Voltage indicators
11598792 · 2023-03-07
Assignee
Inventors
Cpc classification
C07K2319/60
CHEMISTRY; METALLURGY
C07K2319/33
CHEMISTRY; METALLURGY
G01N21/6486
PHYSICS
International classification
Abstract
A voltage indicator includes a polypeptide sequence comprising a voltage-sensitive opsin domain and a capture protein domain arranged and disposed to capture a fluorescent dye ligand. When the fluorescent dye ligand is captured and the voltage indicator is bound to a cell membrane, an increase in voltage across the cell membrane causes an increase in fluorescent emission.
Claims
1. A voltage indicator, comprising: a voltage-sensitive microbial rhodopsin domain comprising the amino acid sequence of SEQ ID NO: 9 with an amino acid mutation at one or more of residue 81, 92, and 199; and a capture protein that covalently or noncovalently binds a fluorescent dye ligand that is (i) a fluorescent protein; or (ii) a fluorescent dye, wherein the capture protein is provided together with the voltage-sensitive microbial rhodopsin domain in a fusion protein.
2. A voltage indicator, comprising an amino acid sequence selected from the group of amino acid sequences of SEQ ID NOS: 2, 4, 6, and 8.
3. The voltage indicator of claim 1, wherein the capture protein is selected from the group consisting of biotin-avidin, a self-labeling protein tag, or a combination thereof.
4. The voltage indicator of claim 1, wherein the capture protein domain is a self-labeling protein tag.
5. The voltage indicator of claim 1, wherein 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acids are removed from the junction between the rhodopsin domain and the capture protein.
6. The voltage indicator of claim 1, and further comprising a targeting sequence.
7. The voltage indicator of claim 6, wherein the targeting sequence is a soma targeting sequence.
8. The voltage indicator of claim 6, wherein the capture protein is positioned at the c-terminal end of the voltage-sensitive microbial rhodopsin domain.
9. The voltage indicator of claim 1, wherein the fluorescent dye ligand is an azetidine-containing fluorescent dye.
10. The voltage indicator of claim 1, wherein the fluorescent dye ligand is a fluorescent protein.
11. A method of measuring voltage, the method comprising contacting the voltage indicator of claim 1 and a fluorescent dye ligand with a cell, and determining changes in fluorescence of the fluorescent dye ligand when the fluorescent dye ligand is captured by the voltage indicator.
12. The method of claim 11, wherein the cell is a neuron.
13. The method of claim 11, and further comprising observing changes in fluorescence with a microscope.
14. The method of claim 11, wherein the voltage indicator further comprises a linker between the voltage-sensitive domain and the capture protein.
15. The method of claim 11, further comprising modifying a length of the linker.
16. The method of claim 11, wherein an increase in membrane potential lead to an increase in fluorescence.
17. A voltage indicator, comprising the amino acid sequence of SEQ ID NO: 20.
18. A method of measuring voltage, the method comprising contacting the voltage indicator of claim 17 and a fluorescent dye ligand with a cell, and determining changes in fluorescence when the fluorescent dye ligand is captured by the voltage indicator.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1) The novel features of the invention are set forth with particularity in the appended claims. A better understanding of the features and advantages of the present invention will be obtained by reference to the following detailed description that sets forth illustrative embodiments, in which the principles of the invention are used, and the accompanying drawings of which:
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
(24)
(25)
(26)
(27)
(28)
(29)
(30)
(31)
(32)
(33)
(34)
(35)
(36)
(37)
(38)
(39)
(40)
(41)
(42)
(43)
(44)
(45)
(46)
(47)
(48)
(49)
(50)
(51)
(52)
(53)
(54)
(55)
(56)
(57)
(58)
(59)
(60)
(61)
(62)
(63)
(64)
(65)
(66)
(67)
(68)
(69)
(70)
(71)
(72)
(73)
(74)
(75)
(76)
(77)
(78)
(79)
(80)
(81)
(82)
(83)
(84)
(85)
DESCRIPTION OF EXEMPLARY EMBODIMENTS
(86) The details of one or more embodiments of the presently-disclosed subject matter are set forth in this document. Modifications to embodiments described in this document, and other embodiments, will be evident to those of ordinary skill in the art after a study of the information provided in this document. The information provided in this document, and particularly the specific details of the described exemplary embodiments, is provided primarily for clearness of understanding and no unnecessary limitations are to be understood therefrom. In case of conflict, the specification of this document, including definitions, will control.
(87) The presently-disclosed subject matter includes a genetically encoded voltage indicators (GEVI) with a direction of fluorescence change such that an increase in membrane potential leads to an increase in fluorescence.
(88) The presently-disclosed subject matter includes voltage indicators and methods of measuring voltage. In some embodiments, the voltage indicators include membrane-localized voltage-sensitive protein and a capture protein engineered to capture a fluorescent dye ligand. These voltage indicators combine the brightness and photostability of robust fluorescent dyes with the targetability of proteins. In this regard, the voltage indicators of the presently-disclosed subject matter include amino acid sequences to improve/localize membrane targeting, such that membrane potential/membrane voltage can be assessed. When the voltage indicator is targeted to a cell membrane, an increase in voltage across the cell membrane causes an increase in fluorescent emission from a fluorescent dye ligand associated with the voltage indicator.
(89) As described herein, the voltage indicators of the presently-disclosed subject matter are uniquely designed to provide a number of benefits that allow for a rapid increase in a robust fluorescent signal in response to spikes in voltage across the membrane. It is also notable that, for example in the case of a neuron, the voltage indicators provide for a rapid increase in a robust fluorescent signal in response to spikes, as well as in response to subthreshold voltage signals. Embodiments of the indicators have sub-millisecond response times between an increase in voltage and an increase in florescent emission. As will be appreciated by those of ordinary skill in the art, the ability to rapidly assess voltage increases with an increase in fluorescence is of particular utility, for example, to reduce noise and enhance sensitivity.
(90) The presently-disclosed subject matter includes a voltage indicator, which comprises a voltage-sensitive protein including amino acid mutations, and a capture protein domain arranged and disposed to capture a fluorescent dye ligand. Beneficially, when the fluorescent dye ligand is captured by the capture protein domain, and when the voltage indicator is bound to a membrane, an increase in voltage across the membrane causes an increase in fluorescent emission from the fluorescent dye ligand. In some embodiments, the membrane is a membrane of a neuron. In this regard, the increase in voltage, whether a spike in voltage or a subthreshold voltage signal, results in an increase in fluorescent emission correlating to the voltage. In some embodiments, the response time between the increase in voltage and the increase in fluorescent emission is less than about a millisecond.
(91) Suitable voltage sensitive proteins include, but are not limited to, one or more opsins, one or more other molecules including a voltage-sensing domain, or a combination thereof, and including amino acid mutations. For example, in some embodiments, the voltage-sensitive protein is a voltage-sensitive opsin domain. In some embodiments, the voltage-sensitive opsin domain is a microbial opsin domain. In some embodiments, the voltage-sensitive opsin domain is a microbial rhodopsin domain.
(92) “Microbial rhodopsins” are a large class of proteins characterized by seven transmembrane domains and a retinilydene chromophore bound in the protein core to a lysine via a Schiff base. Over 5,000 microbial rhodopsins are known, and these proteins are found in all kingdoms of life. Microbial rhodopsins serve a variety of functions for their hosts: some are light-driven proton pumps (bacteriorhodopsin, proteorhodopsins), others are light-driven ion channels (channelrhodopsins), chloride pumps (halorhodopsins), or serve in a purely photosensory capacity (sensory rhodopsins). The retinilydene chromophore imbues microbial rhodopsins with unusual optical properties. The linear and nonlinear responses of the retinal are highly sensitive to interactions with the protein host: small changes in the electrostatic environment can lead to large changes in absorption spectrum. These electro-optical couplings provide the basis for voltage sensitivity in microbial rhodopsins.
(93) In some embodiments, the microbial rhodopsin domain is selected from the group consisting of QuarsAr1, QuarsAr2, Ace2N, and combinations thereof. In another embodiment, the voltage sensitive protein includes a Ciona intestinalis voltage-sensing domain (CiVSD), Danio rerio voltage-sensing domain (DrVSD), Gallus gallus voltage-sensing domain (GgVSD), or a combination thereof.
(94) In some embodiments, the microbial rhodopsin domain comprises an amino acid sequence having at least 90, 95, 98, or 99% sequence identity to SEQ ID NO: 9, SEQ ID NO: 15, SEQ ID NO: 16, or SEQ ID NO: 17.
(95) In some embodiments, the voltage-sensitive opsin domain is Ace2N including an amino acid mutation at one or more of residue 81, 92, and 199. In some embodiments, the voltage-sensitive opsin domain comprises the polypeptide of SEQ ID NO: 9 having one, two, three, or four amino acid mutations. In some embodiments, the voltage-sensitive opsin domain comprises the amino acid sequence of SEQ ID NO: 9 having an amino acid mutation at one or more of residue 81, 92, and 199.
(96) In some embodiments, the voltage indicator includes an amino acid sequence selected from SEQ ID NOS: 2, 4, 6, 8, 20, 22, 24, and 26. In some embodiments, the voltage indicator includes an amino acid sequence encoded by a nucleotide sequence selected from the group of nucleotide sequences of SEQ ID NOS: 1, 3, 5, 7, 19, 21, 23, and 25.
(97) Suitable capture proteins include any protein configured to bind a desired ligand. For example, in one embodiment, the capture protein includes a covalent capture protein. In some embodiments, the capture protein of the voltage indicator is a non-covalent capture protein. In some embodiments, the non-covalent capture protein is selected from the group consisting of TMP-tag, biotin-avidin, and a combination thereof. In some embodiments, the capture protein domain is selected from a HaloTag and a SNAP-Tag. In some embodiments, the capture protein is a covalent capture protein. In some embodiments, the covalent capture protein is selected from the group consisting of HaloTag, SNAP-tag, TMP-tag, βLac-tag, CLIP-tag, or a combination thereof. In some embodiments, the capture protein domain comprises an amino acid sequence selected from the amino acid sequence of SEQ ID NOS: 10 and 11.
(98) In some embodiments, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acids are removed from the junction between the opsin domain and the capture protein.
(99) In some embodiments, in addition to the voltage-sensitive protein domain and the capture protein domain, the voltage indicator also includes a targeting sequence. In some embodiments, the targeting sequence is a soma targeting sequence for directing the indicator to a neuron. In some embodiments, the targeting sequence comprises the amino acid sequence of SEQ ID NO: 12.
(100) In some embodiments, the mutated voltage-sensitive microbial opsin domain and the capture protein are provided as a fusion protein. In some embodiments, the capture protein is positioned at the c-terminal end of the voltage-sensitive microbial opsin domain. In some embodiments, the indicator also includes a targeting sequence that is positioned at the c-terminal end of the capture protein.
(101) As noted herein above, the voltage indicator includes a capture protein domain arranged and disposed to capture a fluorescent dye ligand. Suitable fluorescent dye ligands include, but are not limited to, one or more fluorophore dyes. In one embodiment, the fluorophore dye includes a fluorophore containing one or more cyclic amine substituents. In another embodiment, the fluorescent dye ligand is an azetidine-containing Janelia Fluor™ dyes. For example, the fluorescent dye ligand can be Janelia Fluor™.sub.505, Janelia Fluor™.sub.525, Janelia Fluor™.sub.549, Janelia Fluor™.sub.585, Janelia Fluor™.sub.646, or combinations thereof. In some embodiments, the fluorescent dye ligand is a fluorescent protein. For example, the fluorescent dye ligand can be sfGFP or mNeonGreen.
(102) The presently-disclosed subject matter also includes methods of measuring voltage, and in particular, methods of measuring voltage across a membrane. The voltage indicators as described herein are used to perform the method.
(103) In some embodiments, the method involves administering the voltage indicator and determining changes in fluorescence of the fluorescent dye ligand. When the fluorescent dye ligand is captured by the capture protein domain, and when the voltage indicator is bound to a cell membrane, an increase in voltage across the cell membrane causes an increase in fluorescent emission from the fluorescent dye ligand. In this regard, the method can involve determining changes in voltage based on changes in fluorescence. In some embodiments, an increase in membrane potential leads to an increase in fluorescence.
(104) The method can be used to measure voltage across the membrane of a cell, such as a neuron. Florescent emission will increase with an increase in voltage, which can be a spike in voltage or a subthreshold voltage signal. In some embodiments, the response time between the increase in voltage and the increase in fluorescent emission is less than about a millisecond.
(105) The changes in fluorescence may be measured through any suitable method such as, but not limited to, observation with a microscope, image capture, video recording, or a combination thereof.
(106) In some embodiments, the voltage indicator includes a linker between the voltage-sensitive domain and the capture protein domain. Embodiments of the indicator and method can include modifying a length of the linker. For example, modifying the length of the linker can include removing at least one amino acid residue. In some embodiments, about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, or 22 amino acid residues can be removed. In some embodiments, the modification of the length of the linker can modify the size of a fluorescence response.
(107) While the terms used herein are believed to be well understood by those of ordinary skill in the art, certain definitions are set forth to facilitate explanation of the presently-disclosed subject matter.
(108) Unless defined otherwise, all technical and scientific terms used herein have the same meaning as is commonly understood by one of skill in the art to which the invention(s) belong.
(109) All patents, patent applications, published applications and publications, GenBank sequences, databases, websites and other published materials referred to throughout the entire disclosure herein, unless noted otherwise, are incorporated by reference in their entirety.
(110) Where reference is made to a URL or other such identifier or address, it understood that such identifiers can change and particular information on the internet can come and go, but equivalent information can be found by searching the internet. Reference thereto evidences the availability and public dissemination of such information.
