Composition Exhibiting a von Willebrand Factor (vWF) Protease Activity Comprising a Polypeptide Chain with the Amino Acid Sequence AAGGILHLELLV
20170065686 ยท 2017-03-09
Inventors
- Bernhard Laemmle (Bolligen, CH)
- Helena Elisabeth Schaller-Gerritsen (Muri AG, CH)
- Miha Furlan (Bem, CH)
- Peter Turecek (Klosterneuburg, AT)
- Hans-Peter Schwarz (Vienna, AT)
- Friedrich Scheiflinger (Vienna, AT)
- Gerhard Antoine (Gross Enzersdorf, AT)
- Randolf Kerschbaumer (Klosterneuburg, AT)
- Luigina Tagliavacca (Milano, IT)
- Klaus Zimmermann (Vienna or Pressbaum, AT)
Cpc classification
C07K14/755
CHEMISTRY; METALLURGY
A61K38/4886
HUMAN NECESSITIES
A61P7/02
HUMAN NECESSITIES
International classification
Abstract
The invention relates to vWF cleaving entities having a molecular weight of 180 kD, 170 kD, 160 kD, 120 kD or 110 kD and an N-terminal amino acid sequence of AAGGILHLELLV, vWF cleaving complexes and methods for their production.
Claims
1. An pharmaceutical composition comprising an effective dose of a recombinant polypeptide for the treatment of a disease in which the patient has a supranormal vWF content or an increased level of high-molecular weight vWF, wherein the polypeptide exhibits vWF protease activity and vWF binding activity, is produced in an in vitro mammalian cell culture system, and has a molecular weight between about 180 kD and about 120 kD as determined by SDS-PAGE under reducing conditions and comprising the amino acid sequence TABLE-US-00009 (SEQIDNO:4) AAGGILHLELLVAVGPDVFQAHQEDTERYVLTNLNIGAELLRDPS LGAQFRVHLVKMVILTEPEGAPNITANLTSSLLSVCGWSQTINPE DDTDPGHADLVLYITRFDLELPDGNRQVRGVTQLGGACSPTWSCL ITEDTGFDLGVTI.
2. The pharmaceutical composition of claim 1, wherein the in vitro mammalian cell culture system is a CHO cell culture system.
3. The pharmaceutical composition of claim 1, wherein the disease is thrombotic thrombocytopenic purpura (TTP), Henoch-Schonlein purpura, preeclampsia, neonatal thrombocytopenia, or hemolytic-uremic syndrome.
4. The pharmaceutical composition of claim 1, wherein the recombinant polypeptide comprises the amino acid sequence: TABLE-US-00010 (SEQIDNO:4) AAGGILHLELLVAVGPDVFQAHQEDTERYVLTNLNIGAELLRDPS LGAQFRVHLVKMVILTEPEGAPNITANLTSSLLSVCGWSQTINPE DDTDPGHADLVLYITRFDLELPDGNRQVRGVTQLGGACSPTWSCL ITEDTGFDLGVTI.
5. The pharmaceutical composition of claim 3, wherein the disease is thrombotic thrombocytopenic purpura (TTP), Henoch-Schonlein purpura, preeclampsia, neonatal thrombocytopenia, or hemolytic-uremic syndrome.
6. A method of treating a disease in which a patient has a supranormal vWF content or an increased level of high-molecular weight vWF, wherein the method comprises administering a pharmaceutical composition comprising an effective dose of an isolated polypeptide that has vWF protease activity and comprises a peptide chain that has a molecular weight from about 180 kD to about 120 kD as determined by SDS-PAGE under reducing conditions and comprises the amino acid sequence TABLE-US-00011 (SEQIDNO:4) AAGGILHLELLVAVGPDVFQAHQEDTERYVLTNLNIGAELLRDPS LGAQFRVHLVKMVILTEPEGAPNITANLTSSLLSVCGWSQTINPE DDTDPGHADLVLYITRFDLELPDGNRQVRGVTQLGGACSPTWSCL ITEDTGFDLGVTI.
7. The method of claim 7, wherein the disease is thrombotic throbocytic purpura (TTP), Henoch-Schonlein purpura, preeclampsia, neonatal thrombocytopenia or hemolyticuremic syndrome.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0016]
[0017]
DETAILED DESCRIPTION OF THE INVENTION
[0018] A composition is provided containing a vWF protease consisting of a polypeptide chain with an apparent molecular weight in SDS-PAGE of around 180 kD, around 170 kD, around 160 kD, around 120 kD, around 110 kD or mixtures of these chains, said chain comprising an amino acid sequence AAGGILHLELLV. Alternatively, this amino acid sequence can be directly followed by the amino acid sequence AVG. Furthermore, this sequence is followed by the sequence PDVFQAHQEDTERYVLTNLNIGAELLRDPSLGAQFRVHL VKMVILTEPEGAPNITANLTSSLLSVCGWSQTINPEDDTDPGHADLVLYITRFDLELPDGNR QVRGVTQLGGACSPTWSCLITEDTGFDLGVTI.
[0019] The SOS-PAGE was performed under reducing conditions. As is well known in the art, molecular weight determination using SDS PAGE results in the detection of apparent molecular masses, which may be different from the molecular masses of the native, non-denatured protein.
