CHEMICALLY MODIFIED CYSTATHIONINE BETA-SYNTHASE ENZYME FOR TREATMENT OF HOMOCYSTINURIA
20170065687 ยท 2017-03-09
Inventors
Cpc classification
A61K31/205
HUMAN NECESSITIES
A61K45/06
HUMAN NECESSITIES
A61K31/198
HUMAN NECESSITIES
A61P9/10
HUMAN NECESSITIES
A61K31/385
HUMAN NECESSITIES
C12N9/96
CHEMISTRY; METALLURGY
A61P43/00
HUMAN NECESSITIES
A61K9/0019
HUMAN NECESSITIES
A61K31/198
HUMAN NECESSITIES
A61K31/205
HUMAN NECESSITIES
A61K31/385
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
A61K47/60
HUMAN NECESSITIES
International classification
Abstract
The invention provides reagents and methods for enzyme replacement therapy using chemically modified species of human cystathionine -synthase (CBS) to treat homocystinuria and other related diseases and disorders.
Claims
1. A method for treating or ameliorating a disease, disorder, or condition associated with elevated homocysteine, the method comprising administering a composition comprising a carboxyl-terminal truncated polypeptide of a cystathionine--synthase (CBS) polypeptide comprising amino acid sequence SEQ ID NO: 2, said truncated CBS polypeptide comprising a carboxyl-terminal truncation of a non-conserved region, wherein said truncated CBS polypeptide is a chemically cleaved, enzymatically cleaved or genetically engineered truncate thereof, and wherein said truncated CBS polypeptide is covalently linked to one or a plurality of polyethylene glycol molecules, and each of the one or the plurality of polyethylene glycol molecules has a mass greater than or equal to 20 kDa.
2. The method of claim 1, wherein the disease, disorder, or condition associated with elevated homocysteine is mental retardation, osteoporosis, ectopia lentis, kyphoscoliosis, stroke, myocardial infarction, or pulmonary embolism.
3. The method of claim 1, wherein the composition further comprises anethole dithiolethione or betaine.
4. The method of claim 3, further comprising restriction to a relaxed protein restricted diet.
5. The method of claim 1, wherein the carboxyl-terminal truncated CBS polypeptide comprises SEQ ID NO: 3.
6. The method of claim 1, wherein the carboxyl-terminal truncated CBS polypeptide further comprises an amino-terminal truncation spanning any of amino acid residues 1-39 of SEQ ID NO: 2.
7. The method of claim 1, wherein the carboxyl-terminal truncation spans amino acid residues 401-551, 414-551, 442-551, 489-551, 497-551, 524-551, or 544-551 of SEQ ID NO: 2.
8. The method of claim 1, wherein the one or the plurality of polyethylene glycol molecules is ME-200MA0B, ME-400MA, GL2-400MA, GL4-400MA, GL2-800MA, ME-200GS, ME-200AL, or MEPA-20T.
9. A method for preventing a disease, disorder, or condition associated with elevated homocysteine, the method comprising administering a composition comprising a carboxyl-terminal truncated polypeptide of a cystathionine--synthase (CBS) polypeptide comprising amino acid sequence SEQ ID NO: 2, said truncated CBS polypeptide comprising a carboxyl-terminal truncation of a non-conserved region, wherein said truncated CBS polypeptide is a chemically cleaved, enzymatically cleaved or genetically engineered truncate thereof, and wherein said truncated CBS polypeptide is covalently linked to one or a plurality of polyethylene glycol molecules, and each of the one or the plurality of polyethylene glycol molecules has a mass greater than or equal to 20 kDa.
10. The method of claim 9, wherein the disease, disorder, or condition mediated by elevated homocysteine is mental retardation, osteoporosis, ectopia lentis, kyphoscoliosis, stroke, myocardial infarction, or pulmonary embolism.
11. The method of claim 9, wherein the composition further comprises anethole dithiolethione, betaine or serine.
12. The method of claim 9, wherein the carboxyl-terminal truncated CBS polypeptide comprises SEQ ID NO: 3.
13. The method of claim 9, wherein the carboxyl-terminal truncated CBS polypeptide further comprises an amino-terminal truncation spanning any of amino acid residues 1-39 of SEQ ID NO: 2.
14. The method of claim 9, wherein the carboxyl-terminal truncation spans amino acid residues 401-551, 414-551, 442-551, 489-551, 497-551, 524-551, or 544-551 of SEQ ID NO: 2.
15. The method of claim 9, wherein the one or the plurality of polyethylene glycol molecules is ME-200MA0B, ME-400MA, GL2-400MA, GL4-400MA, GL2-800MA, ME-200GS, ME-200AL, or MEPA-20T.
16. A composition comprising a carboxyl-terminal truncated cystathionine--synthase (CBS) polypeptide comprising amino acid sequence SEQ ID NO: 2, said truncated CBS polypeptide comprising a carboxyl-terminal truncation of a non-conserved region, wherein said truncated CBS polypeptide is a chemically cleaved, enzymatically cleaved or genetically engineered truncate thereof, and wherein said truncated CBS polypeptide is covalently linked to one or a plurality of polyethylene glycol molecules, and each of the one or the plurality of polyethylene glycol molecules has a mass greater than or equal to 20 kDa.
17. The composition of claim 16, wherein the carboxyl-terminal truncated CBS polypeptide comprises SEQ ID NO: 3.
18. The composition of claim 16, wherein the carboxyl-terminal truncated CBS polypeptide further comprises an amino-terminal truncation spanning any of amino acid residues 1-39 of SEQ ID NO: 2.
19. The composition of claim 16, wherein the carboxyl-terminal truncation spans amino acid residues 401-551, 414-551, 442-551, 489-551, 497-551, 524-551, or 544-551 of SEQ ID NO: 2.
20. The composition of claim 16, wherein the one or the plurality of polyethylene glycol molecules is ME-200MA0B, ME-400MA, GL2-400MA, GL4-400MA, GL2-800MA, ME-200GS, ME-200AL, or MEPA-20T.
Description
BRIEF DESCRIPTION OF THE DRAWINGS OF THE INVENTION
[0025] The following detailed description of the embodiments of the present invention can be best understood when read in conjunction with the following drawings.
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
DETAILED DESCRIPTION
[0041] Provided herein are compositions, specifically pharmaceutical compositions, and methods for treating patients with homocystinuria, for example, by enzyme replacement therapy (ERT).
