or multiple-cell), bacterial cells (e.g., strains ofE. coli, Bacillus spp., Streptomyces spp., etc.), mycobacteria cells, fungal cells, yeast cells (e.g., S. cerevisiae, S. pombe, P. pastoris, P. methanolica, etc.), plant cells, insect cells (e.g., SF-9, SF-21, baculovirus-infected insect cells, Trichoplusia ni, etc.), non-human animal cells, human cells, or cell fusions such as, for example, hybridomas or quadromas. In some embodiments, the cell is a human, monkey, ape, hamster, rat, or mouse cell. In some embodiments, the cell is eukaryotic and is selected from the following cells: CHO (e.g., CHO K1, DXB-11 CHO, Veggie-CHO), COS (e.g., COS-7), retinal cell, Vero, CV1, kidney (e.g., HEK293, 293 EBNA, MSR 293, MDCK, HaK, BHK), HeLa, HepG2, WI38, MRC 5, Co1o205, HB 8065, HL-60, (e.g., BHK21), Jurkat, Daudi, A431 (epidermal), CV-1, U937, 3T3, L cell, C127 cell, SP2/0, NS-0, MMT 060562, Sertoli cell, BRL 3A cell, HT1080 cell, myeloma cell, tumor cell, and a cell line derived from an aforementioned cell. In some embodiments, the cell comprises one or more viral genes, e.g., a retinal cell that expresses a viral gene (e.g., a PER.C6 cell). In some embodiments, a host cell is or comprises an isolated cell. In some embodiments, a host cell is part of a tissue. In some embodiments, a host cell is part of an organism.
[0073] The phrase human FcRI gene as used herein refers to a nucleotide sequence encoding a fully human, substantially human, or humanized portion of an FcRI protein depending on context. In some embodiments, a human FcRI gene refers to a humanized FcRI gene as contrasted with a fully mouse FcRI gene. In some embodiments, a human FcRI gene contains one or more substitutions, additions, deletions, or mutations. In some embodiments a human FcRI gene comprises FcRIA (CD64A), FcRIB (CD64B), FcRIC (CD64C), or combinations thereof
[0074] The phrase human FcRI protein refers to a protein encoded by a fully human, substantially human, or humanized FcRI gene depending on context. In some embodiments, a human FcRI protein refers to a humanized FcRI protein as contrasted with a fully mouse FcRI protein. In some embodiments, a human FcRI protein comprises one or more amino acid substitutions, additions, deletions, or mutations. In some embodiments, a FcRI protein comprises FcRIA (CD64A), FcRIB (CD64B), FcRIC (CD64C), or combinations thereof
[0075] The phrase hybrid FcRI gene or hybrid FcRI protein refers to a FcRI gene or protein that includes an FcRI sequence of at least two different species of animals. In some embodiments, a hybrid FcRI gene includes a portion of a human nucleic acid sequence and a portion of a mouse nucleic acid sequence. In some embodiments, a hybrid FcRI protein includes a portion of human amino acid sequence and a portion of a mouse amino acid sequence.
[0076] The term humanized, is used herein in accordance with its art-understood meaning to refer to nucleic acids or proteins whose structures (i.e., nucleotide or amino acid sequences) include portions that correspond substantially or identically with structures of a particular gene or protein found in nature in a non-human animal, and also include portions that differ from that found in the relevant particular non-human gene or protein and instead correspond more closely with comparable structures found in a corresponding human gene or protein. In some embodiments, a humanized gene is one that encodes a polypeptide having substantially the amino acid sequence as that of a human polypeptide (e.g., a human protein or portion thereofe.g., characteristic portion thereof). To give but one example, in the case of a membrane receptor, a humanized gene may encode a polypeptide having an extracellular portion having an amino acid sequence as that of a human extracellular portion and the remaining sequence as that of a non-human (e.g., mouse) polypeptide. In some embodiments, a humanized gene comprises at least a portion of an DNA sequence of a human gene. In some embodiment, a humanized gene comprises an entire DNA sequence of a human gene. In some embodiments, a humanized protein comprises a sequence having a portion that appears in a human protein. In some embodiments, a humanized protein comprises an entire sequence of a human protein and is expressed from an endogenous locus of a non-human animal that corresponds to the homolog or ortholog of the human gene.
[0077] The term identity as used herein in connection with a comparison of sequences, refers to identity as determined by a number of different algorithms known in the art that can be used to measure nucleotide and/or amino acid sequence identity. In some embodiments, identities as described herein are determined using a ClustalW v. 1.83 (slow) alignment employing an open gap penalty of 10.0, an extend gap penalty of 0.1, and using a Gonnet similarity matrix (MACVECTOR 10.0.2, MacVector Inc., 2008).
[0078] The terms intracellular signal cascade or intracellular signal transduction as used herein refers to a transmission of signal from a cell surface to one or more intracellular targets. In some embodiments, intracellular signal transduction comprises a physiological response in a cell that is elicited by the binding of a target molecule (e.g., an immunoglobulin Fc region) to an extracellular component of a FcR1 receptor.
[0079] The term isolated as used herein refers to a substance and/or entity that has been (1) separated from at least some of the components with which it was associated when initially produced (whether in nature and/or in an experimental setting), and/or (2) designed, produced, prepared, and/or manufactured by the hand of man. Isolated substances and/or entities may be separated from about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or more than about 99% of the other components with which they were initially associated. In some embodiments, isolated agents are about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or more than about 99% pure. As used herein, a substance is pure if it is substantially free of other components. In some embodiments, as will be understood by those skilled in the art, a substance may still be considered isolated or even pure, after having been combined with certain other components such as, for example, one or more carriers or excipients (e.g., buffer, solvent, water, etc.); in such embodiments, percent isolation or purity of the substance is calculated without including such carriers or excipients. To give but one example, in some embodiments, a biological polymer such as a polypeptide or polynucleotide that occurs in nature is considered to be isolated when, a) by virtue of its origin or source of derivation is not associated with some or all of the components that accompany it in its native state in nature; b) it is substantially free of other polypeptides or nucleic acids of the same species from the species that produces it in nature; c) is expressed by or is otherwise in association with components from a cell or other expression system that is not of the species that produces it in nature. Thus, for instance, in some embodiments, a polypeptide that is chemically synthesized or is synthesized in a cellular system different from that which produces it in nature is considered to be an isolated polypeptide. Alternatively or additionally, in some embodiments, a polypeptide that has been subjected to one or more purification techniques may be considered to be an isolated polypeptide to the extent that it has been separated from other components a) with which it is associated in nature; and/or b) with which it was associated when initially produced.
[0080] The phrase mouse FcRI gene as used herein refers to a gene comprising a nucleic molecule as shown in SEQ ID NO: 1, or a nucleic acid molecule having substantial identity to a molecule as shown in SEQ ID NO: 1.
[0081] The phrase mouse FcRI protein as used herein refers to a protein comprising an amino acid sequence as shown in SEQ ID NO: 2, including a protein having substantial identity to a protein as shown in SEQ ID NO: 2.
[0082] The phrase non-human animal as used herein refers to any vertebrate organism that is not a human. In some embodiments, a non-human animal is a cyclostome, a bony fish, a cartilaginous fish (e.g., a shark or a ray), an amphibian, a reptile, a mammal, and a bird. In some embodiments, a non-human mammal is a primate, a goat, a sheep, a pig, a dog, a cow, or a rodent. In some embodiments, a non-human animal is a rodent such as a rat or a mouse.