(111) As used herein, the abbreviations for any protective groups, amino acids and other compounds, are, unless indicated otherwise, in accord with their common usage, recognized abbreviations, or the IUPAC-IUB Commission on Biochemical Nomenclature (see, Biochem. (1972) 11(9):1726-1732).
(112) Although any methods, devices, and materials similar or equivalent to those described herein can be used in the practice or testing of the presently-disclosed subject matter, representative methods, devices, and materials are described herein.
(113) In certain instances, nucleotides and polypeptides disclosed herein are included in publicly-available databases, such as GENBANK® and SWISSPROT. Information including sequences and other information related to such nucleotides and polypeptides included in such publicly-available databases are expressly incorporated by reference. Unless otherwise indicated or apparent the references to such publicly-available databases are references to the most recent version of the database as of the filing date of this Application.
(114) The present application can “comprise” (open ended) or “consist essentially of” the components of the present invention as well as other ingredients or elements described herein. As used herein, “comprising” is open ended and means the elements recited, or their equivalent in structure or function, plus any other element or elements which are not recited. The terms “having” and “including” are also to be construed as open ended unless the context suggests otherwise.
(115) Following long-standing patent law convention, the terms “a”, “an”, and “the” refer to “one or more” when used in this application, including the claims. Thus, for example, reference to “a cell” includes a plurality of such cells, and so forth.
(116) Unless otherwise indicated, all numbers expressing quantities of ingredients, properties such as reaction conditions, and so forth used in the specification and claims are to be understood as being modified in all instances by the term “about”. Accordingly, unless indicated to the contrary, the numerical parameters set forth in this specification and claims are approximations that can vary depending upon the desired properties sought to be obtained by the presently-disclosed subject matter.
(117) As used herein, the term “about,” when referring to a value or to an amount of mass, weight, time, volume, concentration or percentage is meant to encompass variations of in some embodiments ±20%, in some embodiments ±10%, in some embodiments ±5%, in some embodiments ±1%, in some embodiments ±0.5%, in some embodiments ±0.1%, in some embodiments ±0.01%, and in some embodiments ±0.001% from the specified amount, as such variations are appropriate to perform the disclosed method.
(118) As used herein, ranges can be expressed as from “about” one particular value, and/or to “about” another particular value. It is also understood that there are a number of values disclosed herein, and that each value is also herein disclosed as “about” that particular value in addition to the value itself. For example, if the value “10” is disclosed, then “about 10” is also disclosed. It is also understood that each unit between two particular units are also disclosed. For example, if 10 and 15 are disclosed, then 11, 12, 13, and 14 are also disclosed.
(119) As used herein, “optional” or “optionally” means that the subsequently described event or circumstance does or does not occur and that the description includes instances where said event or circumstance occurs and instances where it does not. For example, an optionally variant portion means that the portion is variant or non-variant.
(120) The presently-disclosed subject matter is further illustrated by the following specific but non-limiting examples. The following examples may include compilations of data that are representative of data gathered at various times during the course of development and experimentation related to the present invention.
EXAMPLES
Example 1
(121) Through mutagenesis, the present inventors inverted the direction of fluorescence change in exemplary rhodopsin electrochromic fluorescence resonance energy transfer (eFRET) genetically encoded voltage indicators (GEVIs) such that an increase in membrane potential lead to an increase in fluorescence. Several different single amino acid substitutions inverted the fluorescence change of an exemplary eFRET GEVI (i.e., an amino acid substitution relative to the sequence of
(122) By way of comparison,
(123) In one embodiment, D92N (SEQ ID NO: 2), a single amino acid substitution inverted the florescence change (
(124) An additional amino acid substitution, N81D, increased the speed of fluorescence change such that the fluorescence could follow action potentials in neurons (
(125) An additional amino acid substitution (E199V) increased the sensitivity such that the fluorescence change of N81D D92N E199V (SEQ ID NO: 6) was equal in amplitude to the indicator of
Example 2
(126) Voltron was used for in vivo voltage imaging in mice, zebrafish, and fruit flies. In mouse cortex, Voltron allowed single-trial recording of spikes and subthreshold voltage signals from dozens of neurons simultaneously, over 15 minutes of continuous imaging. In larval zebrafish, Voltron enabled the precise correlation of spike timing with behavior.
(127) An exemplary design for a chemigenetic voltage indicator combined a voltage-sensitive microbial rhodopsin domain (6, 7, 11) with a self-labeling protein tag domain (
(128) The modularity of this approach was investigated, and three different exemplary rhodopsin domains, QuasAr1 (7), QuasAr2 (7), and Ace2N (11, 20), were all able to modulate the fluorescence of JF.sub.549 bound to either HaloTag (15) or SNAP-tag (21) self-labeling tag domains (
(129) Voltron was tested in neuron cultures using high-speed imaging with simultaneous whole-cell patch clamp electrophysiology (
(130) TABLE-US-00001 TABLE 1 Voltron525 and Ace2N-mNeon kinetics in primary neuron culture cells Activation Deactivation (−70 mV to 30 mV) (30 mV to −70 mV) τ.sub.fast (ms) τ.sub.slow (ms) % fast τ.sub.fast (ms) τ.sub.slow (ms) % fast Ace2N- 0.59 ± 0.10 6.9 ± 0.5 62 ± 3 0.63 ± 0.09 6.0 ± 1.1 55 ± 4 mNeon Voltron- 0.64 ± 0.09 4.1 ± 0.6 61 ± 4 0.78 ± 0.12 3.9 ± 0.2 55 ± 7 JF525 Neurons expressing Ace2N-mNeon and Voltron525 were imaged at 3.2 kHz during whole cell voltage clamp as detailed in the methods section. Fluorescence traces were then fit using a double exponential model (FIG. 11). Errors are s.e.m. n = 7 cells for Ace-mNeon and n = 8 cells for Voltron525.
(131) The brightness and photostability of Voltron in neuronal cultures was compared with two other recently described fluorescent protein-based GEVIs: Ace2N-mNeon (11) and ASAP-2f (13). Both Voltron525 and Voltron549 were brighter than Ace2N-mNeon (3-4×) and ASAP-2f (16-18×) (
(132) TABLE-US-00002 TABLE 2 Photophysical properties of parent fluorophore HaloTag-bound JFdyes and green fluorescent proteins (mean values, n = 9) Fluoro- λabs λem ε.sub.max W .sup.(a) τ.sub.1 (A1) .sup.(b) τ.sub.2 (A2) <τ.sub.b > .sup.(c) τ.sub.1/2 .sup.(f) phore (nm) (nm) (mM.sup.−1cm.sup.−1) Φ.sub.fl (sec.sup.−1) (sec) (sec) (sec) Pb/10.sup.−6 (d) N.sub.ph/10.sup.5 (e) (sec) JF505 509 531 56.8 0.83 941 59 (0.59) 264 (0.41) 144 7.36 1.13 51 JF525 532 553 83.6 0.87 1,549 329 (1.0) 330 1.96 4.43 336 JF549 555 578 91.3 0.86 3,158 907 (0.65) 124 (0.35) 633 0.50 17.2 804 JF585 593 611 109 0.83 4,443 931 (1.0) 950 0.24 35.1 3,320 JF635 641 656.5 64.0 0.7 2,486 1976 (1.0) 1,980 0.20 34.4 3,130 sfGFP 488 511 51.5 0.66 1,597 90 (0.66) 167 (0.34) 117 5.32 1.24 71 mNeon 506 517.5 120 0.85 1,773 102 (0.72) 144 (0.28) 114 4.83 1.80 118 .sup.(a) Excitation rate (absorbed photons/sec) equal to the integral over wavelength of the product of extinction coefficient and spectral irradiance. .sup.(b) Decay constant (normalized amplitude) of multi-exponential fit to the photobleaching decay curve. .sup.(c) Amplitude-weighted lifetime equal to A.sub.1 τ.sub.1 + A.sub.2τ.sub.2. .sup.(d) Calculated probability of photobleaching per absorbed photon. .sup.(e) Calculated number of photons emitted per molecule before photobleaching. .sup.(f) Calculated time to bleach from a rate of 1000 to 500 photons per sec per molecule.
(133) TABLE-US-00003 TABLE 3 Photobleaching properties of GEVI sensors in neuronal cell culture (mean values, n = 5) W .sup.(a) T.sub.1 (A.sub.1) .sup.(b) T.sub.2 (A.sub.2) <τ.sub.b> .sup.(c) T.sub.1/2 .sup.(f) sensor (sec.sup.−1) (sec) (sec) (sec) Pb/10.sup.−6 (d) N.sub.ph/10.sup.5 (e) (sec) Voltron525 1,549 171 (0.84) 1497 (0.15) 373 1.74 5.03 206 Voltron549 3,158 675 (0.67) 61.5 (0.31) 471 0.672 12.8 538 ASAP-2f 1,597 400 (0.68) 24.9 (0.30) 281 2.23 2.96 132 Ace2N-mNeon 1,773 118 (0.88) 147 (0.11) 120 4.70 1.81 119 .sup.(a) Excitation rate (absorbed photons/sec) equal to the integral over wavelength of the product of extinction coefficient and spectral irradiance. .sup.(b) Decay constant (normalized amplitude) of multi-exponential fit to the photobleaching decay curve. .sup.(c) Amplitude-weighted lifetime equal to A.sub.1 τ.sub.1 + A.sub.2τ.sub.2. .sup.(d) Calculated probability of photobleaching per absorbed photon. .sup.(e) Calculated number of photons emitted per molecule before photobleaching. .sup.(f) Calculated time to bleach from a rate of 1000 to 500 photons per sec per molecule.
(134) The chemigenetic Voltron indicator was next deployed in vivo, observing that the protein could be reliably expressed and labeled with dye in mice, larval zebrafish, and adult fruit flies (
(135) To further assess the advantages garnered from Voltron's improved photostability and brightness, the illumination intensity, imaging duration, and field of view used for in vivo imaging were investigated (
(136) Voltron was then used to image behaving zebrafish larvae, which reliably respond to visual input with fast, directed swim bouts that are tailored to the details of the stimulus (26). Studies were conducted to determine how this sensory-to-motor transformation unfolds in neuronal populations at fine timescales that are inaccessible with calcium imaging. It was first verified that Voltron could detect action potentials and subthreshold voltage signals in live zebrafish using several different colors of dye ligands (
(137) Finally, Voltron was tested in adult Drosophila in vivo by expressing the protein in a pair of dopaminergic neurons, one in each brain hemisphere, which innervate a single compartment in the mushroom body. Strong spiking signals were detected from axons and dendrites of these neurons using Voltron549 (
(138) Combining the molecular specificity of genetically encoded reagents with the superior photophysics of chemical dyes is an established path to improved imaging reagents (14). However, previous attempts to create hybrid small-molecule:protein indicators using a variety of approaches have not been successful for in vivo imaging (28). Here, a modular sensor scaffold was engineered where the targeting and sensor domains are genetically encoded and only the fluorophore and its protein-binding anchor are synthetic. The resulting chemigenetic indicator, Voltron, exhibits substantially increased photon output, enabling in vivo voltage imaging of many more neurons over longer times—approximately 10.sup.2 more neuron-minutes than other sensors. This improvement enables imaging experiments that reveal how the precise electrical dynamics of neuronal populations orchestrate behavior over different time scales.
Example 3
(139) Reagent availability: Voltron plasmids pCAG-Voltron (plasmid #), pCAG-Voltron-ST (plasmid #), pAAV-hsyn-Voltron (plasmid #), pAAV-hsyn-flex-Voltron (plasmid #), pAAV-hsyn-flex-Voltron-ST (plasmid #), pTo12-Huc-Voltron (plasmid #), pTo12-Huc-Voltron-ST (plasmid #), p10XUAS—IVS-Syn21-Voltron-p10 (plasmid #), and p13XLexAOP2-IVS-Syn21-Voltron-p10 (plasmid #) have been deposited at Addgene. AAV-hsyn-flex-Voltron-ST virus is available from Addgene (addgene.org).
(140) Transgenic Drosophila stocks for UAS-Voltron and LexAop-Voltron in multiple landing sites are available from the Bloomington Drosophila Stock Center (flystocks.bio.indiana.edu).
(141) UAS:Voltron transgenic zebrafish are available from the Ahrens Lab at Janelia Research Campus, and from ZIRC (zebrafish.org).