[0042] The nucleic acid sequence encoding human CBS and the amino acid sequence encoded thereby are available through GenBank Accession No. L19501, and these sequences are also disclosed in U.S. Pat. No. 5,523,225, which is incorporated herein by reference in its entirety. The coding sequence for CBS is represented herein as SEQ ID NO: 1, and is a nucleic acid sequence encoding SEQ ID NO: 2, which is the amino acid sequence for full-length human CBS, having 551 amino acid residues. The nucleic acid sequence of the genomic DNA encoding CBS is also publicly available through sequence databases such as Genbank and at University of Colorado-Denver webpage under Kraus Lab.
[0043] As used herein, an isolated protein or polypeptide in the invention is specifically a truncated version of isolated cystathionine -synthase protein (CBS protein), particularly human CBS protein. Such a CBS protein can include, but is not limited to, purified truncated CBS protein, chemically cleaved and recombinantly produced truncated CBS protein, and isolated CBS protein associated with other proteins. More specifically, an isolated protein, according to the present invention, is a protein (including a polypeptide or peptide) that has been removed from its natural milieu (i.e., that has been subject to human manipulation) and can include purified proteins, partially purified proteins, recombinantly produced proteins, and synthetically produced proteins, for example. As such, isolated does not reflect the extent to which the protein has been purified. An isolated truncated CBS protein of the present invention can be produced recombinantly in cells, for example bacterial cells. In addition, and by way of example, a human truncated CBS protein refers to a truncated CBS protein (as set forth herein) from a human (Homo sapiens) or to a CBS protein that has been otherwise produced from the knowledge of the structure (e.g., sequence) and perhaps the function of a naturally occurring CBS protein from Homo sapiens. In other words, a human truncated CBS protein includes biologically active, truncated human CBS protein as described in detail herein.
[0044] As used herein, the term homologue (or variant or mutant) is used to refer to a protein or peptide which differs from a naturally occurring protein or peptide (i.e., the prototype or wild-type protein) by modifications to the naturally occurring protein or peptide, but which maintains the basic protein and side chain structure of the naturally occurring form. Such changes include, but are not limited to: changes in one, few, or even several amino acid side chains; changes in one, few or several amino acids; changes in stereochemistry of one or a few atoms; and/or minor derivatizations, including but not limited to: methylation, glycosylation, phosphorylation, acetylation, myristoylation, prenylation, palmitation, amidation and/or addition of glycosylphosphatidyl inositol. A homologue can have enhanced, decreased, changed, or essentially similar properties as compared to the naturally occurring protein or peptide. In particular embodiments, the invention provides truncated CBS proteins having C-terminal deletions of the naturally occurring CBS protein.
[0045] Methods to measure protein expression levels of CBS according to the invention include, but are not limited to Coomasie blue or silver staining of protein in a separation media, such as gel electrophoresis, Western blotting, immunocytochemistry, other immunologic-based assays; assays based on a property of the protein including but not limited to, enzyme assays, ligand binding or interaction with other protein partners. Binding assays are also well known in the art. For example, a BIAcore instrument can be used to determine the binding constant of a complex between two proteins. The dissociation constant for the complex can be determined by monitoring changes in the refractive index with respect to time as buffer is passed over the chip. Other suitable assays for measuring the binding of one protein to another include, for example, immunoassays such as enzyme linked immunoabsorbent assays (ELISA) and radioimmunoassays (RIA), or determination of binding by monitoring the change in the spectroscopic or optical properties of the proteins through fluorescence, UV absorption, circular dichrosim, or nuclear magnetic resonance (NMR).
[0046] In certain aspects, a CBS variant can include any combination of the N-terminal deletions or modifications and the C-terminal deletions described herein or in U.S. Pat. No. 8,007,787, incorporated by reference herein. In another embodiment additional modifications can be achieved by modification of other amino acid residues to provide a given percent identity to the wild-type CBS sequence. In particular embodiments, the human CBS variant of the invention is a truncated recombinant human CBS (r-hCBSC) homodimeric enzyme wherein the C-terminal regulatory region has been removed (SEQ ID NO: 3).
[0047] In another aspect of the invention, any of the CBS variants described herein has no more than one or two non-CBS amino acid residues at the N-terminus (i.e., the variant comprises no more than one or two amino acid residues at the N-terminus that is/are not a residue of the naturally occurring human cystathionine -synthase amino acid sequence at that position). Such a variant can be produced, for example, using the novel method of recombinant CBS production described below.
[0048] In a further aspect, any of the above-described CBS variants of the present invention, including any truncated CBS protein, comprises an amino acid sequence that is at least about 60% identical, or at least about 65% identical, or at least about 70% identical, or at least about 75% identical, or at least about 80% identical, or at least about 85% identical, or at least about 90% identical, or at least about 95% identical, or at least about 96% identical, or at least about 97% identical, or at least about 98% identical, or at least about 99% identical, to the wild-type amino acid sequence represented by SEQ ID NO:2, or to a biologically active truncation thereof (including non-heme-binding, but catalytically active variants). In particular embodiments, the human CBS variant of the invention is a truncated recombinant human CBS (r-hCBSC) homodimeric enzyme wherein the C-terminal regulatory region has been removed (SEQ ID NO: 3).
[0049] In certain aspects, a CBS protein of the present invention comprises an amino acid sequence that is less than 100% identical to SEQ ID NO: 2, particularly truncated embodiments thereof having an amino acid sequence of the truncation variants as set forth in U.S. Pat. No. 8,007,747 and particularly SEQ ID NO: 3 set forth herein, and in specific embodiments having less than 99% sequence identity, less than 98% sequence identity, less than 97% sequence identity, less than 96% sequence identity, less than 95% sequence identity, less than 94% sequence identity, less than 93% sequence identity, less than 92% sequence identity, less than 91% sequence identity, less than 90% sequence identity, and so on, in increments of whole integers, to SEQ ID NO: 2 and truncated variants thereof having an amino acid sequence of the truncation variants as set forth in U.S. Pat. No. 8,007,747 and particularly SEQ ID NO: 3 set forth herein.