[0083] The phrase nucleic acid as used herein in its broadest sense, refers to any compound and/or substance that is or can be incorporated into an oligonucleotide chain. In some embodiments, a nucleic acid is a compound and/or substance that is or can be incorporated into an oligonucleotide chain via a phosphodiester linkage. As will be clear from context, in some embodiments, nucleic acid refers to individual nucleic acid residues (e.g., nucleotides and/or nucleosides); in some embodiments, nucleic acid refers to an oligonucleotide chain comprising individual nucleic acid residues. In some embodiments, a nucleic acid is or comprises RNA; in some embodiments, a nucleic acid is or comprises DNA. In some embodiments, a nucleic acid is, comprises, or consists of one or more natural nucleic acid residues. In some embodiments, a nucleic acid is, comprises, or consists of one or more nucleic acid analogs. In some embodiments, a nucleic acid analog differs from a nucleic acid in that it does not utilize a phosphodiester backbone. For example, in some embodiments, a nucleic acid is, comprises, or consists of one or more peptide nucleic acids, which are known in the art and have peptide bonds instead of phosphodiester bonds in the backbone, are considered within the scope of the present invention. Alternatively or additionally, in some embodiments, a nucleic acid has one or more phosphorothioate and/or 5-N-phosphoramidite linkages rather than phosphodiester bonds. In some embodiments, a nucleic acid is, comprises, or consists of one or more natural nucleosides (e.g., adenosine, thymidine, guanosine, cytidine, uridine, deoxyadenosine, deoxythymidine, deoxyguanosine, and deoxycytidine). In some embodiments, a nucleic acid is, comprises, or consists of one or more nucleoside analogs (e.g., 2-aminoadenosine, 2-thiothymidine, inosine, pyrrolo-pyrimidine, 3-methyl adenosine, 5-methylcytidine, C-5 propynyl-cytidine, C-5 propynyl-uridine, 2-aminoadenosine, C5-bromouridine, C5-fluorouridine, C5-iodouridine, C5-propynyl-uridine, C5-propynyl-cytidine, C5-methylcytidine, 2-aminoadenosine, 7-deazaadenosine, 7-deazaguanosine, 8-oxoadenosine, 8-oxoguanosine,O(6)-methylguanine, 2-thiocytidine, methylated bases, intercalated bases, and combinations thereof). In some embodiments, a nucleic acid comprises one or more modified sugars (e.g., 2-fluororibose, ribose, 2-deoxyribose, arabinose, and hexose) as compared with those in natural nucleic acids. In some embodiments, a nucleic acid has a nucleotide sequence that encodes a functional gene product such as an RNA or protein. In some embodiments, a nucleic acid includes one or more introns. In some embodiments, nucleic acids are prepared by one or more of isolation from a natural source, enzymatic synthesis by polymerization based on a complementary template (in vivo or in vitro), reproduction in a recombinant cell or system, and chemical synthesis. In some embodiments, a nucleic acid is at least 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 20, 225, 250, 275, 300, 325, 350, 375, 400, 425, 450, 475, 500, 600, 700, 800, 900, 1000, 1500, 2000, 2500, 3000, 3500, 4000, 4500, 5000 or more residues long. In some embodiments, a nucleic acid is single stranded; in some embodiments, a nucleic acid is double stranded. In some embodiments a nucleic acid has a nucleotide sequence comprising at least one element that encodes, or is the complement of a sequence that encodes, a polypeptide. In some embodiments, a nucleic acid has enzymatic activity.
[0084] The phrase operably linked as used herein refers to a juxtaposition wherein the components described are in a relationship permitting them to function in their intended manner. A control sequence operably linked to a coding sequence is ligated in such a way that expression of the coding sequence is achieved under conditions compatible with the control sequences. Operably linked sequences include both expression control sequences that are contiguous with the gene of interest and expression control sequences that act in trans or at a distance to control the gene of interest. The term expression control sequence as used herein refers to polynucleotide sequences which are necessary to effect the expression and processing of coding sequences to which they are ligated. Expression control sequences include appropriate transcription initiation, termination, promoter and enhancer sequences; efficient RNA processing signals such as splicing and polyadenylation signals; sequences that stabilize cytoplasmic mRNA; sequences that enhance translation efficiency (i.e., Kozak consensus sequence); sequences that enhance protein stability; and when desired, sequences that enhance protein secretion. The nature of such control sequences differs depending upon the host organism. For example, in prokaryotes, such control sequences generally include promoter, ribosomal binding site, and transcription termination sequence, while in eukaryotes, typically, such control sequences include promoters and transcription termination sequence. The term control sequences is intended to include components whose presence is essential for expression and processing, and can also include additional components whose presence is advantageous, for example, leader sequences and fusion partner sequences.
[0085] The term polypeptide as used herein refers to any polymeric chain of amino acids. In some embodiments, a polypeptide has an amino acid sequence that occurs in nature. In some embodiments, a polypeptide has an amino acid sequence that does not occur in nature. In some embodiments, a polypeptide has an amino acid sequence that is engineered in that it is designed and/or produced through action of the hand of man.
[0086] The term recombinant as used herein is intended to refer to polypeptides (e.g., signal-regulatory proteins as described herein) that are designed, engineered, prepared, expressed, created or isolated by recombinant means, such as polypeptides expressed using a recombinant expression vector transfected into a host cell, polypeptides isolated from a recombinant, combinatorial human polypeptide library (Hoogenboom H. R., (1997) TIB Tech. 15:62-70; Azzazy H., and Highsmith W. E., (2002) Clin. Biochem. 35:425-445; Gavilondo J. V., and Larrick J. W. (2002) BioTechniques 29:128-145; Hoogenboom H., and Chames P. (2000) Immunology Today 21:371-378), antibodies isolated from an animal (e.g., a mouse) that is transgenic for human immunoglobulin genes (see e.g., Taylor, L. D., et al. (1992) Nucl. Acids Res. 20:6287-6295; Kellermann S-A., and Green L. L. (2002) Current Opinion in Biotechnology 13:593-597; Little M. et al (2000) Immunology Today 21:364-370) or polypeptides prepared, expressed, created or isolated by any other means that involves splicing selected sequence elements to one another. In some embodiments, one or more of such selected sequence elements is found in nature. In some embodiments, one or more of such selected sequence elements is designed in silico. In some embodiments, one or more such selected sequence elements results from mutagenesis (e.g., in vivo or in vitro) of a known sequence element, e.g., from a natural or synthetic source. For example, in some embodiments, a recombinant polypeptide is comprised of sequences found in the genome of a source organism of interest (e.g., human, mouse, etc.). In some embodiments, a recombinant polypeptide has an amino acid sequence that resulted from mutagenesis (e.g., in vitro or in vivo, for example in a non-human animal), so that the amino acid sequences of the recombinant polypeptides are sequences that, while originating from and related to polypeptides sequences, may not naturally exist within the genome of a non-human animal in vivo.
[0087] The term replacement is used herein to refer to a process through which a replaced nucleic acid sequence (e.g., a gene) found in a host locus (e.g., in a genome) is removed from that locus and a different, replacement nucleic acid is located in its place. In some embodiments, the replaced nucleic acid sequence and the replacement nucleic acid sequences are comparable to one another in that, for example, they are homologous to one another and/or contain corresponding elements (e.g., protein-coding elements, regulatory elements, etc.). In some embodiments, a replaced nucleic acid sequence includes one or more of a promoter, an enhancer, a splice donor site, a splice receiver site, an intron, an exon, an untranslated region (UTR); in some embodiments, a replacement nucleic acid sequence includes one or more coding sequences. In some embodiments, a replacement nucleic acid sequence is a homolog of the replaced nucleic acid sequence. In some embodiments, a replacement nucleic acid sequence is an ortholog of the replaced sequence. In some embodiments, a replacement nucleic acid sequence is or comprises a human nucleic acid sequence. In some embodiments, including where the replacement nucleic acid sequence is or comprises a human nucleic acid sequence, the replaced nucleic acid sequence is or comprises a rodent sequence (e.g., a mouse sequence). The nucleic acid sequence so placed may include one or more regulatory sequences that are part of source nucleic acid sequence used to obtain the sequence so placed (e.g., promoters, enhancers, 5- or 3-untranslated regions, etc.). For example, in various embodiments, the replacement is a substitution of an endogenous sequence with a heterologous sequence that results in the production of a gene product from the nucleic acid sequence so placed (comprising the heterologous sequence), but not expression of the endogenous sequence; the replacement is of an endogenous genomic sequence with a nucleic acid sequence that encodes a protein that has a similar function as a protein encoded by the endogenous sequence (e.g., the endogenous genomic sequence encodes a FcRI protein, and the DNA fragment encodes one or more human FcRI proteins). In various embodiments, an endogenous gene or fragment thereof is replaced with a corresponding human gene or fragment thereof. A corresponding human gene or fragment thereof is a human gene or fragment that is an ortholog of, or is substantially similar or the same in structure and/or function, as the endogenous gene or fragment thereof that is replaced.
[0088] The term substantially as used herein refers to the qualitative condition of exhibiting total or near-total extent or degree of a characteristic or property of interest. One of ordinary skill in the biological arts will understand that biological and chemical phenomena rarely, if ever, go to completion and/or proceed to completeness or achieve or avoid an absolute result. The term substantially is therefore used herein to capture the potential lack of completeness inherent in many biological and chemical phenomena.
[0089] The phrase substantial homology as used herein refers to a comparison between amino acid or nucleic acid sequences. As will be appreciated by those of ordinary skill in the art, two sequences are generally considered to be substantially homologous if they contain homologous residues in corresponding positions. Homologous residues may be identical residues. Alternatively, homologous residues may be non-identical residues will appropriately similar structural and/or functional characteristics. For example, as is well known by those of ordinary skill in the art, certain amino acids are typically classified as hydrophobic or hydrophilic amino acids, and/or as having polar or non-polar side chains. Substitution of one amino acid for another of the same type may often be considered a homologous substitution. Typical amino acid categorizations are summarized in Table 1 and 2.