(142) Cloning: Generally, cloning was done by restriction enzyme digest or PCR amplification of plasmid backbones, PCR amplification of inserted genes, and isothermal assembly to combine them, followed by Sanger sequencing to verify DNA sequences. The genes for QuasAr1 and QuasAr2 (7) were amplified from Addgene plasmids 51629 and 51692. The gene for Ace2N was synthesized (Integrated DNA Technologies) with mammalian codon optimization (11). The soma localization tag was synthesized (Integrated DNA technologies) through adding a 66 amino acid domain from the Kv2.1 potassium channel (residues 536 to 600) (22). This domain directs localization to clusters at the soma and proximal dendrites (23). Linker length variants were generated by Quikchange site-directed mutagenesis (Agilent). For expression in primary neuron cultures, sensors were cloned into a pcDNA3.1-CAG plasmid (Invitrogen) at the NheI and HindIII sites. For expression in zebrafish, Voltron and Voltron-ST were cloned into the pTol2-HuC vector (for pan-neuronal expression) at the Agel restriction sites and into the pT2-Tbait-UAS vector (for Gal4-dependent expression) at the EcoRI and PspXI restriction sites. For expression in Drosophila melanogaster, Voltron was cloned into p10XUAS-IVS-Syn21-p10 at the XhoI and XbaI sites. For Cre-dependent expression in mouse brain, Voltron and Voltron-ST were cloned into a pAAV-hsyn-flex plasmid at the BamHI restriction sites. The DNA and amino acid sequences of Voltron and Voltron-ST are given in
(143) In Vitro Spectroscopy of Fluorophores:
(144) To create JFdye-HaloTag conjugates, 5 μM JFdye HaloTag ligand and 10 μM HaloTag protein were incubated in 10 mM HEPES with 0.1 mg/ml CHAPS at pH 7.3 at 4° C. overnight. Completeness of dye-binding was determined by titrating HaloTag protein (2.5 μM to 12.5 μM) with fluorogenic .sub.JF635 HaloTag ligand (5 μM) in overnight reactions and then measuring absorbance at 640 nm. Additionally, thin-layer chromatography was performed on a reaction of 5 μM .sub.JF549 with 7.5 μM HaloTag, which showed >95% of the dye was bound to HaloTag. Fluorescent proteins sfGFP (parent fluorophore of ASAP2f) and mNeonGreen (parent fluorophore of Ace2N-mNeon) were purified from E. coli. All photophysical measurements used either 1 μM solutions of JFdye-HaloTag conjugate in 10 mM HEPES buffer at pH 7.3, or 1-3 μM purified fluorescent proteins in 100 mM MOPS buffer at pH 7.2. Absorbance measurements were performed on a UV-VIS spectrometer (Lambda 35, Perkin Elmer). Fluorescence excitation and emission spectra were measured using a fluorimeter (LS55, Perkin Elmer). Quantum yield measurements were performed using an integrating-sphere spectrometer (Quantaurus, Hamamatsu). Extinction coefficients for the JFdye-HaloTag conjugates were determined from peak absorbance at known concentration of JF dye. Extinction coefficients for fluorescent proteins were determined by the alkali denaturation method, using the extinction coefficient of denatured FP equal to that of denatured GFP (ε=44000 at 447 nm) (29).
(145) Fluorescence Microscopy for Photobleaching:
(146) To investigate photobleaching of fluorophores in solution, aqueous droplets of JFdye-HaloTag conjugates or fluorescent proteins were made by aliquoting 5 μl of a fluorophore solution into 45 μl of 1-Octanol and agitating by tapping or brief vortexing. 5 μl of the emulsion mixture was sandwiched between a pre-silanized glass slide and a glass coverslip to disperse isolated microdroplets of dye-conjugates or proteins for fluorescence microscopy. To perform fluorescence microscopy, microdroplets were continuously illuminated using an inverted microscope (Eclipse Ti2, Nikon) with a 40× (N.A.=1.3, Nikon) oil immersion objective (PLAN Flour, Nikon). Fluorescence excitation was achieved using an LED (SpectraX Light engine, Lumencor) with the following filter sets for the respective fluorophores: For sfGFP, mNeonGreen and .sub.JF505 (FITC5050A cube (semrock): FF02-475/50, FF506-Dio3, FF01-540/50); for .sub.JF525 (510/25 excitation filter, T525lprx dichroic(Chroma), 545/40 emission filter); for .sub.JF549 (Cy34040C cube (semrock): FF01-531/40, FF562-Dio3, FF01-593/40); for .sub.JF585 (49912 cube (Chroma): ZET594/10×, ZT594rdc, ET610lp) and for .sub.JF635 (89000 cube (Chroma), ET645/30×, 89100bs, ET705/72m). Power at the imaging plane for each filter set was set to 12 mW determined with a microscope slide power sensor (S170C, Thorlabs). From measurement of the sample area illuminated, the irradiance was determined to be 40 mW/mm.sup.2. In order to calculate the excitation rate ! (photons absorbed/sec), the LED excitation spectrum was measured after the objective for each filter set using a fiber spectrometer (QE65000, Ocean Optics). Fluorescence images were collected using a scientific CMOS camera (ORCA-Flash 4.0, Hamamatsu) and image acquisition was performed using HCImage Live (Hamamtsu). Each sample was bleached continuously for 10 min. and images were acquired at 1 Hz. Fluorescence intensity from each droplet was obtained after background subtraction using ImageJ software.
(147) To investigate photobleaching of GEVIs in cells, Voltron, Ace2N-mNeon, and ASAP2f were transfected in hippocampal neurons extracted from P0 to P1 Sprague-Dawley rat pups. After transfection, hippocampal neurons were plated onto 35 mm glass-bottom dish (MatTek) coated with poly-D-lysine (Sigma) and cultured for 8-10 days in NbActiv4 medium (BrainBits). For labeling Voltron-expressing neurons, cells were incubated with a 100 nM JFdye-HaloTag ligand for 30 minutes. The same setup and procedure used with droplets above was used to measure photobleaching of GEVIs in cells.
(148) Photobleaching Analysis:
(149) The bleaching profile of individual cells or droplets was fit to either a single or double exponential function of the form F(t)=F.sub.0(A.sub.1e.sup.−t/τ1+A.sub.2e.sup.−t/τ2) to obtain time constants τ.sub.1, τ.sub.2 and weighting A.sub.1, A.sub.2. Data fitting was performed in MATLAB (MathWorks) and Origin (OriginLab), and goodness of fit assessed by minimal residual sum of errors or minimal x.sup.2. To quantify photobleaching across fluorophores requires knowledge of the excitation rate W and the fluorescence quantum yield ϕ.sub.f. The excitation rate W was computed (30) from integration over the wavelength dependence of the product of measured extinction coefficient and irradiance spectral profile. The fluorescence quantum yield for the GEVIs is not directly measured, and assumed to be the same as that measured for the parent fluorophores. Three quantities characterizing bleaching were calculated for each fluorophore or GEVI. These are (i) the calculated time t.sub.1/2 for the fluorescence rate to drop to ½ its initial value, scaled by the excitation rate to achieve an initial fluorescence rate of 10.sup.3 photons/sec (30), (ii) the total number of photons emitted before photobleaching N.sub.p (the photon budget), and (iii) the photobleaching probability P.sub.b. These are per-molecule quantities averaged over the ensemble of molecules in each droplet or cell. The characteristic time t.sub.1/2 was found by determining from the raw data, the time tin, for 50% reduction in fluorescence F(t.sub.raw)/F.sub.0=0.5, from which
(150)
where ϕ.sub.f is the fluorescence quantum yield and W is the excitation rate. To determine N.sub.p, the fit function F(t) was integrated over time, where initially F.sub.0≡ϕ.sub.fW,
N.sub.p=ϕ.sub.fW(A.sub.1τ.sub.1+A.sub.2τ.sub.2)=ϕ.sub.fWτ.sub.b
where <τ.sub.b> is the amplitude-weighted lifetime (31, 32) τ.sub.b
=A.sub.1τ.sub.1+A.sub.2τ.sub.2. The photobleaching probability Pb, based on rate equation models where bleaching proceeds from singlet or triplet states, is inversely related to the total number of fluorescent photons emitted, N.sub.p=ϕ.sub.f/P.sub.b (33, 34), or
P.sub.b=1/Wτ.sub.b
Of the three photobleaching quantities above, the photobleaching probability is most rigorous as it is independent of the fluorescence quantum yield.
(151) Single-Molecule Imaging and Analysis:
(152) Hippocampal neurons extracted from PO to 1 Sprague-Dawley rat pups were transfected with Ace2N-mNeon and Voltron plasmids by electroporation (Lonza, P3 Primary Cell 4D-Nucleofector X kit) according to the manufacturer's instruction. After transfection, hippocampal neurons were plated onto 25 mm ultra-clean cover glasses coated with poly-D-lysine (Sigma) and cultured for 9 days in NbActiv4 medium (BrainBits).
(153) To label Voltron-expressing neurons, cultures were incubated with 2 nM JF549 HaloTag ligand for 15 mins, then transferred to the Attofluor cell chamber (Thermo Fisher Scientific) and supplemented with Tyrode's solution (140 mM NaCI, 5 mM KCI, 3 mM CaCl.sub.2, 1 mM MgCl.sub.2, 10 mM HEPES, 10 mM glucose, pH 7.35). Single-molecule imaging was performed on a Nikon Eclipse TiE Motorized Inverted microscope equipped with a 100× oil-immersion objective lens (N.A.=1.49, Nikon), 488/561 nm laser lines, an automatic TIRF illuminator, a perfect focusing system and a Tokai Hit environmental control (humidity, 37° C., 5% CO.sub.2). Excitation light was passed through a 405/488/561/647 nm laser quad band filter set filter that allows 488 nm or 561 nm light through to the sample (Chroma set number 89902). Emission from sample was collected through the same filter set then passed through a splitter (dichroic mirror: T560Ipxr (Chroma), with perpendicular emission filters: ET525/50m (Chroma) and ET605/52m (Chroma)) to split green and red fluorescence. The light was then collected onto two EMCCD cameras (iXon Ultra 897, Andor).
(154) Samples were first pre-bleached to achieve sparse single molecule detections. The laser power output was calibrated for 488 nm (to image Ace2N-mNeon) and 561 nm (to image Voltron549) to 17.5 mW with a Si Sensor power meter (Thorlabs, PM202). Images were acquired under TIRF imaging mode with 10 Hz frame rate. 1000 frames were recorded for each imaging area and 10 imaging areas were collected for each indicator. For image analysis, single molecules lasting for at least 3 frames were manually selected. The brightness and mean time to photobleach of these molecules were determined with ImageJ (1.51n) quantification tools to assess the single-molecule photo-stability of Ace2N-mNeon and Voltron549.
(155) Fluorescence Imaging in Primary Neuron Culture:
(156) All culture imaging was performed in imaging buffer containing the following (in mM): 145 NaCl, 2.5 KCl, 10 glucose, 10 HEPES, pH 7.4, 2 CaCl2, 1 MgCl2. Wide-field imaging was performed on an inverted Nikon Eclipse Ti2 microscope equipped with a SPECTRA X light engine (Lumencore), 40× oil objective (NA=1.3, Nikon), and imaged onto a scientific CMOS camera (Hamamatsu ORCA-Flash 4.0). A FITC filter set (475/50 nm (excitation), 540/50 nm (emission), and a 506LP dichroic mirror (FITC-5050A-000; Semrock)) was used to image mNeonGreen, ASAP1, and ASAP2f. A Cy3 filter set (531/40 nm (excitation), 593/40 nm (emission), and a 562LP dichroic mirror (Cy3-4040C-000; Semrock)) was used to image Volton549. A custom filter set (510/25 nm (excitation), 545/40 nm (emission), and a 525LP dichroic mirror (Semrock)) was used to image Voltron525. A quad bandpass filter (set number: 89000, Chroma) was used along with the appropriate color band from the SPECTRA X light source to image Voltron505, Voltron585 and Voltron635. For time-lapse imaging during field stimulation or simultaneous electrophysiology measurements, neurons were imaged at 200-3200 Hz depending on the experiment. The LED light power output at the imaging plane was measured with a Si Sensor power meter (Thorlabs, PM202) for each imaging experiment.
(157) For quantifying brightness of voltage indicators expressed in neurons, the excitation spectrum was measured after the objective for each excitation filter used using a spectrometer (QE65000, Ocean Optics). The spectrum was then integrated to get the excitation rate ! as described above (see section: Photobleaching analysis). As with the photobleaching experiments, when the data sets for the light spectrum and extinction coefficient are taken at incommensurate wavelengths, interpolation was used to re-cast the wavelengths of one of the data sets using MATLAB (MathWorks). The fraction of collected fluorescence using the emission filter compared to the total emission spectrum of the fluorophore was calculated. Illumination intensity of 20 mW/mm.sup.2 at imaging plane was used for all indicators. Fluorescence images were acquired from five independent transfections for each construct for brightness measurements. Using MATLAB (MathWorks), fluorescence intensity was then corrected using the calculated excitation rates (!), fraction of emission collected, and quantum efficiency of the Hamamatsu ORCA-Flash 4.0 camera over the emitted wavelengths for ASAP2f, Ace2N-mNeon, Voltron525 and Voltron549. Values were calculated relative to ASAP2f.
(158) Simultaneous Field Stimulation and Fluorescence Imaging in Primary Neuron Cultures:
(159) A stimulus isolator (A385, World Precision Instruments) with platinum wires was used to deliver field stimuli (50V, 83 Hz, 1 ms) to elicit action potentials in cultured neurons as described previously (35). The stimulation was controlled using an Arduino board and timing was synchronized with fluorescence acquisition using the Nikon Elements software and a national instruments PXI-6723 board.
(160) Simultaneous Electrophysiology and Fluorescence Imaging in Primary Neuron Culture:
(161) All imaging and electrophysiology measurements were performed in imaging buffer (see “Fluorescence imaging in primary neuron culture” section) adjusted to 310 mOsm with sucrose. For voltage clamp measurements, 500 nM TTX was added to the imaging buffer to block sodium channels. Synaptic blockers (10 μM CNQX, 10 μM CPP, 10 μM GABAZINE, and 1 mM MCPG) were added to block ionotropic glutamate, GABA, and metabotropic glutamate receptors (35).
(162) Filamented glass micropipettes (Sutter Instruments) were pulled to a tip resistance of 4-6 MΩ. Internal solution for current clamp recordings contained the following (in mM): 130 potassium methanesulfonate, 10 HEPES, 5 NaCl, 1 MgCl2, 1 Mg-ATP, 0.4 Na-GTP, 14 Tris-phosphocreatine, adjusted to pH 7.3 with KOH, and adjusted to 300 mOsm with sucrose. Internal solution for voltage clamp recordings contained the following (in mM): 115 cesium methanesulfonate, 10 HEPES, 5 NaF, 10 EGTA, 15 CsCl, 3.5 Mg-ATP, 3 QX-314, adjusted to pH 7.3 with CsOH, and adjusted to 300 mOsm with sucrose.