[0050] As used herein, unless otherwise specified, reference to a percent (%) identity refers to an evaluation of homology which is performed using a sequence alignment tool or program, including but not limited to (1) a BLAST 2.0 Basic BLAST homology search using blastp for amino acid searches and blastn for nucleic acid searches with standard default parameters, wherein the query sequence is filtered for low complexity regions by default; (2) a BLAST 2 alignment (using the parameters described below); (3) and/or PSI-BLAST with the standard default parameters (Position-Specific Iterated BLAST. It is noted that due to some differences in the standard parameters between BLAST 2.0 Basic BLAST and BLAST 2, two specific sequences might be recognized as having significant homology using the BLAST 2 program, whereas a search performed in BLAST 2.0 Basic BLAST using one of the sequences as the query sequence may not identify the second sequence in the top matches. In addition, PSI-BLAST provides an automated, easy-to-use version of a profile search, which is a sensitive way to look for sequence homologues. The program first performs a gapped BLAST database search. The PSI-BLAST program uses the information from any significant alignments returned to construct a position-specific score matrix, which replaces the query sequence for the next round of database searching. Therefore, it is to be understood that percent identity can be determined by using anyone of these programs.
[0051] CBS derivatives are included in the scope of the present invention. Such derivatives are chemically modified CBS polypeptide compositions in which CBS polypeptide is linked to a polymer. The polymer selected is typically water-soluble so that the protein to which it is attached does not precipitate in an aqueous environment, such as a physiological environment. The polymer may be of any molecular weight, and may be branched or unbranched. Included within the scope of CBS polypeptide polymers is a mixture of polymers. In specific embodiments, for therapeutic use of the end-product preparation, the polymer will be pharmaceutically acceptable.
[0052] The water soluble polymer or mixture thereof may be selected from the group consisting of, for example, polyethylene glycol (PEG), monomethoxy-polyethylene glycol, dextran (such as low molecular weight dextran, of, for example about 6 kDa), cellulose, or other carbohydrate based polymers, poly-(N-vinyl pyrrolidone) polyethylene glycol, propylene glycol homopolymers, a polypropylene oxide/ethylene oxide co-polymer, polyoxyethylatedpolyols (e.g., glycerol), polysalicylic acid, and polyvinyl alcohol. Also encompassed by the invention are bifunctional PEG cross-linking molecules that may be used to prepare covalently attached CBS polypeptide multimers.
[0053] In particular embodiments, the invention provides a truncated recombinant human CBS (r-hCBSC) homodimeric enzyme wherein the C-terminal regulatory region has been removed (SEQ ID NO: 3) that has been chemically modified by covalent linkage with polyethylene glycol (PEG), comprising the PEGylated species set forth herein. Specific embodiments of said PEGylated species are identified in Table 1.
[0054] Pegylation of CBS polypeptides may be carried out by any of the pegylation reactions known in the art. Pegylation may be carried out via an acylation reaction or an alkylation reaction with a reactive polyethylene glycol molecule (or an analogous reactive water-soluble polymer) as described below. For the acylation reactions, the polymer(s) selected should have a single reactive ester group. For reductive alkylation, the polymer(s) selected should have a single reactive aldehyde group. A reactive aldehyde is, for example, polyethylene glycol propionaldehyde, which is water stable, or mono C.sub.1-C.sub.10 alkoxy or aryloxy derivatives thereof.
[0055] One water-soluble polymer for use herein is polyethylene glycol, abbreviated PEG. As used herein, polyethylene glycol is meant to encompass any of the forms of PEG that have been used to derivatize other proteins, such as mono-(C.sub.1-C.sub.10) alkoxy- or aryloxy-polyethylene glycol.
[0056] In general, chemical derivatization may be performed under any suitable conditions used to react a biologically active substance with an activated polymer molecule. Methods for preparing PEGylated CBS polypeptides will generally comprise the steps of (a) reacting the polypeptide with polyethylene glycol (such as a reactive ester, amine, aldehyde or maleimide derivative of PEG) under conditions whereby CBS polypeptide becomes attached to one or more PEG groups, and (b) obtaining the reaction product(s). In general, the optimal reaction conditions for the acylation reactions will be determined based on known parameters and the desired result. For example, the larger the ratio of PEG: protein, the greater the percentage of poly-PEGylated product. In one particular aspect, the CBS polypeptide derivative will have a single PEG moiety at the amino terminus. In particular embodiments, the PEGylated CBS enzyme provided by the invention has an average of about 1 to about 10, more particularly 2 to about 5 and more particularly 3 to 5 PEG molecules covalently attached to each enzyme subunit in the composition.
[0057] Proteins of the present invention are preferably retrieved, obtained, and/or used in substantially pure form. As used herein, substantially pure refers to a purity that allows for the effective use of the protein in vitro, ex vivo or in vivo according to the present invention. For a protein to be useful in an in vitro, ex vivo or in vivo method according to the present invention, it is substantially free of contaminants, other proteins and/or chemicals that might interfere or that would interfere with its use in a method disclosed by the present invention, or that at least would be undesirable for inclusion with an CBS protein (including homologues) when it is used in a method disclosed by the present invention. Such methods include enzymatic reactions (e.g., production of cystathionine), preparation of therapeutic compositions, administration in a therapeutic composition, and all other methods disclosed herein. A substantially pure protein, as referenced herein, is a protein that can be produced by any method (i.e., by direct purification from a natural source, recombinantly, or synthetically), and that has been purified from other protein components such that the protein comprises at least about 80% weight/weight of the total protein in a given composition (e.g., the CBS protein is about 80% of the protein in a solution/composition/buffer), and more preferably, at least about 85%, and more preferably at least about 90%, and more preferably at least about 91%, and more preferably at least about 92%, and more preferably at least about 93%, and more preferably at least about 94%, and more preferably at least about 95%, and more preferably at least about 96%, and more preferably at least about 97%, and more preferably at least about 98%, and more preferably at least about 99%, weight/weight of the total protein in a given composition. In embodiments of the CBS proteins or truncated variants thereof produced in recombinant bacteria, the terms purified or substantially pure will be understood to encompass purification from lipopolysaccharides and other pyrogenic compounds.
[0058] It will be appreciated by one skilled in the art that use of recombinant DNA technologies can improve control of expression of transfected nucleic acid molecules by manipulating, for example, the number of copies of the nucleic acid molecules within the host cell, the efficiency with which those nucleic acid molecules are transcribed, the efficiency with which the resultant transcripts are translated, and the efficiency of posttranslational modifications. Additionally, the promoter sequence might be genetically engineered to improve the level of expression as compared to the native promoter.