TABLE-US-00001 TABLE 1 Alanine Ala A nonpolar neutral 1.8 Arginine Arg R polar positive 4.5 Asparagine Asn N polar neutral 3.5 Aspartic acid Asp D polar negative 3.5 Cysteine Cys C nonpolar neutral 2.5 Glutamic acid Glu E polar negative 3.5 Glutamine Gln Q polar neutral 3.5 Glycine Gly G nonpolar neutral 0.4 Histidine His H polar positive 3.2 Isoleucine Ile I nonpolar neutral 4.5 Leucine Leu L nonpolar neutral 3.8 Lysine Lys K polar positive 3.9 Methionine Met M nonpolar neutral 1.9 Phenylalanine Phe F nonpolar neutral 2.8 Proline Pro P nonpolar neutral 1.6 Serine Ser S polar neutral 0.8 Threonine Thr T polar neutral 0.7 Tryptophan Trp W nonpolar neutral 0.9 Tyrosine Tyr Y polar neutral 1.3 Valine Val V nonpolar neutral 4.2
TABLE-US-00002 TABLE 2 Ambiguous Amino Acids 3-Letter 1-Letter Asparagine or aspartic acid Asx B Glutamine or glutamic acid Glx Z Leucine or Isoleucine Xle J Unspecified or unknown amino acid Xaa X
[0090] As is well known in this art, amino acid or nucleic acid sequences may be compared using any of a variety of algorithms, including those available in commercial computer programs such as BLASTN for nucleotide sequences and BLASTP, gapped BLAST, and PSI-BLAST for amino acid sequences. Exemplary such programs are described in Altschul, et al., Basic local alignment search tool, J. Mol. Biol., 215(3): 403-410, 1990; Altschul, et al., Methods in Enzymology; Altschul, et al., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402, 1997; Baxevanis, et al., Bioinformatics: A Practical Guide to the Analysis of Genes and Proteins, Wiley, 1998; and Misener, et al., (eds.), Bioinformatics Methods and Protocols (Methods in Molecular Biology, Vol. 132), Humana Press, 1999. In addition to identifying homologous sequences, the programs mentioned above typically provide an indication of the degree of homology. In some embodiments, two sequences are considered to be substantially homologous if at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more of their corresponding residues are homologous over a relevant stretch of residues. In some embodiments, the relevant stretch is a complete sequence. In some embodiments, the relevant stretch is at least 9, 10, 11, 12, 13, 14, 15, 16, 17 or more residues. In some embodiments, the relevant stretch includes contiguous residues along a complete sequence. In some embodiments, the relevant stretch includes discontinuous residues along a complete sequence. In some embodiments, the relevant stretch is at least 10, 15, 20, 25, 30, 35, 40, 45, 50, or more residues.
[0091] The phrase substantial identity as used herein refers to a comparison between amino acid or nucleic acid sequences. As will be appreciated by those of ordinary skill in the art, two sequences are generally considered to be substantially identical if they contain identical residues in corresponding positions. As is well known in this art, amino acid or nucleic acid sequences may be compared using any of a variety of algorithms, including those available in commercial computer programs such as BLASTN for nucleotide sequences and BLASTP, gapped BLAST, and PSI-BLAST for amino acid sequences. Exemplary such programs are described in Altschul, et al., Basic local alignment search tool, J. Mol. Biol., 215(3): 403-410, 1990; Altschul, et al., Methods in Enzymology; Altschul et al., Nucleic Acids Res. 25:3389-3402, 1997; Baxevanis et al., Bioinformatics: A Practical Guide to the Analysis of Genes and Proteins, Wiley, 1998; and Misener, et al., (eds.), Bioinformatics Methods and Protocols (Methods in Molecular Biology, Vol. 132), Humana Press, 1999. In addition to identifying identical sequences, the programs mentioned above typically provide an indication of the degree of identity. In some embodiments, two sequences are considered to be substantially identical if at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more of their corresponding residues are identical over a relevant stretch of residues. In some embodiments, the relevant stretch is a complete sequence. In some embodiments, the relevant stretch is at least 10, 15, 20, 25, 30, 35, 40, 45, 50, or more residues.
[0092] The phrase targeting vector or targeting construct as used herein refers to a polynucleotide molecule that comprises a targeting region. A targeting region comprises a sequence that is identical or substantially identical to a sequence in a target cell, tissue or animal and provides for integration of the targeting construct into a position within the genome of the cell, tissue or animal via homologous recombination. Targeting regions that target using site-specific recombinase recognition sites (e.g., loxP or Frt sites) are also included. In some embodiments, a targeting construct of the present invention further comprises a nucleic acid sequence or gene of particular interest, a selectable marker, control and or regulatory sequences, and other nucleic acid sequences that allow for recombination mediated through exogenous addition of proteins that aid in or facilitate recombination involving such sequences. In some embodiments, a targeting construct of the present invention further comprises a gene of interest in whole or in part, wherein the gene of interest is a heterologous gene that encodes a protein in whole or in part that has a similar function as a protein encoded by an endogenous sequence.
[0093] The term variant as used herein refers to an entity that shows significant structural identity with a reference entity but differs structurally from the reference entity in the presence or level of one or more chemical moieties as compared with the reference entity. In many embodiments, a variant also differs functionally from its reference entity. In general, whether a particular entity is properly considered to be a variant of a reference entity is based on its degree of structural identity with the reference entity. As will be appreciated by those skilled in the art, any biological or chemical reference entity has certain characteristic structural elements. A variant, by definition, is a distinct chemical entity that shares one or more such characteristic structural elements. To give but a few examples, a small molecule may have a characteristic core structural element (e.g., a macrocycle core) and/or one or more characteristic pendent moieties so that a variant of the small molecule is one that shares the core structural element and the characteristic pendent moieties but differs in other pendent moieties and/or in types of bonds present (single vs double, E vs Z, etc.) within the core, a polypeptide may have a characteristic sequence element comprised of a plurality of amino acids having designated positions relative to one another in linear or three-dimensional space and/or contributing to a particular biological function, a nucleic acid may have a characteristic sequence element comprised of a plurality of nucleotide residues having designated positions relative to on another in linear or three-dimensional space. For example, a variant polypeptide may differ from a reference polypeptide as a result of one or more differences in amino acid sequence and/or one or more differences in chemical moieties (e.g., carbohydrates, lipids, etc.) covalently attached to the polypeptide backbone. In some embodiments, a variant polypeptide shows an overall sequence identity with a reference polypeptide that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%. Alternatively or additionally, in some embodiments, a variant polypeptide does not share at least one characteristic sequence element with a reference polypeptide. In some embodiments, the reference polypeptide has one or more biological activities. In some embodiments, a variant polypeptide shares one or more of the biological activities of the reference polypeptide. In some embodiments, a variant polypeptide lacks one or more of the biological activities of the reference polypeptide. In some embodiments, a variant polypeptide shows a reduced level of one or more biological activities as compared with the reference polypeptide. In many embodiments, a polypeptide of interest is considered to be a variant of a parent or reference polypeptide if the polypeptide of interest has an amino acid sequence that is identical to that of the parent but for a small number of sequence alterations at particular positions. Typically, fewer than 20%, 15%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2% of the residues in the variant are substituted as compared with the parent. In some embodiments, a variant has 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 substituted residue as compared with a parent. Often, a variant has a very small number (e.g., fewer than 5, 4, 3, 2, or 1) number of substituted functional residues (i.e., residues that participate in a particular biological activity). Furthermore, a variant typically has not more than 5, 4, 3, 2, or 1 additions or deletions, and often has no additions or deletions, as compared with the parent. Moreover, any additions or deletions are typically fewer than about 25, about 20, about 19, about 18, about 17, about 16, about 15, about 14, about 13, about 10, about 9, about 8, about 7, about 6, and commonly are fewer than about 5, about 4, about 3, or about 2 residues. In some embodiments, the parent or reference polypeptide is one found in nature. As will be understood by those of ordinary skill in the art, a plurality of variants of a particular polypeptide of interest may commonly be found in nature, particularly when the polypeptide of interest is an infectious agent polypeptide.
[0094] The term vector as used herein refers to a nucleic acid molecule capable of transporting another nucleic acid to which it is associated. In some embodiment, vectors are capable of extra-chromosomal replication and/or expression of nucleic acids to which they are linked in a host cell such as a eukaryotic and/or prokaryotic cell. Vectors capable of directing the expression of operatively linked genes are referred to herein as expression vectors.