[0020] Based on a computer search of sequence homologies, the vWF protease according to the invention shows high homology to the group of disintegrin and metalloproteinases (ADAM). Members of this group share several distinct protein modules, including a protease domain, a disintegrin domain, a cysteine-rich region and an EGF repeat (Tang B L and Hong W., FEBS, 1999, 445, pp. 223-225). The nucleotide and amino acid sequence as shown in
[0021] Analysis of non-denatured material by mass spectrometry showed very broad peaks of high molecular weight. No prominent bands were identified. This finding is in agreement with appearance, in gel filtration experiments, of 80 kD bands close to the void volume of. Sephacryl S-300, suggesting that the proteins in this preparation tend to polymerize under physiologic conditions (a property of clusterin).
[0022] The AAGGILHLELLV sequence is located at the N-terminal region of the protein. Shortening of the peptide chain occurs at the C-terminus or via endoproteolytical cleavages. The composition according to the present invention contains a vWF cleaving protease that is expressed as a single chain protein.
[0023] Preferably, the composition according to the present invention further comprises Ca.sup.2+, Sr.sup.2+ and/or Ba.sup.2+ ions. The preparation may comprise calcium ions in a. concentration of about 1 to 10.sup.6 ions per polypeptide molecule with vWF protease activity. The preparation according to the present invention contains vWF protease activity in an essentially purified form. Preferably, the purified protease preparation from plasma contains between 0.001% and 1%, preferably 0.002% of the initial amount of plasma protein, and between 1% and 5%, preferably 2.3% of the initial enzyme activity, which has been partially inactivated during the purification procedure. Preferably, the purity is as high as the relative proportions of polypeptide chains with the vWF protease activity present in an amount of above 50%, especially above 80%, most preferred about 90%, of total protein compared to the vWF protease activity in plasma. Preferably, the preparation according to the present invention is essentially free of vWF or vWF fragments, i.e. having a vWF content of below 5%, preferably below the detection limit of an assay to detect vWF.
[0024] The peptides containing the amino acid sequence AAGGILHLELLV or AAGGILHLELLVAVG or AAGGILHLELLVAVGPDVFQAHQEDTERYVLTNLNIGAELLRD PSLGAQFRVHLVKMVILTEPEGAPNITANLTSSLLSVCGWSQTINPEDDTDPGHADLVLYIT RFDLELPDGNRQVRGVTQLGGACSPTWSCLITEDTGFDLGVTI or RRAAGGILHLELLV AVGPDVFQAHQEDTERYVLTNLNIGAELLRDPSLGAQFRVHLVKMVILTEPEGAPNITANL TSSLLSVCGWSQTINPEDDTDPGHADLVLYITRFDLELPDGNRQVRGVTQLGGACSPTWS CLITEDTGFDLGVTI can also be used as tool for detecting proteins binding to the vWF protease or target sites for ligand development for detecting, isolating and purifying proteins that bind to the vWF protease. Preferably the protein to be detected or purified is vWF.
[0025] These ligands can for example be peptides or peptidomimetics capable to bind proteins binding to the vWF protease or binding domains incorporated into antibodies or antibody derivatives (for example single chain antibodies, miniantibodies, bispecific antibodies, diabodies etc.).
[0026] Furthermore, the peptide having the amino acid sequence AAGGILHLELLV or AAGGILHLELLVAVG or AAGGILHLELLV AVGPDVFQAHQEDTERYVLTNLNIGAELLRDPSLGAQFRVHLVKMVILTEPEGAPNITANL TSSLLSVCGWSQTINPEDDTDPGHADLVLYITRFDLELPDGNRQVRGVTQLGGACSPTWS CLITEDTGFDLGVTI or RRAAGGILHLELLV AVGPDVFQAHQEDTERYVLTNLNIGAELLRDPSLGAQFRVHLVKMVILTEPEGAPNITANL TSSLLSVCGWSQTINPEDDTDPGHADLVLYITRFDLELPDGNRQVRGVTQLGGACSPTWS CLITEDTGFDLGVTI can also be used for the development of anit-vWF protease antibodies using techniques as known from the art. The development of these antibodies or antibody derivatives or peptidomimetics can be accomplished according methods known to the prior art (Greer J. et al., J. Med. Chem., 1994, Vol. 37, pp. 1035-1054; Harlow E. and Lane D., in Antibodies. A Laboratory manual, Cold Spring Harbor Laboratory, 1988, Esser C. and Radbruchj A. Annu. Rev. Immunol., 1990, vol. 8, pp. 717-735; Kemp D. S., 1990, Trends Biotechnol., pp. 249-255).
[0027] The present invention relates also to single polypeptide chains having an apparent molecular weight in reduced SDS-PAGE of between 190 kD and 100 kD, preferably about 180 kD, more preferably about 170 kD, in a particularly preferred embodiment about 160 kD, preferably 120 kD and most preferably about 110 kD, comprising an N-terminal amino acid sequence AAGGILHLELLV. This sequence is preferably directly followed by the sequence AVG, which is then preferably followed by the sequence PDVFQAHQEDTERY VLTNLNIGAELLRDPSLGAQFRVHLVKMVILTEPEGAPNITANLTSSLLSVCGWSQTINPED DTDPGHADLVLYITRFDLELPDGNRQVRGVTQLGGACSPTWSCLITEDTGFDLGVTI. In contrast to the protease entities described by Furlan et al. (1996) and Tsai (Blood 87 (10) (1996), pp. 4235-4244) the vWF multimerase entities according to the present invention are much smaller than the entities described in these documents (around 300 kD (Furlan et al.), and 200 kD (Tsai), respectively).