(163) Pipettes were positioned with a MPC200 manipulator (Sutter Instruments). Whole cell voltage clamp and current clamp recordings were acquired using an EPC800 amplifier (HEKA), filtered at 10 kHz with the internal Bessel filter, and digitized using a National Instruments PCIe-6353 acquisition board at 20 kHz. Data were acquired from cells with access resistance <25 MΩ. WaveSurfer software was used to generate the various analog and digital waveforms to control the amplifier, camera, light source, and record voltage and current traces. For fluorescence voltage curves, cells were held at a potential of −70 mV at the start of each step and then 1 second voltage steps were applied to step the potential from −110 mV to +50 mV in 20 mV increments. For current-clamp recordings to generate action potentials, current was injected (20-200 pA for 1-2 s) and voltage was monitored.
(164) Imaging Parvalbumin (PV) Neurons in Mouse Hippocampus:
(165) Hippocampal PV neuron imaging was performed using adult PV-Cre mice (JAX 008069). Imaging window was implanted using procedures similar to those described in Dombeck et. al. (36). In short, a circular craniotomy (3 mm diameter) was made centered at 2.0 mm caudal and 2.0 mm lateral to bregma. The surface of CA1 was exposed by gently removing the overlying cortex with aspiration. AAV2/1-syn-Flex-Voltron-ST virus was diluted to 1.9×10.sup.12 GC/ml and injected at three locations (separated by 800 μm, 30 nl per location) 200 μm from CA1 surface. The imaging window (constructed by gluing a 3 mm diameter cover glass to a stainless steel cannula of 3 mm diameter and 1.5 mm height) was placed onto the hippocampus and glued to the skull using super-bond C&B (Sun Medical). A titanium head bar was glued to the skull for head fixation during imaging.
(166) Imaging experiments started 4-5 weeks after surgery. JF525-HaloTag ligand (100 μl, 1 mM) was delivered using retro-orbital injection (37) 1 day before imaging. Labeled PV neurons (25-195 μm deep) were illuminated using a green LED (M530L3, Thorlabs) through an excitation filter (FF02-520-28, Semrock). A field aperture (diameter ˜1 mm) was used to limit illumination to a circular area (˜160 μm diameter at sample) around the cell of interest. The excitation intensity was ˜25 mW/mm.sup.2 at the sample plane. JF525 fluorescence was collected using a 16×0.8 NA objective (Nikon), separated from excitation light using a dichroic mirror (540lpxr, Chroma) and an emission filter (FF01-575-59, Semrock), and imaged onto a sCMOS camera (Zyla 4.2 plus, Andor). Images were collected at 3858 Hz.
(167) Image analysis was performed in MATLAB. Brain movement was corrected using ImageJ plugin TurboReg (38). A constant camera offset (measured by taking images without illumination) was subtracted from each frame. The fluorescence of each cell was measured by averaging pixels within a region of interest covering the cell body. To detect action potentials (AP), slow baseline fluctuation (measured by moving average with 20 ms window) was first subtracted from the raw fluorescence trace. The timings of AP events were detected as local minima of the baseline subtracted trace with amplitudes larger than four times the standard deviation and peaks separated by at least 5 ms from each other. To quantify AP waveform, 5 ms segments of fluorescence signal around the detected peaks were taken from the raw fluorescence trace, peak aligned and then averaged. The AP amplitude was measured as percent change (F-F0)/F0 with F0 being the fluorescence baseline averaged over a time window 2.5 ms to 1.5 ms before the peak of an individual AP. The rise time, decay time, and the width of the AP waveform was measured using the averaged trace for each cell. The rise time was the time from half the amplitude to the peak. The decay time was the time from the peak to half the amplitude in the decay phase. The width (full width at half maxima, FWHM) was the sum of rise and decay time. This is shown in
(168) Imaging Mouse Cortex:
(169) NDNF-Cre mice (JAX 28536) were used for imaging Layer 1 neurons (2 females, 1 male; 100-120 days old at the time of the window surgery). C57BI/6NCrl (Charles River Laboratories) mice were used for imaging Layer 2/3 neurons (2 females; 100-120 days old). NDNF-Cre mice were injected with 30 nl of AAV2/1-syn-FLEX-Voltron-ST (titer, 2*10.sup.12 GC/ml) at 8-12 injection sites 200 μm deep (injection rate, 1 nl/s). C57BI/6NCrl mice were injected with 30 nl mixture of AAV2/1-syn-FLEX-Voltron-ST (titer, 2*10.sup.12 GC/ml) and AAV9-CamKIIa-Cre (titer, 10.sup.8 GC/ml) 250 μm deep. AAV2/1-syn-FLEX-Voltron without soma targeting signal was injected in additional NDNF-Cre mice (titer, 2*1012 GC/ml)) and C57BI/6NCrl mice (AAV2/1-syn-FLEX-Voltron (titer, 2*10.sup.12 gc/ml)+AAV9-CamKIIa-Cre (titer, 10.sup.8 gc/ml)). This resulted in diffuse fluorescence and was not used for imaging experiments shown in this manuscript.
(170) Cranial windows (4 mm diameter) were implanted over the injection sites in visual cortex (centered on −2.5 mm lateral, +0.5 mm anterior from lambda). Four to nine weeks later JF525 dye was injected into the retro-orbital sinus. Imaging was done 2 to 6 days after dye injection, with subsequent dye injections and imaging 1 to 6 weeks after the first imaging session. To prepare the JF dye for injection, 100 nanomoles of lyophilized JF525 were dissolved in 20 μl of DMSO, 20 μl Pluronic F-127 (20% w/v in DMSO), and 60-80 μl of PBS (final dye concentration 1 μM). Mice were anesthetized with 2-3% isoflurane and 100 μl of the dye solution was injected into the retro-orbital sinus of the right eye using a 27-30 gauge needle (37).
(171) For imaging experiments of Layer 1 neurons, a wide-field fluorescence microscope equipped with a water immersion objective (20×, NA 1.0, Olympus XLUMPLFLN) was used for imaging. Illumination was delivered using a 525 nm LED (Mightex, LCS-0525-60-22); intensity at the sample, <20 mW/mm.sup.2. An mKO/mOrange filter set (530/30 nm (excitation), 575/40 nm (emission), and a 550LP dichroic mirror (Chroma, 49014)) was used for fluorescence imaging of Voltron525. Images were collected using a sCMOS camera (Hamamatsu Orca Flash 4.0 v3) at frame rates of 400-1000 Hz. A 0.55× magnification camera tube was placed between the objective and the camera for imaging large fields of view of 1064 μm×266 μm (
(172) To image Layer 2/3 pyramidal cells, the following changes were made from the imaging protocol for Layer 1 interneurons: Images were recorded at frame rate of 500-700 Hz. Illumination intensity at the sample was <50 mW/mm.sup.2. 1× camera tube was used and the field of view imaged was typically 50 μm×50 μm. The pixel size was 1.04 μm. A digital mirror device (Texas Instruments, LightCrafter) restricted the illumination to the cell being imaged. Mice were imaged while lightly anesthetized and passively viewing drifting gratings (described below).
(173) Visual Stimulation for Pyramidal Cell Recordings:
(174) Mice were presented with drifting grating visual stimuli during imaging sessions (spatial frequency: 0.03 cycles/degree, temporal frequency: 1 Hz, trial period: 1 s, and inter-trial interval: 1 s). Gratings were shown in blue with a black background. During the inter-trial interval, the screen was black. Eight orientations separated by 45° were presented. Mice were anesthetized during all sessions. To induce anesthesia, chlorprothixene (0.2 mg/ml, 5 ul/g weight mouse) was injected into the hind paw followed by keeping the mouse in a chamber with 2-3% isoflurane for 1-2 minutes. Anesthesia was maintained at 0.4-0.8% isoflurane for the duration of the imaging session. Mice were kept on a heating blanket at a temperature of 37°.
(175) Analysis of Layer 2/3 Pyramidal Cell Imaging:
(176) Motion was removed using a rigid registration algorithm. A constant camera offset was subtracted from each frame. A region of interest (ROI) was manually drawn around the neuron. The initial trace (X0) is the mean intensity over the ROI in time. X0 was fit with a piecewise linear curve using a Savitzky-Golay filter with a window size of 10 s to estimate the slow baseline fluctuations, F0. ΔF/F was calculated as
(177)
Spike times were manually selected as large amplitude local minima in the ΔF/F trace occurring in periods of depolarization and separated from other local minima by at least 2 ms.
(178) Visual responses (
(179) The orientation selectivity index (
(R.sub.pref−R.sub.orth)/(|R.sub.pref|+|R.sub.orth|)
where R.sub.pref is the response (mean spikes in trial or mean subthreshold membrane potential) to the preferred orientation, and R.sub.orth is the response to the orientation 90° away from the preferred orientation.
(180) Analysis of Layer 1 Interneuron Imaging:
(181) To identify neuronal activity and spatial structure from Voltron recordings, an iterative spatial and temporal filtering approach was designed and called: Spike Pursuit. In essence, Spike Pursuit begins with a poorly estimated voltage trace for a neuron, and uses detected spikes to iteratively estimate improved temporal and spatial filters that increase the signal to noise ratio of the spikes while controlling for overfitting. Spike pursuit relies on linear methods (the whitened matched filter for temporal filtering, and regularized linear regression for spatial filtering) (39).
(182) Motion was removed using Fast Fourier transform-based rigid registration in MATLAB. Initial ROIs were manually drawn around each neuron in the field of view. Data was processed in chunks of N=40,000 frames. The same initial ROIs were used for each chunk. For each neuron in each chunk, a region of 50×50 pixels centered on the neuron (the ‘context region’, C) was selected for further processing (
(183) The initial temporal trace X.sub.0(t) was the mean of the 0.33 Hz high-pass filtered video over the pixels in the ROI (R):
(184)
where H denotes the set of pixels in the ROI, n(R) is the number of pixels in the ROI. X.sub.0 and the high-pass filtered videos D.sub.N×T and D.sub.N×T.sup.h were provided as input to the Spike Pursuit algorithm, which consisted of a two-step loop for each iteration (i):
(185) Step 1: Spike Time Estimation
(186) To detect spikes in the initial trace, contributions were subtracted from local background. This is intended to reduce the chance of optical crosstalk producing a false spike detection due to an adjacent neuron overlapping the initial ROI, and was not performed when computing the final trace with the optimized spatial filter. The ‘local background’ (B) was defined as the all pixels in the context region more than 12 pixels away from any pixel in the ROI, with M=n(B) pixels. The SVD (singular value decomposition) of the background movie was computed D.sub.M×T.sup.b:
D.sub.M×T.sup.b=U.sub.M×MΣ.sub.M×TV.sub.T×T.sup.*
(187) Multiple linear regression of the trace X.sub.i-1 was performed against the top eight background principal components:
b.sub.i=(V.sub.8*V.sub.8).sup.−1V.sub.8*X.sub.i-1
where V.sub.8 is the first eight columns of V; b.sub.i are the regression coefficients. The trace X.sub.i-1(t) was denoised by subtracting the contribution of background pixels:
X.sub.i.sup.1=X.sub.i-1−V.sub.8b.sub.i
X.sub.i.sup.1(t) was high-pass filtered at 60 Hz using a third order Butterworth filter. Local minima in the filtered trace below a threshold s.sub.i were selected as an initial estimate of spike times. The threshold was chosen as follows: the distribution of local minima P.sub.min,i(x) was calculated by kernel density estimation and its median μ was computed. The distribution of the noise P.sub.noise,i(x) was estimated by symmetrizing about the median; i.e. setting.
(188)
(189) The distribution of spikes P.sub.spike was estimated as:(x):=max(0,P.sub.min,i(x)−
(x))
(190) The threshold was selected as:
(191)
Thus, the initial estimate of spike times was
S.sub.i={t|X.sub.i.sup.1(t)<s.sub.i,X.sub.i.sup.1(t)>X.sub.i.sup.1(t+1),
X.sub.i.sup.1(t)<X.sub.i.sup.1(t−1)}.
(192) This approach assumes that spikes only occur in a small proportion of time points, that P.sub.noise(x) is symmetric about p in the absence of spikes, that local minima are uncorrelated to the voltage trace in the absence of spikes, and that no spikes produce local minima larger than ρ. These assumptions are only approximately satisfied, but results of this method agree well with manual threshold selection.
(193) Following the first round of spike detection, an action potential template Z.sub.i(r) was generated as:
(194)
The template Z.sub.i(τ) was used to perform a whitened matched filter (39) on X.sub.i.sup.1(t), producing the temporally filtered trace X.sub.i.sup.f(t). X.sub.i.sup.f(t) was again adaptively thresholded to obtain the estimated spike times S.sub.i.sup.f for iteration i, and regenerate the action potential template, Z.sub.i.sup.f(τ).