[0095] The term wild-type as used herein has its art-understood meaning that refers to an entity having a structure and/or activity as found in nature in a normal (as contrasted with mutant, diseased, altered, etc.) state or context. Those of ordinary skill in the art will appreciate that wild type genes and polypeptides often exist in multiple different forms (e.g., alleles).
[0096] Various aspects of the invention are described in detail in the following sections. The use of sections is not meant to limit the invention. Each section can apply to any aspect of the invention. In this application, the use of or means and/or unless stated otherwise.
DETAILED DESCRIPTION
[0097] The present invention provides, among other things, improved and/or engineered non-human animals having humanized genetic material encoding an FcRT receptor for experimentation on human or human-like immune effector responses.
Fc receptors
[0098] The receptors for the Fc (i.e., constant) regions of immunoglobulins (FcRs) play an important role in the regulation of the immune response. FcRs are present on accessory cells of a host immune system to facilitate disposal of foreign antigens bound by an antibody. FcRs also play important roles in balancing both activating and inhibitory responses of the accessory cells of the immune system. FcRs are involved in phagocytosis by macrophages, degranulation of mast cells, uptake of antibody-antigen complexes and modulation of the immune response, as well as other immune system processes.
[0099] In mice and humans, distinct FcRs are differentially expressed on the surface of different accessory cells that are each specific for the immunoglobulin isotypes present in the expressed antibody repertoire. For example, immunoglobulin G (IgG) antibodies mediate effector functions through IgG receptors (FcRs). FcRs have been classified into four groups: high affinity activating FcRT (CD64), low affinity inhibitory FcRIIb (CD32b), low affinity activating FcgRIIa/c (CD32a/c) and low affinity activating FcRIII (CD 16). Although each group is present in both mice and humans, the number of isoforms and subsets of immune cells on which they are present are different. For example, FcRIIA and FcRIIIB are expressed on accessory cells in humans but are reportedly absent from mice. Further, affinities of the different IgG isotypes (e.g., IgG 1) for each FcR is different between mice and humans.
High Affinity Human FcRI
[0100] The human high affinity FcRT (CD64) is an integral membrane glycoprotein that binds monomeric IgG-type antibodies with high affinity (typically with Ka approximately 10.sup.8 to 10.sup.9M). After binding IgG, CD64 interacts with an accessory chain known as the common y chain ( chain), which possesses an immunoreceptor tyrosine-based activation motif (ITAM) that triggers cellular activation. In humans, CD64 has been reported to be constitutively expressed on macrophages and monocytes, with inducible expression on polymorphonuclear leukocytes by cytokines such as IFN and G-CSF.
FcRI Sequences
[0101] Exemplary sequences for human, mouse, and hybridized FcRI are set forth in Table 3. For cDNA sequences, consecutive exons are separated by alternating underlined text. For protein sequences, extracellular sequences are underlined. The referenced sequences are exemplary; those skilled in the art are able to determine and compare sequence elements or degrees of identity in order to discriminate additional mouse and human sequences.
TABLE-US-00003 TABLE3 Mouse ACATTACATGATTCTTACCAGCTTTGGAGATGACATGTGGCTTCTAACAA FcRI CTCTGCTACTTTGGGTTCCAGTCGGTGGGGAAGTGGTTAATGCCACCAAG cDNA GCTGTGATCACCTTGCAGCCTCCATGGGTCAGTATTTTCCAGAAGGAAAA NM_010186 TGTCACTTTATGGTGTGAGGGGCCTCACCTGCCTGGAGACAGTTCCACAC AATGGTTTATCAACGGAACAGCCGTTCAGATCTCCACGCCTAGTTATAGC ATCCCAGAGGCCAGTTTTCAGGACAGTGGCGAATACAGGTGTCAGATAGG TTCCTCAATGCCAAGTGACCCTGTGCAGTTGCAAATCCACAATGATTGGC TGCTACTCCAGGCCTCCCGCAGAGTCCTCACAGAAGGAGAACCCCTGGCC TTGAGGTGTCACGGATGGAAGAATAAACTGGTGTACAATGTGGTTTTCTA TAGAAATGGAAAATCCTTTCAGTTTTCTTCAGATTCGGAGGTCGCCATTC TGAAAACCAACCTGAGTCACAGCGGCATCTACCACTGCTCAGGCACGGGA AGACACCGCTACACATCTGCAGGAGTGTCCATCACGGTGAAAGAGCTGTT TACCACGCCAGTGCTGAGAGCATCCGTGTCATCTCCCTTCCCGGAGGGGA GTCTGGTCACCCTGAACTGTGAGACGAATTTGCTCCTGCAGAGACCCGGC TTACAGCTTCACTTCTCCTTCTACGTGGGCAGCAAGATCCTGGAGTACAG GAACACATCCTCAGAGTACCATATAGCAAGGGCGGAAAGAGAAGATGCTG GATTCTACTGGTGTGAGGTAGCCACGGAGGACAGCAGTGTCCTTAAGCGC AGCCCTGAGTTGGAGCTCCAAGTGCTTGGTCCCCAGTCATCAGCTCCTGT CTGGTTTCACATCCTGTTTTATCTGTCAGTGGGAATAATGTTTTCGTTGA ACACGGTTCTCTATGTGAAAATACACAGGCTGCAGAGAGAGAAGAAATAC AACTTAGAAGTCCCTTTGGTTTCTGAGCAGGGAAAGAAAGCAAATTCCTT TCAGCAAGTTAGAAGCGATGGCGTGTATGAAGAAGTAACAGCCACTGCGA GCCAGACCACACCAAAAGAAGCGCCCGATGGACCTCGAAGCTCAGTGGGT GACTGTGGACCCGAGCAGCCTGAACCCCTTCCTCCCAGTGACAGTACTGG GGCACAAACTTCCCAAAGTTGACCCTGAAACTGTGGGACCATGGCATGCA ACTCTTAAATAAAGCAAATATACAGACTGGATCCGGCTGAGACAAGCTGG GTAATCAGACATTTGAAAGGAGACCTATACCAAAGGGATCTTGCAACACA TGGAGTCAGGTCACAGCGGGGGTTGTCGAATGTTTGACCTTATGGAGCAG GGAAACAGGAAGTGAATCCCACAGGACTCCCCCCCCCCGCCCATCCCCCT CCAGGCCGCCCCGGACAGGACCCAGCTCTGGAAGACTCCAGTCTGAGACT TGCGGAACCAGAGCAGGGGTGAGATTCCTGCCCAGAAGGGACAGCTGTGC