[0028] The proteolytic entities provided with the present invention comprise a physiological vWF cleaving activity which is defined by (1) the cleaving vWF at the peptide bond 842Ty r-843Met, (2) having a direct proteolytic activity which converts vWF having a singlet structure to vWF having a satellite structure, and (3) retaining activity in the presence of a serine protease inhibitor such as diisopropyl fluorophosphate (DFP) and in the presence of a calpain protease inhibitor such as carbobenzyloxy (Z) peptidyl diazomethylketone inhibitor (Z-Leu-Leu-Tyr-CHN.sub.2). The proteolytic entities provided with the present invention may also act indirectly via another effector protein, for example a protease.
[0029] This single polypeptide chain forms an active vWF cleaving complex together with a metal ion selected from the group consisting: Ca.sup.++, Sr.sup.++and Ba.sup.++. The preferred metal ion is Ca.sup.++. This active complex is able to cleave vWF in a physiological manner as described above.
[0030] A further aspect of the present invention relates to an isolated vWF cleavage. complex comprising vWF, a metal ion selected from the group consisting of Ca.sup.++, Sr.sup.++ and Ba.sup.++ and one or more single polypeptide chains having vWF protease activity according to the present invention.
[0031] The vWF proteolytic activity (also termed vWF protease activity) of the peptide chains according to the present invention may be determined by any method described in the art, such as the method according to Furlan et al. (1996), which is preferred for the present invention. Further preferred test systems are described.sup., in International Application No. WO 00/50904. The test system described in WO 00/50904 is also suitable for the present vWF protease entities. Alternatively, a collagen binding assay (as described in EP 816 852) can also be used as a test system. Preferably, this test is used for screening and diagnostic purposes.
[0032] A further object of the invention is achieved by providing a composition containing the vWF protease according to the invention together with clusterin or an analog or derivative thereof. With relation to the activity of the protein, the term derivative or analog of clusterin refers to proteins that show the same proteolytic characteristics as the native clusterin protein.
[0033] Clusterin is a heterodimeric glycoprotein consisting of two non-identical subunits, with a molecular mass of approximately 80 kDa (Rosenberg and Silkensen, J., Int. J. Biochem. Cell Biol., 1995, vol. 27, pp. 633-645; Tschopp J. and French, L. E., Clinical and Exp. Immunol., 1994, 97, pp. 11-14). It is produced in a wide array of tissues and found in most biologic fluids. The physiologic functions described in the prior art include complement regulation, lipid transport, sperm maturation, initiation of apoptosis, endocrine secretion, membrane protection and promotion of cell interactions.
[0034] It has been found that the unusually high stability of the vWF protease of the present invention in circulating plasma is associated with the presence of clusterin. We have found that the half-life of vWF-cleaving protease activity in vivo is between 1 and 4 days, while other proteases in plasma have half-lives in the range of seconds to hours. The ratio of clusterin to vWF protease in a composition according to the present invention is preferably in a range of 10M:1M to 1M:10M, and more preferably the ratio of clusterin and vWF is in the equimolar range. In human plasma, the concentration of vWF-cleaving protease is 2-10 mg/liter whereas that of clusterin is 50-400 mg/liter plasma (the molar ratio of vWF-cleaving protease to clusterin in human plasma is about 1:20-1:100).
[0035] Isolation of the composition from either human plasma or other sources, e.g. supernatants of cell cultures expressing the polypeptide according to the present invention, milk or other body fluids of transgenic animals expressing the polypeptide according to the present invention can be performed by chromatographic means. Preferably, the purification is performed by a combination of chromatographic steps including immunoaffinity chromatography, gel filtration, and ion exchange chromatography. For example, the first purification step can be immunoaffinity chromatography, the second step can be gel filtration, followed by one or more additional immunoaffinity chromatography steps. A further purification can be performed using ion exchange chromatography, preferably anion exchange chromatography and at least one affinity chromatography. Further purification steps can be performed using ion exchange chromatography, gel filtration and further affinity chromatography steps.
[0036] As an alternative embodiment, the nucleotide sequence as shown in
[0037] The expression vector may comprise, for example, in the direction of transcription, a transcriptional regulatory region and a translational initiation region functional in a host cell, a DNA sequence encoding for the polynucleotide expressing a vWF protease activity according to the present invention and translational and transcriptional termination regions functional in said host cell, wherein expression of said nucleic sequence is regulated by said initiation and termination regions. The expression vector may also contain elements for the replication of said nucleotide. Examples of DNA expression vectors are pBPV, pSVL, pRc/CMV, pRc/RSV, myogenic vector systems (WO 93/09236) or vectors derived from viral systems, for example from vaccinia virus, adenoviruses, adeno-associated virus, herpes viruses, retroviruses or baculo viruses.
[0038] The expression vector containing the nucleic acid which encodes the polypeptide having vWF protease activity according to the present invention can be used to transform host cells which then produce said polypeptide. The transformed host cells can be grown in a cell culture system to produce said polypeptide in vitro. The host cells preferably excrete the polypeptide having vWF protease activity into the cell culture medium from which it can be prepared.