[0059] Recombinant techniques useful for controlling the expression of nucleic acid molecules include, but are not limited to, integration of the nucleic acid molecules into one or more host cell chromosomes, addition of vector stability sequences to plasmids, substitutions or modifications of transcription control signals (e.g., promoters, operators, enhancers), substitutions or modifications of translational control signals (e.g., ribosome binding sites, Shine-Dalgarno sequences), modification of nucleic acid molecules to correspond to the codon usage of the host cell, and deletion of sequences that destabilize transcripts.
[0060] One aspect of the present invention relates to a method to recombinantly produce and purify a human cystathionine -synthase. The method includes the step of cloning a nucleic acid sequence encoding a human CBS enzyme or a truncated variant thereof as set forth in U.S. Pat. No. 8,007,747 and specifically in SEQ ID NO: 4 herein into an expression vector. In certain embodiments the human CBS-encoding sequence has been modified to utilize codons optimized for expression in a microorganism such as E. coli. In other embodiments the vector includes: (a) a cloning site that will link a fusion partner (e.g., glutathione S-transferase, or GST) to the nucleic acid sequence to be expressed, and (b) a protease cleavage recognition site for the human rhinovirus 3C protease (e.g., available from GE Healthcare as a fusion protein called PreScission protease) or for a protease using a similar cleavage site, for cleaving the fusion partner from the CBS protein after expression of the recombinant fusion protein. As part of the invention, the expression vector is first genetically modified for the specific introduction of a CBS-encoding nucleic acid sequence which will result in expression of a CBS-fusion protein that can be cleaved by the human rhinovirus 3C protease such that a CBS protein having only one additional non-CBS, N-terminal amino acid residue is produced. This result is not possible using the unmodified multiple cloning site in the commercially available vector. The CBS-encoding nucleic acid sequence is introduced into the genetically modified vector, the recombinant fusion protein is expressed and purified using conventional methods or those suitable for CBS production (see e.g. U.S. Pat. No. 5,635,375, supra), and finally, the fusion partner and all but one of the non-CBS amino acid residues is cleaved from the CBS protein, leaving a highly purified, nearly completely human recombinant CBS protein which is ideal for use in human therapeutic applications. In particularly advantageous embodiments, the nucleotide encoding human CBS protein is engineered to the codon usage frequency of the recombinant cell in which it is recombinantly made. A non-limiting example of such an embodiment is set forth herein as SEQ ID NO: 4, wherein the CBS-encoding nucleic acid has been adapted for optimum recombinant expression in E. coli.
[0061] Some aspects of the present invention include a composition comprising any of the CBS variants described herein for in vitro cystathionine or cysteine production, to remove or produce hydrogen sulfide in vitro, or for therapeutic uses in vivo (e.g., to treat or prevent homocystinuria and conditions related thereto). Therefore, another embodiment of the invention relates to a composition comprising an isolated CBS protein and in particular a truncated variant thereof as set forth in U.S. Pat. No. 8,007,747 and specifically in SEQ ID NO: 3 herein. The composition typically also includes a pharmaceutically acceptable carrier. The compositions and their components can be used in any of the in vitro or therapeutic embodiments of the invention described herein.
[0062] As used herein, HO mice are a new mouse model of classical homocystinuria in which the mouse cbs gene is inactivated and that exhibits low-level expression of the human CBS transgene under the control of the human CBS promoter. This mouse model exhibits severe elevations in both plasma and tissue levels of Hcy, methionine, S-adenosylmethionine, and S-adenosylhomocysteine and a concomitant decrease in plasma and hepatic levels of cysteine. See Maclean et al., 2010 Mol. Genet. Metab. 101:153-62).
[0063] Compositions of the present invention are useful for producing cystathionine and cysteine in vitro or for treating a patient that will benefit from increased CBS activity (e.g., a patient with homocystinuria).
[0064] According to the present invention, a pharmaceutically acceptable carrier includes pharmaceutically acceptable excipients and/or pharmaceutically acceptable delivery vehicles, which are suitable for use in administration of the composition to a suitable in vitro, ex vivo or in vivo site. A suitable in vitro, in vivo or ex vivo site is preferably any site where it is desirable to regulate CBS activity. Pharmaceutically acceptable carriers are capable of maintaining a protein or recombinant nucleic acid molecule of the present invention in a form that, upon arrival of the protein or recombinant nucleic acid molecule at the target cell or tissue in a culture or in patient, the protein or recombinant nucleic acid molecule is capable of interacting with its target (e.g., a substrate for CBS).
[0065] Suitable excipients of the present invention include excipients or formularies that transport or help transport, but do not specifically target a composition to a cell (also referred to herein as non-targeting carriers). Examples of pharmaceutically acceptable excipients include, but are not limited to water, phosphate buffered saline, Ringer's solution, dextrose solution, serum-containing solutions, Hank's solution, other aqueous physiologically balanced solutions, oils, esters and glycols. Aqueous carriers can contain suitable auxiliary substances required to approximate the physiological conditions of the recipient, for example, by enhancing chemical stability and isotonicity. Compositions of the present invention can be sterilized by conventional methods and/or lyophilized.
[0066] One type of pharmaceutically acceptable carrier includes a controlled release formulation that is capable of slowly releasing a composition of the present invention into a patient or culture. As used herein, a controlled release formulation comprises a compound of the present invention (e.g., a protein (including homologues), an antibody, a nucleic acid molecule, or a mimetic) in a controlled release vehicle. Suitable controlled release vehicles include, but are not limited to, biocompatible polymers, other polymeric matrices, capsules, microcapsules, microparticles, bolus preparations, osmotic pumps, diffusion devices, liposomes, lipospheres, and transdermal delivery systems. Other carriers of the present invention include liquids that, upon administration to a patient, form a solid or a gel in situ. In specific embodiments, carriers are also biodegradable (i.e., bioerodible). When the compound is a recombinant nucleic acid molecule, suitable carriers include, but are not limited to liposomes, viral vectors or other carriers, including ribozymes, gold particles, poly-L-lysine/DNA-molecular conjugates, and artificial chromosomes. Natural lipid-containing carriers include cells and cellular membranes. Artificial lipid-containing carriers include liposomes and micelles.