(195) Step 2: Spatial Filter Estimation
(196) A target trace {circumflex over (X)}.sub.t(t) was produced by convolving the action potential template with the spike time indicator function:
(197)
A spatial filter wiN×(was estimated by ridge regression of the target trace {circumflex over (X)}.sub.t against D.sub.N×T.sup.h (
w.sub.i=(D.sup.h*D.sup.h+λ(∥D.sup.h∥.sub.F.sup.2)I).sup.−1D.sup.h*{circumflex over (X)}.sub.t
Where ∥D.sup.h∥.sub.F is the Frobenius norm of the high pass filtered data. The regularization parameter λ was selected by cross-validation on one dataset, and fixed for the remaining datasets. The activity trace corresponding to the spatial filter was calculated:
X.sub.i=Dw.sub.i
The Spike Pursuit loop was performed for five iterations. As a final step, the contribution of pixels was removed from a ‘global background’ (G), defined as the entire field of view excluding all pixels less than 12 pixels away from any ROI, with L=n(G) pixels. The SVD of the global background movie was high pass filtered at 0.3 Hz, D.sub.L×T.sup.g:
D.sub.L×T.sup.g=U.sub.L×L.sup.gΣ.sub.L×T.sup.gV.sub.T×T.sup.g*
(198) Multiple linear regression of the trace X.sub.5 was performed against the top 8 principal components of the global background movie:
b.sub.g=(V.sub.8.sup.g*V.sub.8.sup.g).sup.−1V.sub.8.sup.g*X.sub.5
X.sub.final=X.sub.5−V.sub.8.sup.gb.sub.g
Global background subtraction removes fluorescence fluctuations that are shared across most pixels of the movie. It remains unclear to what degree these fluctuations reflect shared membrane potential transients versus other sources of shared variability. Traces without global background subtraction (X.sub.5) are shown in
(199) Calculating Spike Triggered Averages for Layer 1 Interneurons:
(200) For each pair of neurons (p, q) the spike triggered average from neuron p to neuron q was calculated as:
(201)
To calculate the shuffled distribution of spike triggered averages, each spike time was shifted by a random amount ranging from 2 s to 4 s (minimum of 2 s chosen based on the typical autocorrelation function of the fluorescence traces). The spike triggered average of each pair was normalized by the standard deviation of the distribution of shuffled spike triggered averages (gray bar in
(202) Similar results (not shown) were obtained for the spike triggered averages using raw fluorescence traces, calculated as:
(203)
(204) Transgenic Zebrafish:
(205) Transgenic zebrafish which expresses Voltron under UAS promoter were generated as follows. A sequence of Voltron (Ace2-HaloTag) was cloned downstream of a 10×UAS sequence and the E1B minimal promoter (40). This plasmid was injected into 2-cell stage embryos of Casper mutant zebrafish (41) with mRNA of Tol2 transposase (42) to generate founder (F0) transgenic zebrafish.
(206) Transgenic zebrafish which expresses Voltron under elavl3 promoter for
(207) Experiments described in
(208) Preparation for Zebrafish Imaging Experiments:
(209) Imaging experiments were performed using 5- or 6-day larval zebrafish. The zebrafish was immobilized and mounted to an imaging chamber as described previously (44) with minor modifications. Briefly, the zebrafish were habituated in an artificial cerebrospinal fluid (ACSF) [in mM: 120 NaCl, 2.9 KCl, 2.1 CaCl2, 1.2 MgCl2, 20 NaHCO.sub.3, 1.25 NaHPO4, 10 Glucose] bubbled with carbogen gas (95% oxygen, 5% carbon dioxide) for 30 minutes. The muscle of the zebrafish was paralyzed by a short (up to 30 seconds) bath incubation with alpha-bungarotoxin (1 mg/ml, Thermo Fischer Scientific, B1601) dissolved in external solution. After the fish became immobile, heart movement of the zebrafish was stopped by microforceps to prevent the shadowing effect of blood cells in the brain during imaging experiments. The zebrafish showed robust optomotor behavior in ACSF (bubbled with carbogen gas for 30 minutes before the experiment) for several hours after this treatment. The zebrafish was further mounted to a custom-made chamber using 2% agarose (Sigma-Aldrich, A9414) and placed under a light-sheet microscope (45) with a 20× objective lens (Olympus, XLUMPLFLN).
(210) Light-sheet imaging of zebrafish Voltron signals: Imaging was performed in a light-sheet microscope according to a published design (46) with modifications targeted at optimizing Voltron imaging. To increase the fraction of time the imaged cells were exposed to the excitation laser beam, the beam was expanded in the horizontal dimension using a pair of cylindrical lens (LJ1878L1-A (f=10 mm) and LJ1402L1-A (f=40 mm), Thorlabs). Imaging was performed using a 488 nm excitation laser (80 μW) and a 562/40 emission filter (Semrock, FF01-562/40) and with a frame rate of 300 frames/second recorded by a sCMOS camera (Hamamatsu, ORCA Flash4.0 v2). In this setup, the pixel dimension on the camera was 0.293 μm/pixel and the imaged neurons occupied an area of 150-200 pixels on the image.
(211) Simultaneous Cell-Attached Extracellular Recordings and Voltage Imaging in Zebrafish:
(212) Electrophysiology and imaging of neurons expressing Voltron in Tg(vglut2:Gal4); Tg(UAS: Voltron) transgenic zebrafish were simultaneously performed as described previously (44) with a minor modification. Fire-polished borosilicate glass pipettes (Sutter, BF150-75-7.5) were pulled using a heat puller (Sutter, P1000). The tip of the pipette was further coated by quantum dots (Ocean Nanotech, QSR-600) using a previously reported method (47). The pipette resistance after the quantum dot coating was 10-12 MΩ.
(213) The fish was bathed in an external solution and a small incision on the top of the head was made using a sharp glass needle. The pipette was filled with an external solution and inserted into the cerebellum of the brain using a micromanipulator (Sutter, MPC-200), and extracellular spiking signals were recorded from vGlut2-positive neurons in the dorsal part of the cerebellum using cell-attached extracellular recordings. These neurons are assumed to be eurydendroid neurons in the cerebellum, homologues of neurons in the deep cerebellar nuclei in mammalian brains (48), based on their previously described anatomical locations (49) and their expression of the vglut2 gene (49). Signals from the pipette were amplified by an amplifier (Molecular Devices, AxoClamp 700B) and recorded by custom software written in C # (Microsoft) at 6 KHz. Optical signals from the same neurons were simultaneously imaged as described above.
(214) Behavioral experiments in zebrafish: Recording of fictive swim signals and presentation of visual stimuli were performed as described previously (44, 45). To record swim signals from the axonal bundles of spinal motoneurons in the tail, a pair of large barrel electrodes was attached to the dorsal left and right side of the tail. Signals were amplified by an amplifier (Molecular Devices, AxoClamp 700B) and recorded at 6 KHz using custom software written in C # (Microsoft). For synchronization between the swimming signals and neural activity imaging, camera trigger signals that initiate the acquisition of individual frames in the light-sheet microscope were recorded simultaneously with the swim signals. During the experiments, red visual stimuli (red/black gratings with bars 2 mm thick) was projected to the bottom of the fish chamber. The speed of the moving the visual stimulus alternated between 0 mm/s (stopped) and 2 mm/s (moving forward) every 10 seconds. Every trial (20 seconds) contained a stop period and a forward-motion period. In a subset of tested fish, the forward moving speed was changed from 2 mm/s to 0.5 mm/s every other trial. Swimming behavior was continuously recorded for a duration ranging from 6 minutes to 12 minutes (18 to 36 trials).
(215) Signals from the electrodes were processed and individual swim events were detected according to a method described previously (44). Briefly, the raw signals were high-pass filtered, squared and smoothed by applying a Gaussian filter (σ=3.3 milliseconds). The resulting traces were defined to be the swim signal, as shown in
(216) Analysis of Imaging Dataset:
(217) The flow of the data processing is described below and in
(218) Step 1. Image Registration
(219) Sequences of recorded images were corrected for horizontal drift during the imaging session at the subpixel level with a phase correlation algorithm (51) using a custom Python script and a GPU computing board.
(220) Step 2. Segmentation of Neurons
(221) Individual neurons in the imaging field were segmented in a semi-automatic way. This was done using a combination of cell recognition by a pre-trained convolutional neural network build with the Python Keras library (keras.io/) and manual correction. This convolutional network discriminates whether a locally darkest point in a circular patch (radius=2.67 μm) is a center of a Voltron-expressing neuron or not. Once the cells are segmented, ring-shaped masks are drawn automatically over the cells (1.sup.st pixel weights in
(222) Step 3. Optimization of Pixel Weights for Individual Neurons
(223) Weights on the pixels of the above masks were optimized to maximize the signal-to-noise ratio of the voltage signals in individual neurons (
(224)
where W is a matrix of weights over pixels, Var(F) is a variance of a weighted mean fluorescence time-series of candidate pixels using W, E(Fs) is the average of the weighted mean fluorescent values at the time of detected spikes, and ∥W∥∥.sup.2 is the L.sup.2 norm of the pixel weights for regularization. This objective function measures the ratio between the mean heights of the spikes and the noise level of the estimated fluorescence time-series of a cell. Pixel weights W are optimized so that they maximize the objective function J using a gradient ascent method. Spiking events used for this optimization are detected using the fluorescence time series of the 1.sup.st pixel weights using the same algorithm as described below. The final fluorescence time series is obtained by (1) calculating the weighted average of fluorescence values across pixels using the optimized W, (2) subtracting the camera background (i.e., the pixel value when the camera records dark images), and (3) normalizing the resulting time-series by dividing by its baseline time-series, which is a rolling percentile (80% [since Voltron becomes dimmer with increasing voltage, an upper percentile was used instead of a lower percentile used for calcium imaging data], 500-ms time window) of the time-series.
(225) Step 4. Spike Detection
(226) Lastly, spiking events were detected for individual neurons using an iterative method that first estimates the subthreshold potential and subtracts it from the raw voltage trace, and secondly estimates spiking events on the resulting trace. These three steps were iterated three times:
(227) 1. The subthreshold potential was obtained by subtracting the current estimate of the voltage trace attributable to spikes (i.e. the convolution of the estimated spike train s with spike shape k, s*k) from the raw trace followed by low pass filtering to remove the noise. Using a simple Butterworth filter of order 5 with a cutoff at 10 Hz was effective. Subtracting the subthreshold potential yielded the high-frequency component y that consists of voltage transients due to spikes corrupted by noise.
2. Spiking events were detected using a method based on adaptive template matching. First, large spiking events were detected using a high threshold (3.5*rolling standard deviation+rolling median, window size of 3 seconds) to avoid false positives. The neuron's spike shape was constrained to have non-zero values only in a small window around the time of a spike and was calculated using linear regression of y on s.
3. The less clear spike events were detected using this mean spike shape k as a template instead of merely relying on a threshold. Potential spike candidates were detected using a low threshold (2.5*rolling standard deviation+rolling median) to avoid false negatives. Template matching by regressing y on k yielded the sizes of these candidate events. The candidates that were not actual spikes but were merely due to noise had a small size and were iteratively removed with the regression being repeated. After the three outer iterations a reasonable estimate of the spike shape k and the spike times were obtained at frame-rate resolution.
(228) Step 5. Validation of the Authenticity of the Detected Spikes
(229) To minimize the false-positive detection rate of spiking events, the authenticity of the spike shapes were measured throughout the time-series by measuring the gradient of the voltage trace just before the estimated spiking events. This is based on an assumption that spiking events are always preceded with an increase of subthreshold membrane voltage and that non-spike high-frequency noise does not have this preceding component. The gradient of voltage signals from 10 milliseconds to 3.3 milliseconds (3 time points) before the spiking events were quantified for individual spikes. Detected spiking events were binned into contiguous blocks of 50 spiking events. The gradient values for each block of spiking events were tested for its deviation from zero using a Wilcoxon signed rank test. Spiking events in blocks that had significantly positive gradients (p<0.05) are used for subsequent analysis.
(230) Analysis of the Relationships Between Neural Activity and Behavior:
(231) Neurons that were used for analysis in
(232) Mean subthreshold signals and firing rates on
(233) For classifying neurons in
(234) Widefield Imaging of Voltron Expressing Neurons in Zebrafish:
(235) Mitfa.sup.w2/w2 roy.sup.a9/a9 (Casper) zebrafish were maintained under standard conditions at 28° C. and a 14:10 hr light:dark cycle. Embryos (1-2 cell stage) of Tg(elavl3:Gal4-VP16) were injected with 25 ng/μl DNA plasmid encoding the Voltron-ST indicator under the control of the 10×UAS promoter, and 25 ng/μl Tol2 transposase mRNA diluted in E3 medium.
(236) Subsequently, the injected embryos at three day post-fertilization (dpf) were incubated in system water containing JF dye-HaloTag ligands (JF.sub.525, JF.sub.549, JF.sub.585 or JF.sub.635) at 3 μM for 2 hours and then washed in dye-free system water. Larvae at 5 or 6 dpf were screened for the expression of the Voltron-ST based on the fluorescence from JF dye-HaloTag ligands. They were paralyzed by 5-min bath application of 1 mg/ml a-bungarotoxin (Sigma, 203980) and mounted dorsal-side up with 1.5% low-melting point agarose. Spontaneously active forebrain and olfactory neurons were imaged using a custom widefield microscope. The objective was a 60× 1.0 NA water immersion lens (Nikon, MRD07620). Fluorophores were excited with a LED light source (Luminus, CBT-90-W for JF.sub.525, JF.sub.549 and JF.sub.585, Luminus, CBT-90-RX for JF.sub.635) with a proper filter set (Semrock, FITC-A-Basic-000 for JF.sub.525; Semrock, Cy3-4040C-000 for .sub.JF549; Semrock, LED-mCherry-A-000 for JF.sub.585; Semrock, LF635-C-000 for JF.sub.635). The images were acquired with sCMOS camera (PCO, pco.edge 4.2) at 400 Hz (2.5 ms exposure time) for 1-2 min. Data were analyzed using MATLAB (Mathworks). Regions of interest (ROIs) corresponding to identifiable cell bodies were selected manually and the mean signal from each ROI was extracted. The baseline was estimated by fitting the raw fluorescence time course with an exponential curve to account for bleaching. The estimated baseline was used to calculate the ΔF/F.sub.0.