[0039] The host cells may be cells derived from the body of a mammal, for example fibroblasts, keratinocytes, hematopoietic cells, hepatocytes or myoblasts, which are transformed in vitro with an expression vector system carrying a nucleic acid according to the present invention and re-implanted into the mammal. The polypeptide according to the present invention encoded by said nucleic acid will be synthesized by these cells in vivo and they will exhibit a desired biological activity in the mammal.
[0040] The nucleic acid encoding the polypeptide according to the present invention may also be used to generate transgenic animals, which express said polypeptide proteins in vivo. In one embodiment of this specific application, the transgenic animals may express the polypeptide having vWF protease activity in endogenous glands, for example in mammary glands from which the said proteins are secreted. In the case of the mammary glands, said proteins having vWF protease activity are secreted into the milk of the animals from which said proteins can be prepared. The animals may be mice, cattle, pigs, goats, sheep, rabbits or any other economically useful animal.
[0041] The vWF protease composition of the present invention can be used, for example, to process recombinantly produced vWF. Recombinant vWF (r-vWF) can be produced in CHO cells e.g. according to FEBS. Letter 375, 259-262 (1995). The r-vWF recovered in this manner is available as a mature vWF and has a singlet structure, i.e. it differs from plasma-derived vWF, which always has a characteristic satellite structure when examined on 2% SDS agarose gels. In International Patent Application No. WO 96/10584 describes that r-vWF is comprised of multimers with high structural integrity which is retained even after purification and treatment for the inactivation of viruses. The intact structure of the r-vWF is defined by a result of electrophoretic analysis consisting of multimer bands with an absence of satellite bands. To prepare an r-vWF preparation having a structure more closely corresponding to that of plasma-derived vWF from r-vWF with singlet structure, r-vWF is treated with the vWF protease composition of the present invention.
[0042] According to a further aspect of the present invention, the amino acid sequence and nucleotide sequence as shown in
EXAMPLES
Example 1: Method for Isolating vWF-Cleaving Proteolytic Peptides
1.1. Preparation of an IgG-eTTP-Coupled Affinity Gel
[0043] The IgG-eTTP was isolated by aid of a 20 ml protein A-Sepharose (diameter 1.6 cm) in TBS, pH 7.4.. Pheresis plasma of a patient suffering from acquired TTP (erworbenes TTP; eTTP), which previously had been assayed for its inhibitor content relative to the vWF-cleaving protease was applied to the column in a volume of 50 ml. After subsequent rinsing with TBS, pH 7.4, the bound IgGs were step wise eluted with citrate, 0.1 M, pH 4.0, and glycine, 0.1 M, pH 2.7. The fractions immediately were brought to a physiological pH by adding Tris, 1.5 M, pH 8.8, and dialysed against TBS, pH 7.4. The Affi-Gel Hz was coupled according to the producer's instructions with the IgG-eTTP which had been washed out of the protein A-Sepharose with a pH of 4.0. The column material prepared in this manner first was washed as prescribed, subsequently it was washed 3 times alternatingly with 50 ml of buffer B and 200 ml of buffer A (chapter 1.7). Prior to use, intensive rinsing with buffer A was carried out in each instance.
1.2 First Step
[0044] As the starting material, 100 ml of pooled CPD plasma which had come from at least three donors and had been stored at 20 C., was used after centrifuging at 2,500 rpm (1,100 g) for 5 min. At a relatively low flow rate (FR: 30 ml/h), the plasma was loaded on a 200 ml chromatographic column with IgG-eTTP Affi-Gel Hz (hydrazide, diameter 2.6 cm) which had been equilibrated in buffer A. After washing with at least 400 ml of buffer A over night at the same flow rate, a 200 ml desalting gel filtration column (Bio-Gel P-6DG, diameter 2.6 cm) and a 10 ml protein G-Sepharose (diameter 1.6 cm), which previously also had been rinsed with buffer A, was connected thereto. After the flow rate had been increased to 100 ml/h, the proteins bound to Affi-Gel Hz were eluted directly with 50 ml of buffer B onto the Bio-Gel P-6DG so as to remove from the proteins the NaSCN that had been in buffer B. The proteins which had been eluted from the desalting column prior to the NaSCN were led through the protein G Sepharose without interruption, where they were freed from the IgGs. Here, the flow rate was lowered to 50 ml/h so as to extend the dwelt time of the proteins in the 10 ml column. For regeneration, the protein G-Sepharose was shortly washed with buffer C, and the eluted IgG fraction was stored for analysis.
[0045] The first step was carried out 8 times before the collected fractions which had been frozen at 20 C. were pooled and further processed.