[0067] A carrier of the present invention can be modified to target to a particular site in a patient, thereby targeting and making use of a protein of the present invention at that site. A pharmaceutically acceptable carrier that is capable of targeting can also be referred to herein as a delivery vehicle or targeting carrier. Suitable modifications include manipulating the chemical formula of the lipid portion of the delivery vehicle and/or introducing into the vehicle a targeting agent capable of specifically targeting a delivery vehicle to a preferred site or target site, for example, a preferred cell type. A target site refers to a site in a patient to which one desires to deliver a composition. Alternatively, said pharmaceutically acceptable carriers can comprise agents suitable for delivering said CBS proteins to an animal, preferably a human, in blood plasma or serum. Suitable targeting compounds include ligands capable of selectively (i.e., specifically) binding another molecule at a particular site. Examples of such ligands include antibodies, antigens, receptors and receptor ligands. Manipulating the chemical formula of the lipid portion of the delivery vehicle can modulate the extracellular or intracellular targeting of the delivery vehicle. For example, a chemical can be added to the lipid formula of a liposome that alters the charge of the lipid bilayer of the liposome so that the liposome fuses with particular cells having particular charge characteristics. In specific embodiments, liposomes of the present invention include those liposomes commonly used in, for example, protein delivery methods known to those of skill in the art. Complexing a liposome with a protein of the present invention can be achieved using methods standard in the art.
[0068] Another embodiment of the present invention relates to a method to regulate biological processes, including cystathionine production, by regulating the expression and/or activity of CBS. This embodiment can generally include the use (e.g., administration) of therapeutic compositions comprising one or more of the CBS variants, particularly truncated CBS variants thereof as set forth in U.S. Pat. No. 8,007,747 and specifically in SEQ ID NO: 3 herein that are useful in a method of regulating the production of cystathionine that are mediated by or associated with the expression and biological activity of CBS.
[0069] Accordingly, in one embodiment, the method of the present invention regulates cystathionine production in an animal or human patient, wherein patient is protected from or treated for a disease that is amenable to regulation of cystathionine production, such as homocystinuria and conditions/symptoms related thereto (e.g., dislocated optic lenses, skeletal disorders, mental retardation and premature arteriosclerosis and thrombosis). As used herein, the phrase protected from a disease refers to reducing the symptoms of the disease; reducing the occurrence of the disease, and/or reducing the severity of the disease. Protecting a patient can refer to the ability of a therapeutic composition of the present invention, when administered to a patient, to prevent a disease from occurring and/or to cure or to treat the disease by alleviating disease symptoms, signs or causes. As such, to protect a patient from a disease includes both preventing disease occurrence (prophylactic treatment) and treating a patient that has a disease or that is experiencing initial symptoms or later stage symptoms of a disease (therapeutic treatment). The term, disease refers to any deviation from the normal health of a patient and includes a state when disease symptoms are present, as well as conditions in which a deviation (e.g., in non-limiting examples including infection, gene mutation, and genetic defect, etc.) has occurred, but symptoms are not yet manifested (e.g., a predisease condition).
[0070] More specifically, a therapeutic composition as described herein, when administered to a patient by the method of the present invention, preferably produces a result which can include alleviation of the disease (e.g., reduction of at least one symptom or clinical manifestation of the disease), elimination of the disease, alleviation of a secondary disease resulting from the occurrence of a primary disease, or prevention of the disease. In an additional aspect, administration of the therapeutic composition can produce a result that can include increased accumulation of downstream metabolites of transsulfuration in a mammal.
[0071] According to the present invention, an effective administration protocol (i.e., administering a therapeutic composition in an effective manner) comprises suitable dose parameters and modes of administration that result in the desired effect in the patient (e.g., an increase in the activity of cystathionine -synthase in the patient or an increase in the condensation of serine and homocysteine to form cystathionine, preferably so that the patient is protected from the disease (e.g., by disease prevention or by alleviating one or more symptoms of ongoing disease). Effective dose parameters can be determined using methods standard in the art for a particular disease. Such methods include, for example, determination of survival rates, side effects (i.e., toxicity) and progression or regression of disease.
[0072] In accordance with the present invention, a suitable single dose size is a dose that results in regulation of CBS activity or formation of cystathionine or cysteine in a patient, or in the amelioration of at least one symptom of a condition in the patient, when administered one or more times over a suitable time period. Doses can vary depending upon the disease being treated. One of skill in the art can readily determine appropriate single dose sizes for a given patient based on the size of a patient and the route of administration.
[0073] In one aspect of the invention, a suitable single dose of a therapeutic composition of the present invention is an amount that, when administered by any route of administration, regulates at least one parameter of CBS expression or biological activity in the cells of the patient as described above, as compared to a patient which has not been administered with the therapeutic composition of the present invention (i.e., a pre-determine control patient or measurement), as compared to the patient prior to administration of the composition, or as compared to a standard established for the particular disease, patient type and composition. The administered therapeutic composition is enzymatically active for an extended period of time. This period of time preferably exceeds 24 hours. The chemically modified therapeutic composition retains 70% or more of the initial activity of the administered composition after 24 hours. More preferably the period of enzymatic effective activity of the administered therapeutic composition exceeds 48 hours. Even more preferably the period of effective enzymatic activity of the administered therapeutic composition exceeds 72 hours. In certain aspects, the therapeutic composition may be administered several (e.g., twice or three or more) times per day or less frequently, including but not limited to weekly, biweekly, monthly, bimonthly or less frequently. In another aspect of the invention, a suitable dose of the therapeutic composition of the invention can administered in conjunction with betaine (such as CYSTADANE), a much relaxed protein restricted diet, an anti-coagulant, or a statin.
[0074] As discussed above, a therapeutic composition of the present invention is administered to a patient in a manner effective to deliver the composition to a cell, a tissue, and/or systemically to the patient, whereby the desired result is achieved as a result of the administration of the composition. Suitable administration protocols include any in vivo or ex vivo administration protocol. The preferred routes of administration will be apparent to those of skill in the art, depending on the type of condition to be prevented or treated; whether the composition is nucleic acid based, protein based, or cell based; and/or the target cell/tissue. For proteins, methods of in vivo administration include parenteral administration, specifically including but not limited to, intravenous administration, intraperitoneal administration, intramuscular administration, intranodal administration, intracoronary administration, intraarterial administration (e.g., into a carotid artery), subcutaneous administration, intraarticular administration, intraventricular administration, and direct injection into a tissue. Combinations of routes of delivery can be used and in some instances, may enhance the therapeutic effects of the composition.
[0075] Many of the above-described routes of administration, including intravenous, intraperitoneal, intradermal, and intramuscular administrations can be performed using methods standard in the art.
[0076] One method of local administration is by direct injection. Direct injection techniques are particularly useful for administering a composition to a cell or tissue that is accessible by surgery, and particularly, on or near the surface of the body. Administration of a composition locally within the area of a target cell refers to injecting the composition centimeters and preferably, millimeters from the target cell or tissue.