(237) Simultaneous Whole-Cell Recording and Voltron Imaging in Zebrafish:
(238) Experiments were performed on 6-day old progeny of a cross between Tg(10×UAS:Voltron) and TgBAC(slc17ab:LOXP-mCherry-LOXP-GAL4FF;vsx2:Cre). Fish were loaded with JF525 and then paralyzed as described above. After anesthetizing fish with MS-222, they were head-fixed and prepared for whole-cell recording and imaging of V2a hindbrain neurons. They were secured to a Sylgard-coated glass-bottom dish containing extracellular solution (134 mM NaCl, 2.9 mM KCl, 1.2 mM MgCl2, 2.1 mM CaCl.sub.2), 10 mM HEPES, and 10 mM glucose, adjusted to pH 7.8 with NaOH) with etched tungsten wires through the notochord. Then the head was rotated and secured ventral side up with etched tungsten pins placed through the ears and the rostral part of the jaw. The ventral surface of the hindbrain was carefully exposed by removing the notochord using an etched tungsten pin and fine forceps. Whole-cell recordings were guided based on fluorescence image and scanned Dodt gradient contrast image acquired with a custom two-photon microscope equipped with 40× 0.8 NA objective lens (Nikon, MRD07420). Borosilicate glass pipettes (Sutter, BF150-86-15) were pulled by a micropipette puller (Sutter, P-1000) and filled with intracellular solution (125 mM potassium gluconate, 2.5 mM MgCl2, 10 mM EGTA, 10 mM HEPES and 4 mM ATP-Na.sub.2 adjusted to pH 7.3 with KOH). The resistance of the pipette was 5 to 7 MOhm. Recordings were made using the EPC 10 Quadro amplifier and PatchMaster (HEKA instruments). Voltron signal was acquired as described above but with 40× objective lens. After extracting Voltron signal from the patched cell using the procedure described above, the signal was further denoised using wden function in Wavelet Toolbox in MATLAB (Mathworks) to reveal Voltron signal corresponding to small subthreshold voltage changes.
(239) Simultaneous Voltron Imaging and Whole-Cell Patch Clamp in Live Adult Flies:
(240) Experiments were performed on 2- to 10-day-old heterozygous progeny of a cross between UAS-IVS-syn21-Voltron-p10 and MB058B-Gal4 (52). The cross was kept on standard cornmeal food supplemented with all-trans-retinal (0.2 mM before eclosion and then 0.4 mM). Flies were head-fixed and prepared for imaging and electrophysiology as described previously (53). A small window was opened on the head cuticle, and fat cells and trachea that overlaid the target region were removed. The exposed brain was bathed in a drop (˜200 μL) of dye-containing saline (1 μM for JF.sub.549 and 5 μM for JF.sub.525) for 1 hr. Saline contains (in mM): NaCl, 103; KCl, 3; CaCl.sub.2, 1.5; MgCl.sub.2, 4; NaHCO.sub.3, 26; N-tris(hydroxymethyl) methyl-2-aminoethane-sulfonic acid, 5; NaH.sub.2PO.sub.4, 1; trehalose, 10; glucose, 10 (pH 7.3 when bubbled with 95% 02 and 5% CO.sub.2, 275 mOsm. The brain was then washed with fresh saline several times, and maintained in the saline for 1 hr.
(241) During the dye application and washout, animals were placed in a moist chamber to avoid dehydration. After that, they were moved to the imaging rig, where superfusion continued at 1-2 mL/min with oxygenated saline. To minimize movement during imaging, the proboscis was fixed with a UV-curable glue (NOA 68T, Norland products) and the frontal pulsatile organ muscle 16 was removed. Imaging was performed on a wide-field fluorescence microscope (SOM, Sutter Instruments) equipped with a 60×, NA 1.0, water-immersion objective (LUMPlanFl/IR; Olympus) and a sCMOS camera (Orca Flash 4.0 V2+, Hamamatsu). Images were acquired at 800 Hz with 4×4 binning through the Hamamatsu imaging software (HCImage Live). Data presented used .sub.JF549. Illumination was provided by a 530 nm LED (SA-530, Sutter) with an excitation filter (FF01-543/22-25, Semrock); intensity at the sample plane was ˜5 mW/mm.sup.2 for axons and dendrites, and 8-16 mW/mm.sup.2 for soma; emission was separated from excitation light using a dichroic mirror (FF562-Di03-25×36, Semrock) and an emission filter (LP02-568RU-25, Semrock).
(242) Experiments with JF.sub.525 tended to yield shorter duration imaging sessions (˜2 min versus >5 min for JF.sub.549 in dopamine neurons), likely because of greater phototoxicity with the shorter wavelength light. For JF.sub.525, illumination was provided by a 506 nm LED (SA-506-1PLUS, Sutter) with an excitation filter (FF01-503/40-25, Semrock); intensity at the sample plane was typically 10-25 mW/mm.sup.2; emission was separated from excitation light using a dichroic mirror (Di02-R532-25×36, Semrock) and an emission filter (FF01-562/40-25, Semrock).
(243) Whole-cell recordings (54) were guided by Voltron fluorescence from target cells. The patch pipettes were pulled for a resistance of 5-7 MΩ and filled with pipette solution containing (in mM): L-potassium aspartate, 125; HEPES, 10; EGTA, 1.1; CaCl.sub.2), 0.1; Mg-ATP, 4; Na-GTP, 0.5; biocytin hydrazide, 13; with pH adjusted to 7.3 with KOH (265 mOsm). Recordings were made using the Axon MultiClamp 700B amplifier (Molecular Devices). Cells were held at around −60 mV by injecting hyperpolarizing current (<50 pA). Signals were low-pass filtered at 5 kHz and digitized at 10 kHz.
(244) Voltron data were analyzed in MATLAB. Regions of interest (ROIs) corresponding to different neuron compartments were manually selected, and the mean intensity of the ROI was extracted. Median filtering with a 50-ms time window was performed on the raw fluorescence traces to get a filtered trace, and F0 was calculated as the mean over the first 1 s of imaging session. For detecting action potential spikes and quantifying SNR, the filtered trace was subtracted from the raw trace. Spikes were detected by finding local minima with peak amplitude over 3.5 times the standard deviation of the entire subtracted trace, and SNR was quantified as peak amplitude over the standard deviation of the trace excluding the time zone (50 ms) containing spikes. To analyze the axon signals, the ROIs of ipsilateral and contralateral axons were first pooled together to detect spikes. The spikes were then assigned to either the patched cell or its sister cell depending on the relative peak amplitude, i.e. if ipsilateral/contralateral >1, spike is assigned to the patched cell, otherwise it is assigned to the sister cell.
(245) All publications, patents, and patent applications mentioned in this specification are herein incorporated by reference to the same extent as if each individual publication, patent, or patent application was specifically and individually indicated to be incorporated by reference, including the references set forth in the following list:
REFERENCES
(246) 1. T. W. Chen et al., Ultrasensitive fluorescent proteins for imaging neuronal activity. Nature. 499, 295-300 (2013). 2. K. Svoboda, W. Denk, D. Kleinfeld, D. W. Tank, In vivo dendritic calcium dynamics in neocortical pyramidal neurons. Nature. 385, 161-165 (1997). 3. V. Emiliani, A. E. Cohen, K. Deisseroth, M. Hausser, All-optical interrogation of neural circuits. J. Neurosci. 35, 13917-13926 (2015). 4. Y. Xu, P. Zou, A. E. Cohen, Voltage imaging with genetically encoded indicators. Curr. Opin. Chem. Biol. 39, 1-10 (2017). 5. M. Z. Lin, M. J. Schnitzer, Genetically encoded indicators of neuronal activity. Nat. Neurosci. 19 (2016), pp. 1142-1153. 6. J. M. Kralj, A. D. Douglass, D. R. Hochbaum, D. Maclaurin, A. E. Cohen, Optical recording of action potentials in mammalian neurons using a microbial rhodopsin. Nat. Methods. 9, 90-95 (2011). 7. D. R. Hochbaum et al., All-optical electrophysiology in mammalian neurons using engineered microbial rhodopsins. Nat. Methods. 11, 825-833 (2014). 8. Y. Adam et al., All-optical electrophysiology reveals brain-state dependent changes in hippocampal subthreshold dynamics and excitability. bioRxiv (2018), doi:10.1101/281618. 9. L. Jin et al., Single action potentials and subthreshold electrical events imaged in neurons with a fluorescent protein voltage probe. Neuron. 75, 779-785 (2012). 10. P. Zou et al., Bright and fast multicoloured voltage reporters via electrochromic FRET. Nat. Commun. 5, 4625 (2014). 11. 4. Y. Gong et al., High-speed recording of neural spikes in awake mice and flies with a fluorescent voltage sensor. Science. 350, 1361-1366 (2015). 12. A. S. Abdelfattah et al., A bright and fast red fluorescent protein voltage indicator that reports neuronal activity in organotypic brain slices. J. Neurosci. 36, 2458-2472 (2016). 13. H. H. H. Yang et al., Subcellular Imaging of Voltage and Calcium Signals Reveals Neural Processing In Vivo. Cell. 166, 245-257 (2016). 14. J. B. Grimm et al., A general method to improve fluorophores for live-cell and single-molecule microscopy. Nat. Methods. 12, 244-250 (2015). 15. G. V. Los et al., HaloTag: A novel protein labeling technology for cell imaging and protein analysis. ACS Chem. Biol. 3, 373-382 (2008). 16. L. P. Encell et al., Development of a dehalogenase-based protein fusion tag capable of rapid, selective and covalent attachment to customizable ligands. Curr. Chem. Genomics. 6, 55-71 (2012). 17. J. B. Grimm et al., A general method to fine-tune fluorophores for live-cell and in vivo imaging. Nat. Methods. 14, 987 (2017). 18. Y. Gong, M. J. Wagner, J. Zhong Li, M. J. Schnitzer, Imaging neural spiking in brain tissue using FRET-opsin protein voltage sensors. Nat. Commun. 5, 3674 (2014). 19. J. M. Kralj, D. R. Hochbaum, A. D. Douglass, A. E. Cohen, Electrical spiking in Escherichia coli probed with a fluorescent voltage-indicating protein. Science (80,). 333, 345-348 (2011). 20. T. Wada et al., Crystal structure of the eukaryotic light-driven proton-pumping rhodopsin, Acetabularia rhodopsin II, from marine alga. J. Mol. Biol. 411, 986-998 (2011). 21. A. Keppler et al., A general method for the covalent labeling of fusion proteins with small molecules in vivo. Nat. Biotechnol. 21, 86-89 (2003). 22. C. A. Baker, Y. M. Elyada, A. Parra, M. M. L. Bolton, Cellular resolution circuit mapping with temporal-focused excitation of soma-targeted channel rhodopsin. Elife. 5, 1-15 (2016). 23. S. T. Lim, D. E. Antonucci, R. H. Scannevin, J. S. Trimmer, A novel targeting signal for proximal clustering of the Kv2.1 K+channel in hippocampal neurons. Neuron. 25, 385-397 (2000). 24. S. L. Smith, I. T. Smith, T. Branco, M. Häusser, Dendritic spikes enhance stimulus selectivity in cortical neurons in vivo. Nature. 503, 115-120 (2013). 25. B. Tasic et al., Adult mouse cortical cell taxonomy revealed by single cell transcriptomics. Nat. Neurosci. 19, 335-346 (2016). 26. M. B. Ahrens et al., Brain-wide neuronal dynamics during motor adaptation in zebrafish. Nature. 485, 471-7 (2012). 27. T. Hige, Y. Aso, G. M. Rubin, G. C. Turner, Plasticity-driven individualization of olfactory coding in mushroom body output neurons. Nature. 526, 258-262 (2015). 28. A. Wang, J. Feng, Y. Li, P. Zou, Beyond fluorescent proteins: hybrid and bioluminescent indicators for imaging neural activities. ACS Chem. Neurosci. 9, 639-650 (2018). 29. L. A. Gross, G. S. Baird, R. C. Hoffman, K. K. Baldridge, R. Y. Tsien, The structure of the chromophore within DsRed, a red fluorescent protein from coral. Proc. Natl. Acad. Sci. 97, 11990-11995 (2000). 30. N. C. Shaner, P. A. Steinbach, R. Y. Tsien, A guide to choosing fluorescent proteins. Nat. Methods. 2, 905-909 (2005). 31. D. Wüstner, T. Christensen, L. M. Solanko, D. Sage, Photobleaching kinetics and time-integrated emission of fluorescent probes in cellular membranes. Molecules. 19, 11096-11130 (2014). 32. J. R. Lakowicz, Principles of Fluorescence Spectroscopy (Springer New York, N.Y., 2006). 33. S. J. Lord et al., DCDHF fluorophores for single-molecule imaging in cells. ChemPhysChem. 10, 55-65 (2009). 34. C. Eggeling, A. Volkmer, C. A. M. Seidel, Molecular photobleaching kinetics of Rhodamine 6G by one- and two-photon induced confocal fluorescence microscopy. ChemPhysChem. 6, 791-804 (2005). 35. T. J. Wardill et al., A Neuron-Based Screening Platform for Optimizing Genetically-Encoded Calcium Indicators. PLoS One. 8, 1-12 (2013). 36. D. A. Dombeck, C. D. Harvey, L. Tian, L. L. Looger, D. W. Tank, Functional imaging of hippocampal place cells at cellular resolution during virtual navigation. Nat. Neurosci. 13, 1433-1440 (2010). 37. T. Yardeni, M. Eckhaus, H. D. Morris, M. Huizing, S. Hoogstraten-Miller, Retro-orbital injections in mice. Lab Anim. (NY). 40, 155-160 (2011). 38. P. Thévenaz, U. E. Ruttimann, M. Unser, A pyramid approach to subpixel registration based on intensity. IEEE Trans. Image Process. 7, 27-41 (1998). 39. F. Franke, R. Quian Quiroga, A. Hierlemann, K. Obermayer, Bayes optimal template matching for spike sorting-combining fisher discriminant analysis with optimal filtering. J. Comput. Neurosci. 38, 439-459 (2015). 40. R. W. Koster, S. E. Fraser, Tracing Transgene Expression in Living Zebrafish Embryos. Dev. Biol. 233, 329-346 (2001). 41. R. M. White et al., Transparent Adult Zebrafish as a Tool for In Vivo Transplantation Analysis. Cell Stem Cell. 2, 183-189 (2008). 42. K. Kawakami et al., A transposon-mediated gene trap approach identifies developmentally regulated genes in zebrafish. Dev. Cell. 7, 133-44 (2004). 43. C. Satou et al., Transgenic tools to characterize neuronal properties of discrete populations of zebrafish neurons. Development. 140, 3927-31 (2013). 44. T. Kawashima et al., The Serotonergic System Tracks the Outcomes of Actions to Mediate Short-Term Motor Learning. Cell. 167, 933-946.e20 (2016). 45. N. Vladimirov et al., Light-sheet functional imaging in fictively behaving zebrafish. Nat. Methods. 11, 883-884 (2014). 46. N. Vladimirov et al., Light-sheet functional imaging in fictively behaving zebrafish. Nat. Methods 11, 883-884 (2014). 47. B. K. Andrásfalvy et al., Quantum dot-based multiphoton fluorescent pipettes for targeted neuronal electrophysiology. Nat. Methods. 11, 1237-1241 (2014). 48. Y.-K. Bae et al., Anatomy of zebrafish cerebellum and screen for mutations affecting its development. Dev. Biol. 330, 406-26 (2009). 49. M. Takeuchi et al., Establishment of Gal4 transgenic zebrafish lines for analysis of development of cerebellar neural circuitry. Dev. Biol. 397, 1-17 (2015). 50. M. B. Ahrens et al., Brain-wide neuronal dynamics during motor adaptation in zebrafish. Nature. 485, 471-7 (2012). 51. M. Guizar-Sicairos, S. T. Thurman, J. R. Fienup, Efficient subpixel image registration algorithms. Opt. Lett. 33, 156 (2008). 52. Y. Aso et al., The neuronal architecture of the mushroom body provides a logic for associative learning. Elife. 3, e04577 (2014). 53. M. Murthy, G. Turner, Dissection of the head cuticle and sheath of living flies for whole-cell patch-clamp recordings in the brain. Cold Spring Harb. Protoc. 8, 134-139 (2013). 54. R. I. Wilson, G. C. Turner, G. Laurent, Transformation of Olfactory Drosophila Antennal Lobe. Science (80-.). 303, 366-370 (2004). 55. F. St-Pierre et al., High-fidelity optical reporting of neuronal electrical activity with an ultrafast fluorescent voltage sensor. Nat. Neurosci. 17, 884-889 (2014). 56. O. Randlett et al., Whole-brain activity mapping onto a zebrafish brain atlas. Nat. Methods. 12, 1039-1046 (2015). 57. S. Chamberland et al., Fast two-photon imaging of subcellular voltage dynamics in neuronal tissue with genetically encoded indicators. Elife. 6, e25690 (2017). 58. Govorunova, E. G., et al., Microbial Rhodopsins: Diversity, Mechanisms, and Optogenetic Applications. Annu Rev Biochm. 86, 845-872 (2017). 59. Beja, O., et al. Proteorhodopsin phototrophy in the ocean. Nature 411, 786-789 (2001) 60. U.S. Patent Application Publication NO. 2020/0123218 for “OPTOGENETIC PROBES FOR MEASURING MEMBRANE POTENTIAL.” 61. U.S. Pat. Nos. 9,933,417, 10,018,624, 10,161,932, and 10,495,632.