1.3 Second Step
[0046] The pooled fractions from 8 chromatographies of the first step were diluted 1:1 with H.sub.2O so as to obtain an ionic strength at which the desired proteins would bind to the anion exchange column (High Q Support). The sample whose volume was from 1,500 to 1,800 ml, depending on the charge used, was checked for its pH and its ionic strength and applied over night at a FR of 90 ml/h through a 50 ml column with Therasorb (diameter 1.6 cm) onto a 5 ml High Q Support (diameter 1.6 cm). Both, Therasorb and High Q Support had previously been equilibrated in buffer D. After washing with approximately 150 ml of buffer D, the Therasorb was disconnected, and the 25 ml Lentil Lectin Sepharose (diameter 1.6 cm) which had been equilibrated in buffer E was connected to follow the High Q Support. At a FR of 60 ml/h, the proteins bound to High Q Support were immediately eluted with buffer E directly to the Lentil Lectin-Sepharose. The proteins which bound to the Lentil Lectin-Sepharose could be eluted in two steps with buffers G and H and could be collected. The proteins which had remained bound to Therasorb and High Q Support were washed out with buffer C or buffer F, respectively, and discarded after an analysis.
[0047] For regeneration, before being used, the Lentil Lectin-Sepharose in each case was rinsed according to the producer's instruction 3 times alternatingly with 20 Mt each of buffers I and J, the High Q Support was rinsed successively with 10 ml each of NaOH 1N and NaCl 1M.
1.4 Third Step
[0048] The pooled fractions which had been eluted from the Lentil Lectin-Sepharose with buffer H were dialysed three times for a total: of 4 h, each against 1 l of buffer D, and again applied to the High Q Support at a flow rate of 60 ml/h. Connected thereinfront was a 5 ml heparin-Sepharose (diameter 1.4 cm), which likewise had been equilibrated in buffer D. After the application of the sample, it was rinsed with approximately 50 ml of buffer D, the heparin-Sepharose was disconnected, and a 500 ml Sephacryl S-300 HR (diameter 2.6 cm), which had been equilibrated in buffer L, was connected thereto. The proteins bound to High Q Support were directly eluted to the gel filtration column with 10 ml of buffer K. The exclusion chromatography was effected at a flow rate of 42 ml/h, and the fractions were collected at 7 ml each. The proteins which were more strongly bound to High Q Support were again eluted with buffer F, those which remained adhered to the heparin-Sepharose, with buffer K.
1.5 Fourth Step
[0049] The pool of the active fractions from the third step was applied without treatment at a FR of 10 ml/h to a 1 ml anti-.sub.2-macroglobulin column (flow rate 0.7 cm) which had been equilibrated in buffer L. The anti-.sub.2-macroglobulin column was prepared by immobilization according to the instructions, of rabbit-anti-.sub.2-macroglobulin antibodies at a concentration of 4.9 mg/ml on CNBr-activated Sepharose. The proteins bound thereon were eluted with NaSCN 3M in buffer L and with buffer C and stored for analysis.
1.5. Materials
[0050]
TABLE-US-00001 buffer A Tris 10 mM pH 7.4 NaCl 0.15M Na.sub.3-citrate 1 mM Na acid 0.02% buffer B NaSCN 3.0M pH 7.4 in buffer A buffer C glycine 0.1M pH 2.7 Na acid 0.02% buffer D Tris 10 mM pH 7.4 NaCl 75 mM buffer E Tris 20 mM pH 7.4 NaCl 0.5M MnCl.sub.2 1 mM buffer F Tris 10 mM pH 7.4 NaCl 1.0M buffer G Tris 20 mM pH 7.4 NaCl 0.5M Methyl--D-mannopyranoside 30 mM buffer H Tris 20 mM pH 7.4 NaCl 0.5M Methyl--D-mannopyranoside 0.3M buffer I Tris 20 mM pH 8.5 NaCl 0.5M buffer J Na acetate 20 mM pH 5.5 NaCl 0.5M buffer K Tris 10 mM pH 7.4 NaCl 0.5M buffer L (TBS) Tris 10 mM pH 7.4 NaCl 0.15M
Chromatographic Materials
[0051]
TABLE-US-00002 affi-gel hydrazide gel: for immobilizing specific Bio-Rad, Hercules, CA, USA IgG's anti-.sub.2-macroglobulin column: isolation of applicant's own production (see 1.5): .sub.2-macroglobulin rabbit-anti-human-.sub.2-macroglobulin antibody on CNBr activated Sepharose 4B; 4.9 mg/ml Bio-Gel P6-DG, medium: gel filtration Bio-Rad with exclusion limit 6 kDa CNBr activated Sepharose 4B: for Amersham Pharmacia Biotech, Uppsala, immobilizing proteins S heparin Sepharose, HITrap 5 ml: Amersham Parmacia affinity chromatography: binds various proteins High Q Support, Macro-Prep: strong Bio-Rad anion exchanger IgG-eTTP Affi-gel Hz: for binding vWF-protease applicant's own production (see 1.1.): IgG- eTTP on Affi-gel Hz hydrazide Lentil Lectin-Sepharose 4B: affinit Amersham Pharmacia chromatography: binds to sugar residues o proteins protein A Sepharose CL-4B. binds IgG of Amersham Pharmacia type 1, 2 and 4 protein G Sepharose 4FF: isolation of IgGs Amersham Pharmacia of all types Sephacryl S-300 HR: gel filtration for MWs Amersham Pharmacia 10,000 to 1,500,000 Therasorb: coupled with sheep-anti-human-Ig Serag-Wiessner, Naila, D antibodies: isolation of human immunoglobulins
1.6 Fifth Step
[0052] Alternatively, or in addition to step four, an anti-clusterin column chromatography as a further step can be applied. The samples were prepared identically to the anti-2-macrogluobulin-column using anti-clusterin antibodies.