CATCCCCTCACAGGGTGGATGGGTTCAGGGAAAGGCCTCCCCAGGGACGG CCTGCGTGTCAGGGGAGCAGACGCTGATACAGACAGCTCCATAGCCTGGG CTAAAGCTGGCTAAGACCCGGTGGTCATCCTGAGAGCATCGGAATTTGTG CTCTCCTTCCTACCGTCTCTCTTCATGCACCCTCCCCAGATTTGCTGCCC ACGACCCTCAAAGGACATAGTGGCGGCAGCTAAAGAGTGAAGTGTCAGCA GTAATCCATCCATCTAACCTCCCTCAGGTCCAGATACCCCCACCCCCAAA CTCCCACACTCTAGGGGCCTTTTCAGGCAGCCTGCATGTGGTGTCTTAGC AGAGCTATGGTACAAAGGCTTTTAGCTCTATCATTATCTGACAAGCAGAC AGCACCCTCAGGTGCTCTCATTGGGTGGTGAGAGCTTTCTCCAGCCTGTA CCACCTGTAAGCTGGAGTGTGGGGCGGGAACACTGGCCCAAAGCGTCCCT ATTGGAAGGCACGGCTTACATGGGTGTCACAAATGCCCTTAGACCACGCA GGAAGACCGAATTCTAGAAACAAGGAGTAGATCATGTCTCCACTTACTGT CACTCCTAAGGATCCCCTGAAGGTCTTGGAGCTTCACATCCCTGGAACTC TAGGGTCTGCCGTGCTAGAGGTCCCAGTCTGCAGAGTGGGTGTGGCATAG CCTGAGCCTCCCTGGATGTGAACATTAGCAAGGTATATTGGGACCTTTAT AACCAGGGACCAATAGGCATGAGAGGGACCGGGATAATGGACCACAGTCA CAGGAGGAGATACACTCTGTTGTACAATGCATGCAGAAACTGTCAAAAAC AGTGTGGGAGCTGGAGAGATGATCAGGGGTTAAGAACACTTCCTGCTCTT CCAGAGGACCTGAGTTCACTTTTTGTAACTGCTTGTAAGTCCAGATGTCG TCTTCTGATCTCTTTCAAGCACCCACATGTGCAGGGCATGCAGACACAGA CATATGAACAAGAACAATTAAAAAATAAATTATAACTGC (SEQIDNO:1) Mouse MILTSFGDDMWLLTTLLLWVPVGGEVVNATKAVITLQPPWVSIFQKENVTLWCE FcRI GPHLPGDSSTQWFINGTAVQISTPSYSIPEASFQDSGEYRCQIGSSMPSDPVQL Protein QIHNDWLLLQASRRVLTEGEPLALRCHGWKNKLVYNVVFYRNGKSFQFSSDSEV NP_034316. AILKTNLSHSGIYHCSGTGRHRYTSAGVSITVKELFTTPVLRASVSSPFPEGSL 1 VTLNCETNLLLQRPGLQLHFSFYVGSKILEYRNTSSEYHIARAEREDAGFYWCE VATEDSSVLKRSPELELQVLGPQSSAPVWFHILFYLSVGIMFSLNTVLYVKIHR LQREKKYNLEVPLVSEQGKKANSFQQVRSDGVYEEVTATASQTTPKEAPDGPRS SVGDCGPEQPEPLPPSDSTGAQTSQS(SEQIDNO:2) Human AATATCTTGCATGTTACAGATTTCACTGCTCCCACCAGCTTGGAGACAAC FcRI ATGTGGTTCTTGACAACTCTGCTCCTTTGGGTTCCAGTTGATGGGCAAGT cDNA GGACACCACAAAGGCAGTGATCACTTTGCAGCCTCCATGGGTCAGCGTGT NC_000001. TCCAAGAGGAAACCGTAACCTTGCACTGTGAGGTGCTCCATCTGCCTGGG 11 AGCAGCTCTACACAGTGGTTTCTCAATGGCACAGCCACTCAGACCTCGAC CCCCAGCTACAGAATCACCTCTGCCAGTGTCAATGACAGTGGTGAATACA GGTGCCAGAGAGGTCTCTCAGGGCGAAGTGACCCCATACAGCTGGAAATC CACAGAGGCTGGCTACTACTGCAGGTCTCCAGCAGAGTCTTCACGGAAGG AGAACCTCTGGCCTTGAGGTGTCATGCGTGGAAGGATAAGCTGGTGTACA ATGTGCTTTACTATCGAAATGGCAAAGCCTTTAAGTTTTTCCACTGGAAT TCTAACCTCACCATTCTGAAAACCAACATAAGTCACAATGGCACCTACCA TTGCTCAGGCATGGGAAAGCATCGCTACACATCAGCAGGAATATCTGTCA CTGTGAAAGAGCTATTTCCAGCTCCAGTGCTGAATGCATCTGTGACATCC CCACTCCTGGAGGGGAATCTGGTCACCCTGAGCTGTGAAACAAAGTTGCT CTTGCAGAGGCCTGGTTTGCAGCTTTACTTCTCCTTCTACATGGGCAGCA AGACCCTGCGAGGCAGGAACACATCCTCTGAATACCAAATACTAACTGCT AGAAGAGAAGACTCTGGGTTATACTGGTGCGAGGCTGCCACAGAGGATGG AAATGTCCTTAAGCGCAGCCCTGAGTTGGAGCTTCAAGTGCTTGGCCTCC AGTTACCAACTCCTGTCTGGTTTCATGTCCTTTTCTATCTGGCAGTGGGA ATAATGTTTTTAGTGAACACTGTTCTCTGGGTGACAATACGTAAAGAACT GAAAAGAAAGAAAAAGTGGGATTTAGAAATCTCTTTGGATTCTGGTCATG AGAAGAAGGTAATTTCCAGCCTTCAAGAAGACAGACATTTAGAAGAAGAG CTGAAATGTCAGGAACAAAAAGAAGAACAGCTGCAGGAAGGGGTGCACCG GAAGGAGCCCCAGGGGGCCACGTAGCAGCGGCTCAGTGGGTGGCCATCGA TCTGGACCGTCCCCTGCCCACTTGCTCCCCGTGAGCACTGCGTACAAACA TCCAAAAGTTCAACAACACCAGAACTGTGTGTCTCATGGTATGTAACTCT TAAAGCAAATAAATGAACTGACTTCAACTGGGATACATTTGGAAATGTGG TCATCAAAGATGACTTGAAATGAGGCCTACTCTAAAGAATTCTTGAAAAA CTTACAAGTCAAGCCTAGCCTGATAATCCTATTACATAGTTTGAAAAATA GTATTTTATTTCTCAGAACAAGGTAAAAAGGTGAGTGGGTGCATATGTAC AGAAGATTAAGACAGAGAAACAGACAGAAAGAGACACACACACAGCCAGG AGTGGGTAGATTTCAGGGAGACAAGAGGGAATAGTATAGACAATAAGGAA GGAAATAGTACTTACAAATGACTCCTAAGGGACTGTGAGACTGAGAGGGC TCACGCCTCTGTGTTCAGGATACTTAGTTCATGGCTTTTCTCTTTGACTT TACTAAAAGAGAATGTCTCCATACGCGTTCTAGGCATACAAGGGGGTAAC TCATGATGAGAAATGGATGTGTTATTCTTGCCCTCTCTTTTGAGGCTCTC TCATAACCCCTCTATTTCTAGAGACAACAAAAATGCTGCCAGTCCTAGGC CCCTGCCCTGTAGGAAGGCAGAATGTAACTGTTCTGTTTGTTTAACGATT AAGTCCAAATCTCCAAGTGCGGCACTGCAAAGAGACGCTTCAAGTGGGGA GAAGCGGCGATACCATAGAGTCCAGATCTTGCCTCCAGAGATTTGCTTTA CCTTCCTGATTTTCTGGTTACTAATTAGCTTCAGGATACGCTGCTCTCAT ACTTGGGCTGTAGTTTGGAGACAAAATATTTTCCTGCCACTGTGTAACAT AGCTGAGGTAAAAACTGAACTATGTAAATGACTCTACTAAAAGTTTAGGG AAAAAAAACAGGAGGAGTATGACACAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAA(SEQIDNO:3) Human MWFLTTLLLWVPVDGQVDTTKAVITLQPPWVSVFQEETVTLHCEVLHLPGSSSTQ FcRI WFLNGTATQTSTPSYRITSASVNDSGEYRCQRGLSGRSDPIQLEIHRGWLLLQVS Protein SRVFTEGEPLALRCHAWKDKLVYNVLYYRNGKAFKFFHWNSNLTILKTNISHNGT AAI52384 YHCSGMGKHRYTSAGISVTVKELFPAPVLNASVTSPLLEGNLVTLSCETKLLLQR PGLQLYFSFYMGSKTLRGRNTSSEYQILTARREDSGLYWCEAATEDGNVLKRSPE LELQVLGLQLPTPVWFHVLFYLAVGIMELVNTVLWVTIRKELKRKKKWDLEISLD SGHEKKVISSLQEDRHLEEELKCQEQKEEQLQEGVHRKEPQGAT (SEQIDNO:4) Exemplary MWFLTTLLLWVPVDGQVDTTKAVITLQPPWVSVFQEETVTLHCEVLHLPGSSSTQ Humanized WFLNGTATQTSTPSYRITSASVNDSGEYRCQRGLSGRSDPIQLEIHRGWLLLQVS FcRI SRVFTEGEPLALRCHAWKDKLVYNVLYYRNGKAFKFFHWNSNLTILKTNISHNGT Protein YHCSGMGKHRYTSAGISVTVKELFPAPVLNASVTSPLLEGNLVTLSCETKLLLQR PGLQLYFSFYMGSKTLRGRNTSSEYQILTARREDSGLYWCEAATEDGNVLKRSPE LELQVLGLQLPTPVWGPQSSAPVWFHILFYLSVGIMFSLNTVLYVKIHRLQREKK YNLEVPLVSEQGKKANSFQQVRSDGVYEEVTATASQTTPKEAPDGPRS SVGDCGPEQPEPLPPSDSTGAQTSQS(SEQIDNO:5)
Humanized FcRI Non-Human Animals
[0102] Non-human animals are provided that express humanized FcRI receptor proteins on the surface of immune cells (e.g., myeloid cells) of the non-human animals resulting from a genetic modification of an endogenous locus of the non-human animal that encodes an FcRI protein. Suitable examples described herein include rodents, in particular, mice.