[0077] In the method of the present invention, therapeutic compositions can be administered to any member of the Vertebrate class, Mammalia, including, without limitation, primates, rodents, livestock and domestic pets. Livestock include mammals to be consumed or that produce useful products (e.g., sheep for wool production). Preferred patients to protect include humans.
[0078] Each reference described and/or cited herein is incorporated by reference in its entirety.
[0079] The following examples are provided for the purpose of illustration and are not intended to limit the scope of the present invention.
TABLE-US-00001 TABLE 1 Designation Target groups Molecular weight (daltons) ME-200MA0B SH 20,000 ME-020MA SH 2,000 ME-400MA SH 40,000 GL2-400MA SH 40,000 GL4-400MA SH 40,000 GL2-800MA SH 80,000 ME-050GS NH.sub.2, OH, OH 5,000 ME-200GS NH.sub.2, OH, SH 20,000 ME-200AL NH.sub.2 20,000 MEPA-20T COOH 20,000
EXAMPLES
Example 1
Production of Truncated CBS Protein in Bacteria
[0080] a. Recombinant Expression of Truncated CBS Protein in Bacteria
[0081] A truncated human CBS variant lacking specific portions of the non-conserved regions (r-hCBSC; SEQ ID No: 3) was constructed and over-expressed using the previously described E. coli based expression system (Kozich and Kraus, 1992, supra Constructs encoding the truncated human CBS protein variant r-hCBSC (SEQ ID NO: 4) were generated by a modification of the previously described pHCS3 CBS expression construct (Kozich and Kraus, 1992, Hum. Mutat. 1:113-123) which contains the CBS full-length coding sequence (SEQ ID NO: 1) cloned into pKK388.1. To generate C-terminal deletion constructs, CBS cDNA fragments spanning the desired nucleotide residues were amplified using primers incorporating Sph I and Kpn I sites to the 5 and 3 respective ends of the PCR product. All PCR products were then cut with Sph I and Kpn I and cloned by ligation into the pHCS3 vector digested with Sph I and Kpn I. An Sph I site naturally occurs in the CBS cDNA, just upstream of the antisense primer hybridization site (base pair position 1012, according to the CBS cDNA numbering SEQ ID NO: 1). PCR products thus generated were then digested with Nco I and Sph I and ligated into the pHCS3 plasmid cut with the same enzymes.
TABLE-US-00002 pKKCBS414-551 (SEQIDNO:5) Sense:CGTAGAATTCACCTTTGCCCGCATGCTGAT (SphIrestrictionsiteinbold) (SEQIDNO:6) Antisense:TACGGGTACCTCAACGGAGGTGCCACCACCAGGGC (KpnIrestrictionsiteinbold)
[0082] Finally, the construct was transformed into E. coli BL21 (Stratagene). The authenticity of the construct was verified by DNA sequencing using a Thermo Sequenase Cy5.5 sequencing kit (Amersham Pharmacia Biotech) and the Visible Genetics Long-Read Tower System-V3.1 DNA sequencer according to the manufacturer's instructions.
[0083] For bacterial expression analysis of CBS deletion mutants, growth of E. coli BL21 cells bearing the CBS truncation mutant construct, induction of expression and the generation of crude cell lysates were performed as described previously (Maclean et al., 2002, Hum. Mutat. 19:641-55).
[0084] An alternative method was also employed to make a sequence-optimized, truncated human CBS enzyme (r-hCBSC; SEQ ID No: 3) in a pET28a (+) vector. The full length (551 aa) human CBS coding sequence was optimized for bacterial expression and cloned into the pUC57 vector following digestion with the EcoRV restriction enzyme, by GenScript USA Inc. (NJ, USA). The CBS sequence was then amplified by PCR using primers A1 and A2 to generate a sequence coding for the truncated enzyme (aa 1-413):
[0085] Primers:
TABLE-US-00003 A1 (SEQIDNO:7) 5 agtcgcCCATGGcgtcagaaaccccgcag3 NcoIrestrictionsiteinCAPs.BoldGmutatedto C(forproline). A2 (SEQIDNO:8) 5 atcgcgCTCGAGttagcgcaggtgccaccac3 XhoIrestrictionsiteinCAPs,followedbyTTA forstopcodon
[0086] The PCR product was then digested with the restriction enzymes NcoI and XhoI, and ligated into the pET-28a(+) vector (commercially available from EMD Millipore, Billerica, Mass.) that was digested with the same enzymes. Cloning into the optimal NcoI site of pET-28a(+) results in a G.fwdarw.C mutation as compared to the CBS wild-type sequence (coding for alanine instead of proline). Accordingly, a Site-Directed Mutagenesis kit (Stratagene, Calif., USA) utilizing primers B1 and B2 was used to re-generate the wild type sequence to code for proline:
TABLE-US-00004 B1 (SEQIDNO:9) 5 GGAGATATACCATGCCGTCAGAAACCCCGC3 B2 (SEQIDNO:10) 5 GCGGGGTTTCTGACGGCATGGTATATCTCC3
[0087] The full sequence of the optimized, truncated human CBS enzyme was then verified by sequencing.
[0088] Expression of the truncated CBS is controlled by the upstream T7 promoter in the pET-28a(+) vector, and requires transformation into DE3 bacteria and induction by IPTG.
[0089] b. Expression of the Sequence-Optimized, Truncated Human CBS Enzyme
[0090] The pET-28a(+) vector, harboring the sequence coding for the truncated human CBS, was transformed into DE3 bacteria, i.e., HMS174(DE3), and kanamycin-resistant clones were selected and maintained as stock glycerol at 80 C. for further use.
[0091] Bacteria from stock glycerol was grown in 5 ml of Luria-Bertani (LB) medium, containing 30 ug/ml kanamycin, overnight at 37 C. on a rotational shaker at 275 RPM. The next morning, 1 ml of the overnight culture was added to a 100 ml Terrific Broth (TB) medium containing 30 ug/ml kanamycin and grown overnight as described above. 10 ml of the overnight culture was then added to a 1 liter TB medium containing the following supplements: [0092] 0.001% of thiamine-HCl pH 8.0 [0093] 0.0025% of pyridoxine-HCl pH 8.0 [0094] 0.3 mM -(aminolevulinic acid) (-ALA) pH 8.0 [0095] 150 M ferric chloride [0096] 30 ug/ml of kanamycin
[0097] The 1 liter culture was then grown at 30 C. on a rotational shaker at 275 RPM until OD.sub.600 reached the value of 0.6-0.7 and protein expression was induced by addition of 1 mM IPTG. Fermentation was continued for additional 16 hours. Cells were then harvested by a 10 minutes, 6000 RCF centrifugation at 4 C., washed with ice-cold 0.9% NaCl, re-centrifuged as above, and frozen at 80 C.