2. SDS-Page Reduced/Non-Reduced
SDS-Polyacrylamide Gel-Electrophoresis (SDS-PAGE)
[0053] SDS-PAGE was done according to Lmmli. The separating gels were prepared having a size of 13.5 cm height, 15 cm width and 3 mm thickness, having the composition as follows:
[0054] Concentration of SDS-Polyacrylamide gel for a gradient gel of 4% to 12%:
TABLE-US-00003 Acrylamide 4% 12% N,N-Methylenebisacrylamide 0.107% 0.32% Tris (Tris(hydroxymethyl)aminomethane) 0.4M 0.4M APS (Ammoniumperoxydisulfate) 0.03% 0.03% SDS (Sodium Dodecyl Sulfate) 0.1% 0.1% Temed 0.067% 0.067% (N,N,N,N-Tetramethylethylenediamine) pH 8.7 pH 8.7
[0055] 30 ml of each of the 4% and 12% solutions, were poured between two glass plates.
[0056] After polymerization, the stacking get was prepared, having a height of 3 cm and having 16 slots. The volume of each slot was 150 l.
Stacking Gel
[0057]
TABLE-US-00004 Acrylamide 3% N,N-Methylenebisacrylamide 0.08% Tris 0.1M APS 0.03% SDS 0.1% Temed 0.2% pH 6.8
[0058] 100 l probe were mixed with 50 l buffer for the SDS-PAG and incubated 20 minutes at 60 C. Probes that had to be reduced were mixed with DTT (1,4-Dithio-DL-threitol), 65 mM before the solution was heated up.
Buffer for the SDS-PAGE
[0059]
TABLE-US-00005 Tris 0.15M SDS 4% Glycerin-87% 30% Bromine phenol blue few amounts pH 6.8
[0060] After heating, the probes were centrifuged, loaded onto the slots of the SDS PAG and covered with electrophoresis buffer. Electrophoresis was run over night in a vertical chamber system, using 60 V voltage.
Electrophoresis Buffer
[0061]
TABLE-US-00006 Tris 50 mM Glycine 0.38M EDTA (Titriplex III: ethylen- 2 mM dinitrilo tetra acetic acid- disodium salt -dihydrate) SDS 0.1% standard-pH 8.3
Silver Staining
[0062] The gels (13.5150.3 cm) were put into a tray containing a mixture of methanol (25%), acetic acid (7.5%), water (65.5%) and glycerin-87% (2%) (fixing solution) for at least 3 hours. Subsequently, the gets were rinsed 4-times with 200 ml water for 1 hour. Then the get was put into a sodium thio sulfate solution (0.02%), washed twice with water (1 min) and incubated 2-times 20 minutes with silver nitrate (0.1%) in water under constant shaking.
[0063] After rinsing with water for two times, the gel was shaken in a developing solution, consisting of sodium carbonate (2.5%) and formaldehyde-37% (0.04%) in water. The reaction was stopped with the fixing solution, as soon as the proteins were visible as gray to brown bands.
Example 2: Affinity Purification of von Willebrand Factor (vWF)
[0064] The peptide with the sequence AAGGILHLELLV was synthesized on a solid-phase support following the method of Barany, G and Merrifield, R. B. (1980) Solid-phase Peptide Synthesis, in The Peptides vol. 2 (Gross, E. and Meienhofer, J., eds) Academic, New York. After cleavage and de-protection of the peptide, the peptide was purified by ion-exchange chromatography. The peptide was characterized by reverse phase HPLC on a C8 silica column with gradient elution in trifluoro acetic acid with acetonitrile. The peptide showed no major byproducts.
[0065] The peptide was solubilized in a concentration of 5 mg/mL in 0.1 molar phosphate buffer pH 7.5 and incubated with a pre-activated gel suitable for affinity chromatography (Actigel, ALD-Superflow, Sterogene). Prior to coupling of the peptide to the gel the pre-activated matrix was excessively washed with the same phosphate buffer. One volume of the pre-washed gel was then mixed with one volume of the peptide solution to be immobilized and subsequently 0.1 volume portions of a solution of 0.1 molar cyanoborohydride (NaCNBH.sub.3) in 0.1 molar phosphate buffer pH 7.5. The gel was suspended in this solution and shaked for 15 hours at room temperature. Subsequently the gel was washed on a sinter funnel with a 10-fold volume of the phosphate buffer containing 150 mmolar NaCl and with 5 volumes of the phosphate buffer containing 2 molar NaCl. Then the gel was equilibrated with an access of 0.1 molar phosphate buffer pH 7.0.
[0066] The gel was then transferred into a chromatographic column having a dimension of diameter to get bed height of 1:4. By determining the peptide concentration the solution of the incubation supernatant after separation from the gel and the washing solutions the amount of peptide coupled to the affinity matrix was calculated. The coupling rate was 85%.