[0103] A humanized endogenous FcRI gene, in some embodiments, comprises genetic material from a heterologous species (e.g., humans), wherein the humanized endogenous FcRI gene encodes a FcRI protein that comprises the encoded portion of the genetic material from the heterologous species. In some embodiments, a humanized endogenous FcRI gene of the present invention comprises genomic DNA of a heterologous species that corresponds to the extracellular portion of a FcRI protein that is expressed on the plasma membrane of a cell. Non-human animals, embryos, cells and targeting constructs for making non-human animals, non-human embryos, and cells containing said humanized endogenous FcRI gene are also provided.
[0104] In some embodiments, the endogenous FcRI locus is deleted. In some embodiments, the endogenous FcRI locus is altered, wherein a portion of the endogenous FcRI locus is replaced with a heterologous sequence (e.g., a human FcRI sequence in whole or in part). In some embodiments, all or substantially all of the endogenous FcRI locus is replaced with a heterologous locus (e.g., a human FcRI locus). In some embodiments, a portion of a heterologous FcRI locus is inserted into an endogenous non-human FcRI locus. In some embodiments, the heterologous locus is a human locus.
[0105] A non-human animal of the present invention contains a human FcRI gene in whole or in part at an endogenous non-human FcRI locus. Thus, such non-human animals can be described as having a heterologous FcRI gene. The replaced, inserted or modified endogenous FcRI locus can be detected using a variety of methods including, for example, PCR, Western blot, Southern blot, restriction fragment length polymorphism (RFLP), or a gain or loss of allele assay.
[0106] In various embodiments, a humanized FcRI gene according to the present invention includes a FcRI gene that has a third, fourth and fifth exon each having a sequence at least 50% (e.g., 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more) identical to a third, fourth, and fifth exon that appear in a human FcRI gene of SEQ ID NO: 3.
[0107] In various embodiments, a humanized FcRI gene according to the present invention includes a FcRI gene that has a nucleotide coding sequence (e.g., a cDNA sequence) at least 50% (e.g., 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more) identical to nucleotides that appear in SEQ ID NO: 5.
[0108] In various embodiments, a humanized FcRI protein produced by a non-human animal of the present invention has an extracellular portion having a sequence that is at least 50% (e.g., 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more) identical to an extracellular portion of a human FcRI protein that appears in Table 3.
[0109] In various embodiments, a humanized FcRI protein produced by a non-human animal of the present invention has an extracellular portion having a sequence that is at least 50% (e.g., 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more) identical to amino acid residues 18-288 that appear in a human FcRI protein of SEQ ID NO: 4.
[0110] In various embodiments, a humanized FcRI protein produced by a non-human animal of the present invention has an amino acid sequence that is at least 50% (e.g., 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more) identical to an amino acid sequence of a humanized FcRI protein as exemplified in SEQ ID NO: 5.
[0111] Compositions and methods for making non-human animals that expresses a humanized FcRI protein, including specific polymorphic forms or allelic variants (e.g., single amino acid differences), are provided, including compositions and methods for making non-human animals that expresses such proteins from a human promoter and a human regulatory sequence. In some embodiments, compositions and methods for making non-human animals that expresses such proteins from an endogenous promoter and an endogenous regulatory sequence are also provided. The methods include inserting the genetic material encoding a human FcRI protein in whole or in part at a precise location in the genome of a non-human animal that corresponds to an endogenous FcRI gene thereby creating a humanized FcRI gene that expresses a FcRI protein that is human in whole or in part. In some embodiments, the methods include inserting genomic DNA corresponding to exons 3-5 a humanized gene that encodes a FcRI protein that contains a human portion containing amino acids encoded by the inserted exons.
[0112] A humanized endogenous FcRI gene approach employs a relatively minimal modification of the endogenous gene and results in natural FcRI mediated effector responses in the non-human animal, in various embodiments, because the genomic sequence of the FcRI sequences are modified in a single fragment and therefore retain normal functionality by including necessary regulatory sequences. Thus, in such embodiments, the FcRI gene modification does not affect other surrounding genes or other endogenous FcRI genes. Further, in various embodiments, the modification does not affect the assembly of a functional receptor on the plasma and maintains normal effector functions via binding and subsequent signal transduction through the cytoplasmic portion of the receptor which is minimally or unaffected by the modification.
[0113] A schematic illustration (not to scale) of an endogenous murine FcRI gene and a humanized endogenous FcRI gene is provided in
[0114] A non-human animal (e.g., a mouse) having a humanized endogenous FcRI gene can be made by any method known in the art. For example, a targeting vector can be made that introduces a human FcRT gene in whole or in part with a selectable marker gene.
[0115] In addition to mice having humanized FcRI genes as described herein, also provided herein are other genetically modified non-human animals that comprise humanized FcRI genes. In some embodiments, such non-human animals comprise a humanized FcRI gene operably linked to an endogenous FcRI promoter. In some embodiments, such non-human animals express a humanized FcRI protein from an endogenous locus, wherein the humanized FcRI protein comprises amino acid residues 16-290 of a human FcRI protein.
[0116] Such non-human animals may be selected from the group consisting of a mouse, rat, rabbit, pig, bovine (e.g., cow, bull, buffalo), deer, sheep, goat, chicken, cat, dog, ferret, primate (e.g., marmoset, rhesus monkey). For the non-human animals where suitable genetically modifiable ES cells are not readily available, other methods are employed to make a non-human animal comprising genetic modifications as described herein. Such methods include, e.g., modifying a non-ES cell genome (e.g., a fibroblast or an induced pluripotent cell) and employing nuclear transfer to transfer the modified genome to a suitable cell, e.g., an oocyte, and gestating the modified cell (e.g., the modified oocyte) in a non-human animal under suitable conditions to form an embryo.
[0117] In some embodiments, a non-human animal of the present invention is a mammal. In some embodiments, a non-human animal of the present invention is a small mammal, e.g., of the superfamily Dipodoidea or Muroidea. In some embodiments, a genetically modified animal of the present invention is a rodent. In some embodiments, a rodent of the present invention is selected from a mouse, a rat, and a hamster. In some embodiments, a rodent of the present invention is selected from the superfamily Muroidea. In some embodiments, a genetically modified animal of the present invention is from a family selected from Calomyscidae (e.g., mouse-like hamsters), Cricetidae (e.g., hamster, New World rats and mice, voles), Muridae (true mice and rats, gerbils, spiny mice, crested rats), Nesomyidae (climbing mice, rock mice, with-tailed rats, Malagasy rats and mice), Platacanthomyidae (e.g., spiny dormice), and Spalacidae (e.g., mole rates, bamboo rats, and zokors). In some certain embodiments, a genetically modified rodent of the present invention is selected from a true mouse or rat (family Muridae), a gerbil, a spiny mouse, and a crested rat. In some certain embodiments, a genetically modified mouse of the present invention is from a member of the family Muridae. In some embodiment, an non-human animal of the present invention is a rodent. In some certain embodiments, a rodent of the present invention is selected from a mouse and a rat. In some embodiments, a non-human animal of the present invention is a mouse.
[0118] In some embodiments, a non-human animal of the present invention is a rodent that is a mouse of a C57BL strain selected from C57BL/A, C57BL/An, C57BL/GrFa, C57BL/KaLwN, C57BL/6, C57BL/6J, C57BL/6ByJ, C57BL/6NJ, C57BL/10, C57BL/10ScSn, C57BL/10Cr, and C57BL/Ola. In some certain embodiments, a mouse of the present invention is a 129 strain selected from the group consisting of a strain that is 129P1, 129P2, 129P3,129X1, 129S1 (e.g., 129S1/SV, 129S1/SvIm), 129S2, 129S4, 129S5, 129S9/SvEvH, 129/SvJae, 129S6 (129/SvEvTac), 129S7, 129S8, 129T1, 129T2 (see, e.g., Festing et al., 1999, Mammalian Genome 10:836; Auerbach et al., 2000, Biotechniques 29(5):1024-1028, 1030, 1032). In some certain embodiments, a genetically modified mouse of the present invention is a mix of an aforementioned 129 strain and an aforementioned C57BL/6 strain. In some certain embodiments, a mouse of the present invention is a mix of aforementioned 129 strains, or a mix of aforementioned BL/6 strains. In some certain embodiments, a 129 strain of the mix as described herein is a 129S6 (129/SvEvTac) strain. In some embodiments, a mouse of the present invention is a BALB strain, e.g., BALB/c strain. In some embodiments, a mouse of the present invention is a mix of a BALB strain and another aforementioned strain.