(247) It will be understood that various details of the presently disclosed subject matter can be changed without departing from the scope of the subject matter disclosed herein. Furthermore, the foregoing description is for the purpose of illustration only, and not for the purpose of limitation.
(248) TABLE-US-00004 SEQUENCE LISTING SEQ ID NO: 1 - DNA sequence of Voltron D92N ATGGCTGACGTGGAAACCGAGACCGGCATGATTGCACAGTGGATTGTCTTTGCTATT ATGGCTGCTGCTGCTATTGCTTTTGGAGTGGCTGTGCACTTTCGGCCTTCAGAGCTG AAGAGCGCATACTATATCAACATTGCCATCTGCACTATCGCCGCTACCGCTTACTAT GCAATGGCCGTGAACTACCAGGACCTGACAATGAATGGTGAAAGGCAGGTGGTCTAC GCAAGATATATTAACTGGGTGCTGACCACACCACTGCTCCTGCTCAACCTCATCGTC ATGACCAAGATGGGCGGAGTGATGATTTCTTGGGTCATCGGCGCAGACATTTTCATG ATCGTGTTTGGTATTCTGGGCGCCTTCGAGGATGAACACAAGTTCAAATGGGTGTAC TTTATCGCTGGATGTGTGATGCAGGCAGTCCTGACATACGGGATGTATAACGCCACT TGGAAAGACGATCTGAAGAAAAGCCCCGAGTACCATAGCTCCTATGTCAGTCTGCTC GTCTTCCTGTCAATCCTCTGGGTGTTTTATCCTGTCGTGTGGGCTTTCGGGTCTGGT AGTGGCGTGCTGTCCGTCGACAATGAGGCCATTCTCATGGGAATCCTGGATGTGCTC GCTAAGCCACTGTTTGGAATGGGGTGCCTCATTGCCCATGAGACTATCTTCAAGATC GGTACTGGCTTTCCATTCGACCCCCATTATGTGGAAGTCCTGGGCGAGCGCATGCAC TACGTCGATGTTGGTCCGCGCGATGGCACCCCTGTGCTGTTCCTGCACGGTAACCCG ACCTCCTCCTACGTGTGGCGCAACATCATCCCGCATGTTGCACCGACCCATCGCTGC ATTGCTCCAGACCTGATCGGTATGGGCAAATCCGACAAACCAGACCTGGGTTATTTC TTCGACGACCACGTCCGCTTCATGGATGCCTTCATCGAAGCCCTGGGTCTGGAAGAG GTCGTCCTGGTCATTCACGACTGGGGCTCCGCTCTGGGTTTCCACTGGGCCAAGCGC AATCCAGAGCGCGTCAAAGGTATTGCATTTATGGAGTTCATCCGCCCTATCCCGACC TGGGACGAATGGCCAGAATTTGCCCGCGAGACCTTCCAGGCCTTCCGCACCACCGAC GTCGGCCGCAAGCTGATCATCGATCAGAACGTTTTTATCGAGGGTACGCTGCCGATG GGTGTCGTCCGCCCGCTGACTGAAGTCGAGATGGACCATTACCGCGAGCCGTTCCTG AATCCTGTTGACCGCGAGCCACTGTGGCGCTTCCCAAACGAGCTGCCAATCGCCGGT GAGCCAGCGAACATCGTCGCGCTGGTCGAAGAATACATGGACTGGCTGCACCAGTCC CCTGTCCCGAAGCTGCTGTTCTGGGGCACCCCAGGCGTTCTGATCCCACCGGCCGAA GCCGCTCGCCTGGCCAAAAGCCTGCCTAACTGCAAGGCTGTGGACATCGGCCCGGGT CTGAATCTGCTGCAAGAAGACAACCCGGACCTGATCGGCAGCGAGATCGCGCGCTGG CTGTCGACGCTCGAGATTTCCGGCGAGCCAACCACTAAGAGCAGGATCACCAGCGAG GGCGAGTACATCCCCCTGGACCAGATCGACATCAACGTGTTCTGCTACGAGAACGAG GTGTAA SEQ ID NO: 2 - Protein sequence of Voltron D92N MADVETETGMIAQWIVFAIMAAAAIAFGVAVHFRPSELKSAYYINIAICTIAATAYY AMAVNYQDLTMNGERQVVYARYINWVLTTPLLLLNLIVMTKMGGVMISWVIGADIFM IVFGILGAFEDEHKFKWVYFIAGCVMQAVLTYGMYNATWKDDLKKSPEYHSSYVSLL VFLSILWVEYPVVWAFGSGSGVLSVDNEAILMGILDVLAKPLEGMGCLIAHETIFKI GTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYVWRNIIPHVAPTHRC IAPDLIGMGKSDKPDLGYFFDDHVREMDAFIEALGLEEVVLVIHDWGSALGFHWAKR NPERVKGIAFMEFIRPIPTWDEWPEFARETFQAFRTTDVGRKLIIDQNVFIEGTLPM GVVRPLTEVEMDHYREPFLNPVDREPLWRFPNELPIAGEPANIVALVEEYMDWLHQS PVPKLLFWGTPGVLIPPAEAARLAKSLPNCKAVDIGPGLNLLQEDNPDLIGSEIARW LSTLEISGEPTTKSRITSEGEYIPLDQIDINVFCYENEV* SEQ ID NO: 3 - DNA sequence of Voltron N81D D92N ATGGCTGACGTGGAAACCGAGACCGGCATGATTGCACAGTGGATTGTCTTTGCTATT ATGGCTGCTGCTGCTATTGCTTTTGGAGTGGCTGTGCACTTTCGGCCTTCAGAGCTG AAGAGCGCATACTATATCAACATTGCCATCTGCACTATCGCCGCTACCGCTTACTAT GCAATGGCCGTGAACTACCAGGACCTGACAATGAATGGTGAAAGGCAGGTGGTCTAC GCAAGATATATTGACTGGGTGCTGACCACACCACTGCTCCTGCTCAACCTCATCGTC ATGACCAAGATGGGCGGAGTGATGATTTCTTGGGTCATCGGCGCAGACATTTTCATG ATCGTGTTTGGTATTCTGGGCGCCTTCGAGGATGAACACAAGTTCAAATGGGTGTAC TTTATCGCTGGATGTGTGATGCAGGCAGTCCTGACATACGGGATGTATAACGCCACT TGGAAAGACGATCTGAAGAAAAGCCCCGAGTACCATAGCTCCTATGTCAGTCTGCTC GTCTTCCTGTCAATCCTCTGGGTGTTTTATCCTGTCGTGTGGGCTTTCGGGTCTGGT AGTGGCGTGCTGTCCGTCGACAATGAGGCCATTCTCATGGGAATCCTGGATGTGCTC GCTAAGCCACTGTTTGGAATGGGGTGCCTCATTGCCCATGAGACTATCTTCAAGATC GGTACTGGCTTTCCATTCGACCCCCATTATGTGGAAGTCCTGGGCGAGCGCATGCAC TACGTCGATGTTGGTCCGCGCGATGGCACCCCTGTGCTGTTCCTGCACGGTAACCCG ACCTCCTCCTACGTGTGGCGCAACATCATCCCGCATGTTGCACCGACCCATCGCTGC ATTGCTCCAGACCTGATCGGTATGGGCAAATCCGACAAACCAGACCTGGGTTATTTC TTCGACGACCACGTCCGCTTCATGGATGCCTTCATCGAAGCCCTGGGTCTGGAAGAG GTCGTCCTGGTCATTCACGACTGGGGCTCCGCTCTGGGTTTCCACTGGGCCAAGCGC AATCCAGAGCGCGTCAAAGGTATTGCATTTATGGAGTTCATCCGCCCTATCCCGACC TGGGACGAATGGCCAGAATTTGCCCGCGAGACCTTCCAGGCCTTCCGCACCACCGAC GTCGGCCGCAAGCTGATCATCGATCAGAACGTTTTTATCGAGGGTACGCTGCCGATG GGTGTCGTCCGCCCGCTGACTGAAGTCGAGATGGACCATTACCGCGAGCCGTTCCTG AATCCTGTTGACCGCGAGCCACTGTGGCGCTTCCCAAACGAGCTGCCAATCGCCGGT GAGCCAGCGAACATCGTCGCGCTGGTCGAAGAATACATGGACTGGCTGCACCAGTCC CCTGTCCCGAAGCTGCTGTTCTGGGGCACCCCAGGCGTTCTGATCCCACCGGCCGAA GCCGCTCGCCTGGCCAAAAGCCTGCCTAACTGCAAGGCTGTGGACATCGGCCCGGGT CTGAATCTGCTGCAAGAAGACAACCCGGACCTGATCGGCAGCGAGATCGCGCGCTGG CTGTCGACGCTCGAGATTTCCGGCGAGCCAACCACTAAGAGCAGGATCACCAGCGAG GGCGAGTACATCCCCCTGGACCAGATCGACATCAACGTGTTCTGCTACGAGAACGAG GTGTAA SEQ ID NO: 4 - Protein sequence of N81D D92N MADVETETGMIAQWIVFAIMAAAAIAFGVAVHFRPSELKSAYYINIAICTIAATAYY AMAVNYQDLTMNGERQVVYARYIDWVLTTPLLLLNLIVMTKMGGVMISWVIGADIFM IVFGILGAFEDEHKFKWVYFIAGCVMQAVLTYGMYNATWKDDLKKSPEYHSSYVSLL VFLSILWVFYPVVWAFGSGSGVLSVDNEAILMGILDVLAKPLFGMGCLIAHETIFKI GTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYVWRNIIPHVAPTHRC IAPDLIGMGKSDKPDLGYFFDDHVRFMDAFIEALGLEEVVLVIHDWGSALGFHWAKR NPERVKGIAFMEFIRPIPTWDEWPEFARETFQAFRTTDVGRKLIIDQNVFIEGTLPM GVVRPLTEVEMDHYREPFLNPVDREPLWRFPNELPIAGEPANIVALVEEYMDWLHQS PVPKLLFWGTPGVLIPPAEAARLAKSLPNCKAVDIGPGLNLLQEDNPDLIGSEIARW LSTLEISGEPTTKSRITSEGEYIPLDQIDINVFCYENEV* SEQ ID NO: 5 - DNA sequence of Voltron N81D D92N E199V ATGGCTGACGTGGAAACCGAGACCGGCATGATTGCACAGTGGATTGTCTTTGCTATT ATGGCTGCTGCTGCTATTGCTTTTGGAGTGGCTGTGCACTTTCGGCCTTCAGAGCTG AAGAGCGCATACTATATCAACATTGCCATCTGCACTATCGCCGCTACCGCTTACTAT GCAATGGCCGTGAACTACCAGGACCTGACAATGAATGGTGAAAGGCAGGTGGTCTAC GCAAGATATATTGACTGGGTGCTGACCACACCACTGCTCCTGCTCAACCTCATCGTC ATGACCAAGATGGGCGGAGTGATGATTTCTTGGGTCATCGGCGCAGACATTTTCATG ATCGTGTTTGGTATTCTGGGCGCCTTCGAGGATGAACACAAGTTCAAATGGGTGTAC TTTATCGCTGGATGTGTGATGCAGGCAGTCCTGACATACGGGATGTATAACGCCACT TGGAAAGACGATCTGAAGAAAAGCCCCGAGTACCATAGCTCCTATGTCAGTCTGCTC GTCTTCCTGTCAATCCTCTGGGTGTTTTATCCTGTCGTGTGGGCTTTCGGGTCTGGT AGTGGCGTGCTGTCCGTCGACAATGTGGCCATTCTCATGGGAATCCTGGATGTGCTC GCTAAGCCACTGTTTGGAATGGGGTGCCTCATTGCCCATGAGACTATCTTCAAGATC GGTACTGGCTTTCCATTCGACCCCCATTATGTGGAAGTCCTGGGCGAGCGCATGCAC