[0067] The gel was subsequently used to purify vWF from a Factor VIII (FVIII)/vWF complex. A FVIII/vWF complex concentrate was produced according to EP 0 270 516 containing vWF in a concentration of 260 U vWF:Ag/ml and a specific activity of 13.5 U vWF:Ag/mg Protein. The concentrate was diluted with 20 mM phosphate buffer pH 7.0 to a final vWF concentration of 6 U vWF:Ag/mL. A volume of 20 ml of this solution was subjected to the affinity column with immobilized peptide described above. After washing the column with 10 ml of the phosphate buffer the vWF specifically bound to the peptide ligand was eluted by a linear gradient from 0-2 mol/l NaCl in phosphate buffer at a flow rate of 1 ml/minute. Fractions of 1 ml were collected and their optical density was determined at 280 nm. All fractions were measured for their content of vWF antigen determined by a specific ELISA method (Asserachrom vWF, Boehringer, Mannheim). Measurement showed a specific peak of vWF eluting from the peptide at a NaCl concentration of 100 mmol/l, while most of the protein measured by UV-absorption eluted prior to the vWF fraction with the washing buffer. The vWF containing fractions were pooled and measured for vWF activity. The vWF in this pool had a specific activity of 95 U vWF/mg protein and was essentially free from other proteins.
Example 3: Anti-Peptide Antibodies
[0068] The peptide with the sequence AAGGILHLELLV was synthesized and purified as described in example 2. The peptide was then used to immunize 3 months old BALB/c mice with the following protocol: A primary subcutaneous injection of 100 g peptide antigen emulsified in Freund's complete adjuvant in 100 l followed by intra-peritoneal boosts of 100 g peptide antigen in phosphate buffered saline at monthly intervals.
[0069] The anti-peptide titer was tested by routine ELISA method using. purified peptide as screening antigen. After the final boost the spleens were taken from the mice for dell fusion. Cell fusion was carried out according to a standard protocol originally described by Kohler G. and Milstein C. 1975, Nature 256:495. Anti-peptide antibodies producing hybridoma cell lines were screened by standard techniques with the purified peptide as screening antigen essentially based on a conventional ELISA methodology. After cloning a cell line could be isolated with a high expression level of an antibody specific for the screening peptide with the sequence AAGGILHLELLV. This cell line was cultured on serum-free culture medium and grown to high density. The supernatant of the cell culture was harvested by centrifugation to remove cells and the monoclonal antibody containing supernatant was concentrated by ultra-diafiltration and conditioned for further use.
[0070] The monoclonal antibody obtained had a high selectivity for the vWF cleaving protease as described by Furlan et al. 1996, Blood 87:4223-4234. This monoclonal antibody was immobilized to a polystyrene ELISA plate in a carbonate/bi-carbonate buffer, 0.05 molar, pH 9.6, at a concentration of 5 g immunoglobuline/ml overnight (16 hours) at 4 C., with each 100 l of coating solution per well. The coating solution was removed from the wells and replaced by a solution of bovine serum albumin (BSA) at a concentration of 100 g/ml at a volume of 100 L per well, for 2 hours. The BSA solution was removed and the wells were washed with phosphate buffered saline. The pre-coated plates were then incubated with either samples of platelet poor plasma from healthy human plasma donors or platelet poor plasma from patients with an unclear diagnosis of either thrombotic thrombocytopenic purpura (TTP) or hemolytic uremic syndrome (HUS). After incubation of the plasma samples with the antibody coated ELISA plates as in a routine sandwich ELISA system, after 3 hours the plasma was removed from the wells. Wells were washed with phosphate buffered saline and incubated with the monoclonal antibody directed against the peptide with the sequence AAGGILHLELLV, conjugated with horse radish peroxidase following the method of Wilson, M. B. and Nakane, P. K. (1978) In Immunofluorescence and Related Staining Techniques. Knapp, W. Holubar, K. and Wick, G (eds), Elsevier/North Holland, Amsterdam, p. 215, and detected by the OPT reagent as described by Cathy D. and Raykundalia Ch. (1989) ELISA and related enzyme immunoassays, in Antibodies II a practical approach. Cathy D (ed), IRL Press Eynsharri Oxford England, p. 97.
[0071] Based on the level of the samples from the healthy human plasma donors a normal range was established. Plasmas from patients with HUS had a vWF protease activity equivalent to healthy humans while patients with TTP had a decreased protease activity as confirmed by an assay based on a different assay principle as described in WO00/509904.
Example 4: Amino Acid Sequencing and Amino Acid Analysis of the vWF Protease
[0072] The final protein preparation from the third step of isolation was electrophoresed on a 1.5 mm-thick SDS-polyacrylamide gel according to Laemmli (Laemmli UK., Nature, 1970, 227, pp. 680-685) A gradient of 4 to 12% polyacrylamide was used for fractionation of high molecular weight proteins, and a gradient of 8 to 12% polyacrylamide for low molecular weight proteins. After electrophoresis under non-reducing or reducing conditions (final concentration 65 mmol/l dithiotreitol), the proteins were blotted onto PVDF-membranes and stained, for 2 min with 0.25% Coomassie Blue in 45% methanol, 9% acetic acid and 46% H.sub.2O. After rinsing with: a Mixture of 50% methanol, 10% acetic acid and 40% H.sub.2O, the visible protein bands were cut out and analyzed on a Procise-cLC Sequencer (Foster City, Calif.) at the Chemical Institute of the University of Bern.