[0119] In some embodiments, a non-human animal of the present invention is a rat. In some certain embodiments, a rat of the present invention is selected from a Wistar rat, an LEA strain, a Sprague Dawley strain, a Fischer strain, F344, F6, and Dark Agouti. In some certain embodiments, a rat strain as described herein is a mix of two or more strains selected from the group consisting of Wistar, LEA, Sprague Dawley, Fischer, F344, F6, and Dark Agouti.
Non-Human Animals Having Humanized FcRI Genes
[0120] FcR mutant and transgenic non-human animals (e.g., mice) have been reported, for example, by van de Winkel et al. in U.S. Pat. No. 6,111,166.
[0121] Such animals have been employed in assays to assess the molecular aspects of FcRI expression, function and regulation. However, they are not without limitations and disadvantages. For example, the mouse disclosed in the '166 patent contains human FcRI randomly inserted into its genome, which (1) may disrupt the expression and or function of other genes unintentionally, whether detected or not, and (2) results in expression of both fully human and fully mouse FcRI which complicates or confounds particular study of a single type of FcR. Moreover, intracellular signaling region of FcRI chain may be perturbed, disrupted, or otherwise not in accordance with normal FcRI in the mouse disclosed in the '116 patent because the intracellular region of the FcRI chain that participates in signal transduction is human rather than mouse.
[0122] The present invention provides a means to overcome these and other disadvantages. The present invention provides, among other things, a humanized FcRI transgene inserted at an endogenous mouse locus to replace mouse FcRI with a human or hybrid FcRI gene. In some embodiments, a hybrid FcRI gene is inserted at the endogenous mouse locus, wherein the extracellular domain comprises a human sequence and the intracellular domain comprises a mouse sequence. In some embodiments, insertion of a hybrid FcRI gene at an endogenous locus of mouse FcRI gene provides expression of FcRI protein on immune cells that more closely resembles the distribution of human FcRI protein on human immune cells as compared to the distribution of human FcRI protein expression on immune cells of a mouse that additionally expresses an endogenous mouse FcRI protein. In some embodiments, insertion of a hybrid FcRI gene at an endogenous locus of mouse FcRI gene provides expression of FcRI protein on immune cells that is induced and regulated by appropriate signals and stimuli.
[0123] In some embodiments, FcRI chain mediated presentation of MHC class II antigens is functionally maintained in mice having a hybrid FcRI protein with a humanized extracellular region a mouse FcRI chain intracellular region. In some embodiments, intracellular processing of internalized FcRT is preserved in a mouse having a hybrid FcRT protein with a mouse intracellular region as compared to that in a mouse having a fully human FcRT protein or an FcRI protein with a non-murine intracellular region.
[0124] Non-human animals of the present invention provide an improved in vivo system and source of biological materials (e.g., cells) expressing human FcRT that are useful for a variety of assays. In various embodiments, non-human animals of the present invention are used to develop therapeutics that target FcRI and/or modulate FcRI signaling and immune effector responses. In various embodiments, mice of the present invention are used to screen and develop candidate therapeutics (e.g., antibodies) to which FcRI binds. In various embodiments, non-human animals of the present invention are used to determine the immune effector response associated with a particular therapeutic antibody.
[0125] Genetically modified non-human animals that do not express endogenous high affinity mouse FcR genes are useful, e.g., to elucidate the various functions of the individual high affinity FcR genes in the immune response, to measure the efficacy of a human therapeutic antibody via cell-mediated immunity (e.g., ADCC), to determine a role of FcR in immune diseases or disorders, to serve as models of immune diseases or disorders, to generate antibodies against one or more FcR proteins, and to serve as breeding mates to generate other genetically modified mice of interest.
[0126] In one embodiment, a mouse according to the invention can be used to determine a cytotoxic effect lost (in comparison to a wild type mouse) by a mouse that does not express high affinity FcR genes by administering an agent to such a mouse, where the agent is known to trigger an FcR dependent cytotoxic effect in wild type mice. In one embodiment, a mouse of the present invention is implanted with tumor cells and, after a subsequent period of time, injected with an antibody specific for an antigen expressed on the surface of the tumor cells. The isotype of the antibody is known prior to injection and the animals are analyzed for impairment of FcR-dependent ADCC by comparison to ADCC observed in wild type animals.
[0127] In one aspect, mice deficient in endogenous high affinity receptors could be combined (e.g., by breeding) with other immune deficient mice to develop in vivo models of autoimmune disease. For example, Severe Combined Immunodeficiency (SCID) mice are routinely used in the art as model organisms for studying the inner system. Scm mice have an impaired ability to make Tor B lymphocytes, or activate some components of the complement system, and cannot efficiently fight infections, reject tumors, and reject transplants. High affinity FcR a-subunit gene-deficient mice of the present invention may be bred to SCID mice to ascertain cell depletion in a host animal in response to administration of an antibody therapeutic (e.g., an anti-tumor antibody), which would determine the roles of ADCC and complement dependent cytotoxicity (CDC) in tumor cell depletion in vivo.
[0128] In some embodiments, genetically modified non-human animals comprising a replacement of the endogenous high affinity FcR genes with high-affinity human FcR genes are provided. Such animals are useful for studying the pharmacokinetics of fully human antibodies and FcR-mediated ADCC. In addition, human FcR genes have been shown to exhibit polymorphisms or allelic variants associated with disease. Thus, genetically modified non-human animals that comprise a replacement of the endogenous high affinity FcR genes with specific allelic or polymorphic forms of human FcR genes can be used to study human autoimmune diseases, and traits associated with the polymorphisms, in the animal. In some embodiments, the allelic forms of human FcR genes are associated with enhanced efficacy for human IgG.
[0129] In some embodiments, the effect of a human high affinity FcR polymorphism on the efficacy of a human antibody therapeutic is determined. In some embodiments, an anti-tumor antibody is administered to a first humanized mouse comprising a first polymorphism of a human FcR and also to a second humanized mouse comprising a second polymorphism of a human FcR, wherein the first and the second mice each comprise a human tumor cell; and the anti-tumor activity of the anti-tumor antibody is assessed in the first mouse and in the second mouse.
[0130] In some embodiments, a treatment option is selected by a physician with respect to treating a human having the first or the second polymorphism and having a tumor corresponding to the human tumor cell based on the assessment of efficacy of the anti-tumor antibody in the first mouse and in the second mouse.
[0131] The endogenous FcRI -chain replacement approach employs a relatively minimal disruption of natural FcR-mediated signal transduction in the animal. In various embodiments, genomic sequence of the FcR -chains are replaced in a single fragment and therefore retain normal functionality by including necessary regulatory sequences. Thus, in such embodiments, the FcR -chain modification does not impair other endogenous FcRs dependent upon functional FcR-chain molecules. Further, in various embodiments, the modification does not affect the assembly of functional receptor complex involving an FcR -chain and the endogenous FcR-chain, which may be important for proper expression of some FcR -chains on the cell surface and for certain downstream signaling resulting from an activated receptor. Because the FcR -chain is not deleted, in various embodiments animals containing a replacement of endogenous FcR -chain genes with human FcR -chain genes may process normal effector functions from antibodies through binding of the Fc portion of IgG immunoglobulins to the human FcR -chains present on the surface of accessory cells.
[0132] Non-human animals of the present invention express humanized FcRT protein, thus cells, cell lines, and cell cultures can be generated to serve as a source of humanized FcRI for use in binding and functional assays, e.g., to assay for binding or function of FcRT to a potential therapeutic antibody. In various embodiments, a humanized FcRI protein expressed by a non-human animal as described herein may comprise a variant amino acid sequence. Variant human FcRI proteins having variations associated with ligand binding residues have been reported. In various embodiments, non-human animals of the present invention express a humanized FcRI protein variant. In various embodiments, the variant is polymorphic at an amino acid position associated with ligand binding. In various embodiments, non-human animals of the present invention are used to determine the immune effector response of a therapeutic antibody through interaction with a polymorphic variant of human FcRI.
[0133] Cells from non-human animals of the present invention can be isolated and used on an ad hoc basis, or can be maintained in culture for many generations. In various embodiments, cells from a non-human animal of the present invention are immortalized and maintained in culture indefinitely (e.g., in serial cultures).
[0134] Non-human animals of the present invention provide improved in vivo system elucidating mechanisms of antibody dependent cell mediated cytotoxicity.
EXAMPLES
[0135] The following examples are provided so as to describe to those of ordinary skill in the art how to make and use methods and compositions of the invention, and are not intended to limit the scope of what the inventors regard as their invention. Unless indicated otherwise, temperature is indicated in Celsius, and pressure is at or near atmospheric.
Example 1
Humanization of an Endogenous FcRI Gene.