[0098] An aliquot, 4.45 ml of lysis buffer (20 mM NaH.sub.2PO.sub.4, pH=7.2, 40 mM NaCl, 0.1 mM PLP) per 1 gram of pellet, was then added to the cell pellet and the latter was homogenized in a Dounce homogenizer until no cells aggregates were visible. The homogenate was then treated with lysozyme (2 mg/ml final), incubated for 1 hour at 4 C. on a rocking platform, sonicated to reduce viscosity, and centrifuged at 53000 RCF. The supernatant, comprising the soluble fraction was then stored at 80 C.
[0099] Expression levels were verified by gel-electrophoresis followed by Coomassie gel staining, and specific activity was determined by the radioactive activity assay.
[0100] c. CBS Assay
[0101] CBS activity was determined by a previously described radioisotope assay using [.sup.14C] serine as the labeled substrate (Kraus, 1987, Methods Enzymol. 143, 388-394). Protein concentrations were determined by the Lowry procedure (Lowry et al., 1951, J Biol. Chem. 193, 265-275) using bovine serum albumin (BSA) as a standard. One unit of activity is defined as the amount of CBS that catalyzes the formation of 1 mol of cystathionine in 1 h at 37 C.
[0102] d. Denaturing and Native Polyacrylamide Gel Electrophoresis and Western Blotting
[0103] Western blot analysis of crude cell lysates under both denaturing and native conditions was performed as described previously (Majtan et al., 2010 J Biol Chem. 2010; 285(21):15866-73) with some modifications. Soluble fractions of E. coli lysates containing the expressed mutant protein were mixed with sample buffer and run on a 6% native PAGE without a stacking gel. The final composition of the sample buffer was: 50 mM Tris-HCl, pH 8.9, 1 mM DTT, 10% glycerol, 0.001% bromphenol blue. Detection of heme was performed using a previously described method that relies on heme peroxidase activity (Vargas et al., 1993, Anal. Biochem. 209: 323-6).
[0104] e. Densitometric Scanning Analysis
[0105] Quantitative densitometry analysis was performed using the Imagemaster ID (version 2.0) software (Pharmacia). To construct a calibration curve, 50, 75, 100, 250, 500 and 1000 ng of purified wild type CBS protein were run on an SDS-PAGE together with crude cell lysates of the individual mutants. Following electrophoresis, Western blot immunoanalysis was conducted using rabbit anti-CBS serum. The signals corresponding to the experimentally observed CBS mutant subunits were all within the linear range of the calibration curve constructed with purified human CBS.
[0106] f. Determination of Plasma Metabolites
[0107] Stable-Isotope-Dilution Liquid Chromatography-Mass Spectrometry method was used to measure levels of sulfur amino acid metabolism compounds in mouse plasma, substantially as disclosed in Allen et al., 1993, Serum betaine N, N-dimethylglycine and N-methylglycine levels in patients with cobalamin and folate deficiency and related inborn errors of metabolism, Metabolism 42: 1448-1460.
Example 2
[0108] Plasma Retention Time in Vivo and Enzymatic Activity in Vitro are Enhanced Following rhCBSC PEGylation
[0109] Once administered to patients, the rhCBSC enzyme was expected to be active in circulation in the blood. CBS enzyme activity was assayed as set forth in Example 1 and found to decrease when incubated in plasma in vitro at 37 C. (40% and 20% of activity following 24 h and 48 h incubation, respectively) as shown in
[0110] In order to confirm that the loss of activity observed in vitro also occurred in vivo, experiments were performed where C57BL/6J mice were injected with 5 mg/kg body weight of the rhCBSC via intra-peritoneal (IP), intra-vascular (IV) or sub-cutaneous (SQ) routes. To avoid excessive bleeding, two experimental groups (denoted 1 and 2) of five mice each were used for each injection route (total n=30). For each injection route, blood was collected from group 1 at 0, 1, 8 and 24 hours post injection and from group 2 at 1, 4, 10, and 48 hours post injection. Animals were bled by a single-use lancet for submandibular bleeding and blood was collected into Capiject T-MLHG lithium heparin (12.5 IU) tubes with gel (Terumo Medical Corporation, NJ, USA). Tubes were then centrifuged at 1200 G for 10 min, followed by collection of plasma to 1.5 ml tubes and storage at 80 C.
[0111] Plasma was analyzed for CBS activity using the radiometric activity assay set forth in Example 1. CBS enzyme activity for the injected enzyme at the indicated time-points is shown in
[0112] To monitor whether rhCBSC clearance from circulation may contribute to the rapid loss of activity in vivo as shown above, plasma proteins from two representative mice from each group described above were resolved by electrophoresis, transferred onto a PVDF membrane and reacted with an anti-human CBS antibody to follow CBS clearance from circulation. As shown in
[0113] rhCBSC enzyme was modified by polyethylene glycol (PEG) molecules (PEGylated) with ME-020MA or GL4-400MA PEGs. Polyethylene glycol was purchased from the NOF corporation (Tokyo, Japan). PEGylation was carried out according to the manufacturer's instructions. For example, coupling of PEG maleimide derivatives to the SH groups of CBS (5 mg/ml) was carried out in a 100 mM phosphate buffer pH=6 overnight at 4 C. Molar ratio of PEG molecules to the CBS protein was 10:1 or 5:1, depending on the PEG molecule.