[0073] The N-terminal amino acid sequence of polypeptide bands separated by SDS-PAGE of purified vWF-cleaving protease is shown in table 1:
TABLE-US-00007 Molecularweight AminoAcidsequence 350kDaunreduced Ser-Val-Ser-Gly-Lys- Pro-Gln-Tyr-Met-Val* 150kDaunred. Ala-Ala-Gly-Gly-Ile 140kDaunred. Ala-Ala-Gly-Gly-Ile 130kDaunred. Ala-Ala-Gly-Gly-Ile 110kDaunred. Ala-Ala-Gly-Gly-Ile- Leu-His-Leu-Glu 70kDaunred. Asp/Ser-Gln/Leu-Thr/ Met-Val/Pro-Ser/Phe** 180kDareduced Ala-Ala-Gly-Gly-Ile- Leu-His-Leu-Glu 170kDareduced Ala-Ala-Gly-Gly-Ile 160kDareduced Ala-Ala-Gly-Gly-Ile- Leu-His-Leu-Glu-Leu- Leu-Val-Ala-Val-Gly 120kDareduced Ala-Ala-Gly-Gly-Ile- Leu-His-Leu-Glu-Leu- Leu-Val-Ala-Val-Gly 40kDareduced Asp-Gln-Thr-Val-Ser** *identified as 2-macroglobulin **identified as clusterin
[0074] Analysis of the composition of the amino acids was performed from the same sample as used for amino acid sequencing. The protein bands were hydrolyzed in the gas phase over 6 N HCl for 22 hours' at 110 C. and the amino acids were determined by high-performance liquid chromatography. Four unreduced polypeptide bands from SDS-PAGE of purified vWF-cp with M.sub.r 150, 140, 130, and 110 kDa were analyzed
[0075] The results are shown in Tab. 2:
TABLE-US-00008 No. residues/100 residues Amino acid 150 kDa 140 kDa 130 kDa 110 kDa Asx 6.7 7.0 7.4 8.3 Glx 12.2 12.0 12.8 11.8 Ser 8.4 8.9 8.8 9.2 Gly 11.8 12.1 12.1 12.9 His 2.5 2.3 2.5 2.4 Arg 8.3 7.6 8.1 7.2 Thr 5.6 5.5 5.6 5.7 Ala 10.1 9.5 9.6 8.2 Pro 8.9 8.5 8.3 8.1 Tyr 2.1 2.7 2.3 2.4 Val 7.0 6.9 6.7 6.5 Ile 2.7 2.9 2.6 3.0 Leu 10.0 9.9 9.1 9.7 Phe 2.6 2.8 2.6 3.2 Lys 1.0 1.3 1.3 1.4
Example 5: Search on Chromosome 9 Clone RP11-224N20 for Potential Exons of the vWF-Protease
[0076] The coding region of the N-terminus of the activated vWF protease (aminoacids A-A-G-G-I-L-H-L-E-L-L-V-A-V-G) was found on Chromosome 9 clone RP11-224N20 bases 156653 to 156697. Thus the nucleotide sequence from base 150001 to 185911 was screened for potential exons. Consecutive overlapping genome-segments with various lengths (1500 bases-5000 bases) were analysed using search engines that were queried via the internet-explorer. The genomic sequence segments, its translations and the results of the search were managed using the Vectors NTI Suite1 v.5.2 computer-program (Informax Inc., USA).
[0077] The first four exons of the search were translated into the corresponding amino add sequence and these sequences were searched for homologies. This search revealed that each sequence displays high homology with the amino acid sequence of the family of human disintegrin and metalloproteinases with thrombospondin motifs (ADAM-TS).
[0078] By alignments performed with the Vectors NTI Suite1 v.52-AlignX program (Informax Inc., USA), further potential exons were identified that encode for amino acid sequences that are homologous to segments of the human ADAM-TS sequences. Exons potentially encoding for the entire proteinase domain, for parts of the disintegrin like domain, the thrombospondin motif, the cystein-rich domain, as well as for three potential thrombospondin submotifs or a new ADAM-TS proteinase were thus identified. The succession of the exons on the genomic sequence was found to be consistant with the succession of the corresponding amino acid segments on the ADAM-TS consensus sequence.
Example 6: Cloning of the Gene Expressing the vWF-Protease Gene
[0079] Human salivary gland poly A+ RNA was purchased from Clontech. First strand cDNA was, obtained using Expand reverse transcriptase (Roche) and oligo d(T) primer according to the manufacturer's instructions. PCR was performed using 5CGGCGGGATCCTACACCTGG 3 and 5AATGGTGACTCCCAGGTCGA 3 as primers with 10 ng of salivary gland cDNA as template and 10 U of Hot Star Tag polymerase (Quiagen). The thermal cycling parameters were an initial incubation at 94 C. for 15 minutes followed by 45 cycles of 94 C. (50 sec), 50 C. (50 sec), 72 C. (2 min). PCR products were directly sequenced in both directions using the BigDye Terminator Cycle Sequencing Ready Reaction Kit (PerkinElmer Life Science).
[0080] The obtained DNA sequence was used to scan the genomic data base using BLAST (basic local alignment search tool) programs and matched to the chromosome 9 clone RP11-224N20. DNA sequence was translated to amino acids sequence using ExPASy proteomic tools. The DNA and translated amino acid sequences corresponding to 4 putative exons of chromosome 9q34 are shown in