[0136] This example illustrates exemplary methods of humanizing an endogenous gene encoding high affinity FcRI in a non-human mammal such as a rodent (e.g., a mouse).
Construction of Humanization FcRI Targeting Vector (MAID6074)
[0137] A large targeting vector (LTVEC) was constructed by using the human Fc Gamma Receptor 1 gene (promoter region, signal plus ecto domain region) to replace the mouse counterparts sequence on murine chromosome 3.
Generation of BAC-Based Targeting Vectors (MAID6073)
[0138] Mouse BAC RP23-477p23 and human BAC CTD-2339o22 containing the gene of FcRI were identified using blast and BAC end sequence based on database of NCBI and Ensemble.
[0139] The approach to generate targeting vectors, the LTVEC contained human sequence from (5 distal end) FcRI gene promoter (25kb) to the 3 proximal end at the gene codon W290 (before its transmembrane domain(TM)) of the human FcRI gene, (followed by the mouse trans-membrane domain and the rest of gene), involves the following steps.
[0140] First, by homologous recombination in bacteria, 5 end of human sequence from human BAC(CTD-2339o22) removed and left a I-Ceul site and a 25 kb promoter region of the FcRI gene, 3 end human sequence removed by the loxped pgk-Neo cassette located in the intron 5 (404bp upstream of TM domain) of FcRI gene, followed by AsiS1 site.
[0141] Second, by homologous recombination in bacteria, in Mouse BAC RP23-477p23, mouse FcRI gene (from its promoter(20 kb) up to the transmembrane domain) removed by a Spec cassette (8 AA of EC3 domain of human FcRI sequence (up to the codon W290) added before mouse TM) flanked by I-Ceul and AsiS1 sites.
[0142] Third, digestion and ligation by I-Ceul and AsiS1 sites to generate the LTVEC (MAID6073) contained human sequence from the (5 distal end) FcRI gene promoter (25 kb) to the 3 proximal end at the codon W290 (before the transmembrane domain) of the human FcRI, followed by the mouse transmembrane domain and the rest of gene.
[0143]
Selection of Targeted Mouse ES Cells
[0144] The MAID 6074 LTVEC was electroporated into the mouse ES cell line F1H4.
Example 2
Generation of High Affinity FcRI Humanized Mice
[0145] This example illustrates transformation and breeding of mice. hFcgR1 ecto domain (MAID 6073) LTVEC was electroporated into parental F1H4 mouse Embryonic Stem (ES)cells. Colonies surviving G418 drug selection were picked and screened for the homologous recombination of human FcRI sequence into the FcRI mouse locus. Eight clones were identified to have the appropriate modification and being heterozygous for human FcRI ecto domain, one of which was clone 6073F-D2. All these clones contained the neo cassette.
[0146] Clone 6073F-D2 was electroporated with 2 g of Cre plasmid to remove the neo cassette. The colonies were picked and then screened for the absence of the neo cassette. Of the clones determined to have the neo cassette removed, ES clones 6074B-A1 and 6074B-A10 were micro-injected using the VelociMouse method.
[0147] Male and female (XY female) FO VelociMice were generated from clones 6074B-A1 and 6074B-A10. These FO mice were bred to each other in clonal and non-clonal pairings. Fl mice were produced and these mice were shown to be heterozygous and homozygous (and wildtype) for the human FcRI. The Fl mice appeared normal and the ratio of Hom:Het:WT mice followed the predicted Mendelian ratio of 1:2:1. Cohorts of males and females being wild-type and homozygous for human FcRI were transferred for study.
Example 3
Characterization of High Affinity FcRI Humanized Mice
[0148] This example illustrates the characteristic expression of high affinity FcRI protein on the surface of cells from non-human animals engineered to contain an humanized FcRI gene construct as described in Example 1 at an endogenous FcRI locus.
[0149] Genotypic characterization of high affinity FcRI humanized mice is shown in
[0150] The results of phenotypic characterization of are shown in
Example 4
Phenotypic Characterization of High Affinity FcRI Humanized Mice Treated with Murine Granulocyte Colony Stimulating Factor (mG-CSF)
[0151] Phenotypic analysis was performed for MAID 6074 (hFcRI) HO mice treated with murine G-CSF (mG-CSF) vs. phosphate buffered saline (PBS) control. Mice were examined 48 hours after subcutaneous injection. Data is shown for 6-7 week old MAID 6074 WT mice treated with PBS (n=2) or mG-CSF (n=2) compared to MAID 6074 HO mice treated with PBS (n=2) or mG-CSF (n=3). Results were similar for 16-17 week old MAID 6074 WT mice treated with PBS (n=1) or mG-CSF (n=1) compared to MAID 6074 HO mice treated with PBS (n=1) or mG-CSF (n=1). Baseline (PBS) and mG-CSF induced expression of mouse or hybridized FcRI in monocytes, macrophages, neutrophils and dendritic cells in blood and spleen of MAID 6074 WT and MAID 6074 HO mice are shown in
[0152] Untreated MAID 6074 HO mice express FcRI (CD64) mRNA in blood, although protein was not detected by FACS. G-CSF (48 hrs) induced an increase in FcRI (CD64) mRNA in blood and spleen, and protein as detected by FACS.
Example 5
Phenotypic Characterization of Mice Expressing Humanized High and Low Affinity Fc Receptors
[0153] Mice were generated that expressed humanized high affinity and low affinity Fc receptors by using standard breeding techniques. Specifically, mice expressing humanized high affinity FcRI generated as described in Examples 1 and 2 were crossed with mice expressing humanized low affinity FcRIIa, FcRIIb, FcRIIc, FcRIIIa and FcRIIIb generated as described in Examples 1-6 and
[0154] Phenotypic analysis was performed on the humanized high and low affinity FcR mice following treatment with murine G-CSF (mG-CSF) or a phosphate buffered saline (PBS) control. Mice were administered a subcutaneous injection of PBS or mG-CSF (62 g s.c., single dose). After 48 hours, blood and spleens from the treated mice were harvested and phenotypically characterized by FACS as described in Example 4. The cell surface phenotype of the humanized high and low affinity FcR mice was similar to the phenotype observed for the high affinity FcR humanized mice. Also similar to the high affinity Fc receptor humanized mice, the mice in which both the high and low affinity Fc receptor were humanized showed increased expression of human FcRI in blood and splenic monocytes, macrophages and neutrophils. In summary, humanization of the low affinity Fc receptors in the FcRI humanized mice produced no significant phenotypic change.
Equivalents
[0155] Having thus described several aspects of at least one embodiment of this invention, it is to be appreciated by those skilled in the art that various alterations, modifications, and improvements will readily occur to those skilled in the art. Such alterations, modifications, and improvements are intended to be part of this disclosure, and are intended to be within the spirit and scope of the invention. Accordingly, the foregoing description and drawing are by way of example only and the invention is described in detail by the claims that follow.
[0156] Use of ordinal terms such as first, second, third, etc., in the claims to modify a claim element does not by itself connote any priority, precedence, or order of one claim element over another or the temporal order in which acts of a method are performed, but are used merely as labels to distinguish one claim element having a certain name from another element having a same name (but for use of the ordinal term) to distinguish the claim elements.
[0157] The articles a and an as used herein in the specification and in the claims, unless clearly indicated to the contrary, should be understood to include the plural referents. Claims or descriptions that include or between one or more members of a group are considered satisfied if one, more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process unless indicated to the contrary or otherwise evident from the context. The invention includes embodiments in which exactly one member of the group is present in, employed in, or otherwise relevant to a given product or process. The invention also includes embodiments in which more than one, or the entire group members are present in, employed in, or otherwise relevant to a given product or process. Furthermore, it is to be understood that the invention encompasses all variations, combinations, and permutations in which one or more limitations, elements, clauses, descriptive terms, etc., from one or more of the listed claims is introduced into another claim dependent on the same base claim (or, as relevant, any other claim) unless otherwise indicated or unless it would be evident to one of ordinary skill in the art that a contradiction or inconsistency would arise. Where elements are presented as lists, (e.g., in Markush group or similar format) it is to be understood that each subgroup of the elements is also disclosed, and any element(s) can be removed from the group. It should be understood that, in general, where the invention, or aspects of the invention, is/are referred to as comprising particular elements, features, etc., certain embodiments of the invention or aspects of the invention consist, or consist essentially of, such elements, features, etc. For purposes of simplicity those embodiments have not in every case been specifically set forth in so many words herein. It should also be understood that any embodiment or aspect of the invention can be explicitly excluded from the claims, regardless of whether the specific exclusion is recited in the specification.
[0158] Those skilled in the art will appreciate typical standards of deviation or error attributable to values obtained in assays or other processes described herein.