TACGTCGATGTTGGTCCGCGCGATGGCACCCCTGTGCTGTTCCTGCACGGTAACCCG ACCTCCTCCTACGTGTGGCGCAACATCATCCCGCATGTTGCACCGACCCATCGCTGC ATTGCTCCAGACCTGATCGGTATGGGCAAATCCGACAAACCAGACCTGGGTTATTTC TTCGACGACCACGTCCGCTTCATGGATGCCTTCATCGAAGCCCTGGGTCTGGAAGAG GTCGTCCTGGTCATTCACGACTGGGGCTCCGCTCTGGGTTTCCACTGGGCCAAGCGC AATCCAGAGCGCGTCAAAGGTATTGCATTTATGGAGTTCATCCGCCCTATCCCGACC TGGGACGAATGGCCAGAATTTGCCCGCGAGACCTTCCAGGCCTTCCGCACCACCGAC GTCGGCCGCAAGCTGATCATCGATCAGAACGTTTTTATCGAGGGTACGCTGCCGATG GGTGTCGTCCGCCCGCTGACTGAAGTCGAGATGGACCATTACCGCGAGCCGTTCCTG AATCCTGTTGACCGCGAGCCACTGTGGCGCTTCCCAAACGAGCTGCCAATCGCCGGT GAGCCAGCGAACATCGTCGCGCTGGTCGAAGAATACATGGACTGGCTGCACCAGTCC CCTGTCCCGAAGCTGCTGTTCTGGGGCACCCCAGGCGTTCTGATCCCACCGGCCGAA GCCGCTCGCCTGGCCAAAAGCCTGCCTAACTGCAAGGCTGTGGACATCGGCCCGGGT CTGAATCTGCTGCAAGAAGACAACCCGGACCTGATCGGCAGCGAGATCGCGCGCTGG CTGTCGACGCTCGAGATTTCCGGCGAGCCAACCACTAAGAGCAGGATCACCAGCGAG GGCGAGTACATCCCCCTGGACCAGATCGACATCAACGTGTTCTGCTACGAGAACGAG GTGTAA SEQ ID NO: 6 -Protein sequence of Voltron N81D D92N E199V MADVETETGMIAQWIVFAIMAAAAIAFGVAVHFRPSELKSAYYINIAICTIAATAYY AMAVNYQDLTMNGERQVVYARYIDWVLTTPLLLLNLIVMTKMGGVMISWVIGADIFM IVFGILGAFEDEHKFKWVYFIAGCVMQAVLTYGMYNATWKDDLKKSPEYHSSYVSLL VFLSILWVFYPVVWAFGSGSGVLSVDNVAILMGILDVLAKPLFGMGCLIAHETIFKI GTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYVWRNIIPHVAPTHRC IAPDLIGMGKSDKPDLGYFFDDHVRFMDAFIEALGLEEVVLVIHDWGSALGFHWAKR NPERVKGIAFMEFIRPIPTWDEWPEFARETFQAFRTTDVGRKLIIDQNVFIEGTLPM GVVRPLTEVEMDHYREPFLNPVDREPLWRFPNELPIAGEPANIVALVEEYMDWLHQS PVPKLLFWGTPGVLIPPAEAARLAKSLPNCKAVDIGPGLNLLQEDNPDLIGSEIARW LSTLEISGEPTTKSRITSEGEYIPLDQIDINVFCYENEV* SEQ ID NO: 7 - DNA sequence of Ace2-mNeonGreen N81D D92N ATGGCTGACGTGGAAACCGAGACCGGCATGATTGCACAGTGGATTGTCTTTGCTATT ATGGCTGCTGCTGCTATTGCTTTTGGAGTGGCTGTGCACTTTCGGCCTTCAGAGCTG AAGAGCGCATACTATATCAACATTGCCATCTGCACTATCGCCGCTACCGCTTACTAT GCAATGGCCGTGAACTACCAGGACCTGACAATGAATGGTGAAAGGCAGGTGGTCTAC GCAAGATATATTGACTGGGTGCTGACCACACCACTGCTCCTGCTCAACCTCATCGTC ATGACCAAGATGGGCGGAGTGATGATTTCTTGGGTCATCGGCGCAGACATTTTCATG ATCGTGTTTGGTATTCTGGGCGCCTTCGAGGATGAACACAAGTTCAAATGGGTGTAC TTTATCGCTGGATGTGTGATGCAGGCAGTCCTGACATACGGGATGTATAACGCCACT TGGAAAGACGATCTGAAGAAAAGCCCCGAGTACCATAGCTCCTATGTCAGTCTGCTC GTCTTCCTGTCAATCCTCTGGGTGTTTTATCCTGTCGTGTGGGCTTTCGGGTCTGGT AGTGGCGTGCTGTCCGTCGACAATGAGGCCATTCTCATGGGAATCCTGGATGTGCTC GCTAAGCCACTGTTTGGAATGGGGTGCCTCATTGCCCATGAGACTATCTTCAAGAAG ATGCTGAGGTCTCTCCCAGCGACACATGAGTTACACATCTTTGGCTCCATCAACGGT GTGGACTTTGACATGGTGGGTCAGGGCACCGGCAATCCAAATGATGGTTATGAGGAG TTAAACCTGAAGTCCACCAAGGGTGACCTCCAGTTCTCCCCCTGGATTCTGGTCCCT CATATCGGGTATGGCTTCCATCAGTACCTGCCCTACCCTGACGGGATGTCGCCTTTC CAGGCCGCCATGGTAGATGGCTCCGGATACCAAGTCCATCGCACAATGCAGTTTGAA GATGGTGCCTCCCTTACTGTTAACTACCGCTACACCTACGAGGGAAGCCACATCAAA GGAGAGGCCCAGGTGAAGGGGACTGGTTTCCCTGCTGACGGTCCTGTGATGACCAAC TCGCTGACCGCTGCGGACTGGTGCAGGTCGAAGAAGACTTACCCCAACGACAAAACC ATCATCAGTACCTTTAAGTGGAGTTACACCACTGGAAATGGCAAGCGCTACAGGAGC ACTGCGCGGACCACCTACACCTTTGCCAAGCCAATGGCGGCTAACTATCTGAAGAAC CAGCCGATGTACGTGTTCCGTAAGACGGAGCTCAAGCACTCCAAGACCGAGCTCAAC TTCAAGGAGTGGCAAAAGGCCTTTACCGATGTGATGGGCATGGACGAGCTGTACAAG AAGAGCAGGATCACCAGCGAGGGCGAGTACATCCCCCTGGACCAGATCGACATCAAC GTGTTCTGCTACGAGAACGAGGTGTAA SEQ ID NO: 8 - Protein sequence of Ace2-mNeonGreen N81D D92N MADVETETGMIAQWIVFAIMAAAAIAFGVAVHFRPSELKSAYYINIAICTIAATAYY AMAVNYQDLTMNGERQVVYARYIDWVLTTPLLLLNLIVMTKMGGVMISWVIGADIFM IVFGILGAFEDEHKFKWVYFIAGCVMQAVLTYGMYNATWKDDLKKSPEYHSSYVSLL VFLSILWVFYPVVWAFGSGSGVLSVDNEAILMGILDVLAKPLFGMGCLIAHETIFKK MLRSLPATHELHIFGSINGVDFDMVGQGTGNPNDGYEELNLKSTKGDLQFSPWILVP HIGYGFHQYLPYPDGMSPFQAAMVDGSGYQVHRTMQFEDGASLTVNYRYTYEGSHIK GEAQVKGTGFPADGPVMTNSLTAADWCRSKKTYPNDKTIISTFKWSYTTGNGKRYRS TARTTYTFAKPMAANYLKNQPMYVFRKTELKHSKTELNFKEWQKAFTDVMGMDELYK KSRITSEGEYIPLDQIDINVFCYENEV* SEQ ID NO: 9 - Protein sequence of Ace2N MADVETETGMIAQWIVFAIMAAAAIAFGVAVHFRPSELKSAYYINIAICTIAATAYY AMAVNYQDLTMNGERQVVYARYINWVLTTPLLLLDLIVMTKMGGVMISWVIGADIFM IVFGILGAFEDEHKFKWVYFIAGCVMQAVLTYGMYNATWKDDLKKSPEYHSSYVSLL VFLSILWVFYPVVWAFGSGSGVLSVDNEAILMGILDVLAKPLFGMGCLIAHETIFK SEQ ID NO: 10 - Protein sequence of HaloTag IGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYVWRNIIPHVAPTHR CIAPDLIGMGKSDKPDLGYFFDDHVRFMDAFIEALGLEEVVLVIHDWGSALGFHWAK RNPERVKGIAFMEFIRPIPTWDEWPEFARETFQAFRTTDVGRKLIIDQNVFIEGTLP MGVVRPLTEVEMDHYREPFLNPVDREPLWRFPNELPIAGEPANIVALVEEYMDWLHQ SPVPKLLFWGTPGVLIPPAEAARLAKSLPNCKAVDIGPGLNLLQEDNPDLIGSEIAR WLSTLEISGEPTT SEQ ID NO: 11 - Protein sequence of exemplary a capture protein domain KMLRSLPATHELHIFGSINGVDFDMVGQGTGNPNDGYEELNLKSTKGDLQFSPWILV PHIGYGFHQYLPYPDGMSPFQAAMVDGSGYQVHRTMQFEDGASLTVNYRYTYEGSHI KGEAQVKGTGFPADGPVMTNSLTAADWCRSKKTYPNDKTIISTFKWSYTTGNGKRYR STARTTYTFAKPMAANYLKNQPMYVFRKTELKHSKTELNFKEWQKAFTDVMGMDELY K SEQ ID NO: 12 - Protein sequence of Kv2.1 membrane trafficking signal KSRITSEGEYIPLDQIDINV SEQ ID NO: 13 - Protein sequence of Kv2.1 ER export signal FCYENEV SEQ ID NO: 14: Protein sequence of Kv2.1 Proximal restriction/clustering QSQPILNTKEMAPQSKPPEELEMSSMPSPVAPLPARTEGVIDMRSMSSIDSFISCAT DFPEATRF SEQ ID NO: 15: - Protein sequence of QuarAr1. IALQAGYDLLGDGRPETLWLGIGTLLMLIGTFYFLVRGWGVTDKDAREYYAVTILVS GIASAAYLSMFFGIGLTEVSVGGEMLDIYYARYAHWLFTTLLLLHLALLAKVDRVTI GTLVGVDALMIVTGLIGALSHTAIARYSWWLFSTICMIVVLYVLATSLRSAAKERGP EVASTFNTLTALVLVLWTAYPILWIIGTEGAGVVGLGIETLLFMVLDVTAKVGFGFI LLRSRAILGDTEAPEPSAGADVSAAD SEQ ID NO: 16 - Protein sequence of QuasAr2, as in FIG. 10. IALQAGYDLLGDGRPETLWLGIGTLLMLIGTFYFLVRGWGVTDKDAREYYAVTILVS GIASAAYLSMFFGIGLTEVSVGGEMLDIYYARYAQWLFTTPLLLLHLALLAKVDRVT IGTLVGVDALMIVTGLIGALSHTAIARYSWWLFSTICMIVVLYVLATSLRSAAKERG PEVASTFNTLTALVLVLWTAYPILWIIGTEGAGVVGLGIETLLFMVLDVTAKVGFGF ILLRSRAILGDTEAPEPSAGADVSAAD SEQ ID NO: 17 - Protein Sequences of QuasAr2, as in FIG. 11. IALQAGYDLLGDGRPETLWLGIGTLLMLIGTFYFLVRGWGVTDKDAREYYAVTILVS GIASAAYLSNIFFGIGLTEVSVGGEMLDIYYARYAQWLFTTPLLLLHLALLAKVDRV TIGTLVGVDALMIVTGLIGALSHTAIARYSWWLFSTICMIVVLYVLATSLRSAAKER GPEVASTFNTLTALVLVLWTAYPILWIIGTEGAGVVGLGIETLLFMVLDVTAKVGFG FILLRSRAILGDTE