[0114] PEGylated rhCBSC enzyme modified with ME-020MA or GL4-400MA PEGs was incubated in mouse plasma at 37 C. (final concentration 160 ng/l), to determine whether such modification of the rhCBSC enzyme improved its stability. PEGylated rhCBSC enzyme activity was assayed by taking samples from mice administered PEGylated rhCBSC enzyme as set forth above at time points indicated in
[0115] To evaluate the activity of the PEGylated rhCBSC in vivo, C57BL/6J mice were injected with 5 mg/kg body weight of ME020MA- or GL4-400MA-PEGylated rhCBSC or with non-PEGylated rhCBSC via SQ route. Each treatment arm consisted of two groups of five mice (total 30 mice) and bled as described in above. Plasma was analyzed for CBS activity using the radiometric activity assay set forth in Example 1. Significant activity was detected for the two forms of the PEGylated enzyme 24 h and 48 h post injection, with GL4-400MA PEGylated rhCBSC activity peaking at 24 h, as shown in
Example 3
Repeated Injection Regimen with PEGylated, but not with Non-PEGylated rhCBSC, Exhibited Buildup of CBS Activity in Vivo
[0116] Rapid clearance rate of a protein from the circulation may be bypassed by increasing the number of injections to maintain higher plasma concentrations. Accordingly, a repeated injection regimen was tested with both non-PEGylated and PEGylated rhCBSC. C57BL/6J mice were injected at 0, 24, 48 hours (arrows in
Example 4
Single Injection of the PEGylated rhCBSC Reduced Homocysteine and Increased Cystathionine in Plasma
[0117] The preceding Examples were carried out in wild-type mice and were focused on characterization of the clearance and activity of the injected rhCBSC, and comparison between the PEGylated and the non-PEGylated enzyme. Once established that PEGylation was necessary, a varied repertoire of PEGylated CBS enzyme molecules were first tested in wild-type mice, and were then evaluated in a mouse model of homocystinuria.
[0118] A repertoire of rhCBSC enzymes modified with various PEG molecules were tested in wild-type mice in order to determine the best PEGylation strategy. Twenty seven C57BL/6J mice were divided into nine experimental groups (n=3). Each experimental group was injected via SQ route with 5 mg/kg body weight of rhCBSC PEGylated with the PEG molecule indicated in
[0119] Before proceeding with studies on HO mice, daily fluctuations in homocysteine, cystathionine, cysteine and methionine in these mice were assayed to determine the best time of day for injection of the rhCBSC enzyme. Accordingly, blood from six HO mice was drawn at the time points indicated in
[0120] rhCBSC molecules PEGylated with ME-400MA (lane 1,
[0121] The overall goal of the experiments described herein was to test the ability of the rhCBSC to lower homocysteine and increase cystathionine in vivo in order to be used as enzyme replacement therapy (ERT) for homocystinuria. The HO mice model for homocystinuria was used to test the potential of the rhCBSC to serve in ERT. HO mice were injected once with rhCBSC that was PEGylated with the PEG molecules (GL4-400MA, ME-400MA, ME-200MA0B) indicated in
Example 5
Repeated Injection of the PEGylated rhCBSC Significantly Impacted Homocysteine and Cystathionine Plasma Levels, and Restored Normal Cysteine Levels
[0122] A long term, repeated injection regimen, comparing non-PEGylated and PEGylated enzyme for the ability to reduce and maintain low levels of homocysteine as well as to increase cystathionine and cysteine levels was conducted as follows. Six HO mice were injected (arrows,
[0123] The effects of PEGylated rhCBSC on plasma homocysteine levels as compared to non-PEGylated rhCBSC was also determined, as presented in
[0124] The effects of PEGylated rhCBSC on plasma cysteine levels as compared to the non-PEGylated rhCBSC was also determined using the same experimental methods. As shown in
[0125] These results showed that PEGylated rhCBSC enzyme administered SQ to HO mice, significantly and positively affected homocysteine and cystathionine concentrations, and at the same time restored cysteine levels to their normal values. The latter experimental result is an indication that the intracellular transsulfuration pathway was activated following administration of rhCBSC.
TABLE-US-00005 TABLE2 CBSSequences SEQ ID Molecule NO Sequence HumanCBS 1 atgccttctgagaccccccaggcagaagtggggcccacaggctgccc nucleicacid ccaccgctcagggccacactcggcgaaggggagcctggagaaggggt sequence ccccagaggataaggaagccaaggagcccctgtggatccggcccgat (fulllength) gctccgagcaggtgcacctggcagctgggccggcctgcctccgagtc cccacatcaccacactgccccggcaaaatctccaaaaatcttgccag atattctgaagaaaatcggggacacccctatggtcagaatcaacaag attgggaagaagttcggcctgaagtgtgagctcttggccaagtgtga gttcttcaacgcgggcgggagcgtgaaggaccgcatcagcctgcgga tgattgaggatgctgagcgcgacgggacgctgaagcccggggacacg attatcgagccgacatccgggaacaccgggatcgggctggccctggc tgcggcagtgaggggctatcgctgcatcatcgtgatgccagagaaga tgagctccgagaaggtggacgtgctgcgggcactgggggctgagatt gtgaggacgcccaccaatgccaggttcgactccccggagtcacacgt gggggtggcctggcggctgaagaacgaaatccccaattctcacatcc tagaccagtaccgcaacgccagcaaccccctggctcactacgacacc accgctgatgagatcctgcagcagtgtgatgggaagctggacatgct ggtggcttcagtgggcacgggcggcaccatcacgggcattgccagga agctgaaggagaagtgtcctggatgcaggatcattggggtggatccc gaagggtccatcctcgcagagccggaggagctgaaccagacggagca gacaacctacgaggtggaagggatcggctacgacttcatccccacgg tgctggacaggacggtggtggacaagtggttcaagagcaacgatgag gaggcgttcacctttgcccgcatgctgatcgcgcaagaggggctgct gtgcggtggcagtgctggcagcacggtggcggtggccgtgaaggctg cgcaggagctgcaggagggccagcgctgcgtggtcattctgcccgac tcagtgcggaactacatgaccaagttcctgagcgacaggtggatgct gcagaagggctttctgaaggaggaggacctcacggagaagaagccct ggtggtggcacctccgtgttcaggagctgggcctgtcagccccgctg accgtgctcccgaccatcacctgtgggcacaccatcgagatcctccg ggagaagggcttcgaccaggcgcccgtggtggatgaggcgggggtaa tcctgggaatggtgacgcttgggaacatgctctcgtccctgcttgcc gggaaggtgcagccgtcagaccaagttggcaaagtcatctacaagca gttcaaacagatccgcctcacggacacgctgggcaggctctcgcaca tcctggagatggaccacttcgccctggtggtgcacgagcagatccag taccacagcaccgggaagtccagtcagcggcagatggtgttcggggt ggtcaccgccattgacttgctgaacttcgtggccgcccaggagcggg accagaagtga HumanCBS 2 MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPD polypeptide APSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINK Sequence IGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDT (fulllength IIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEI enzyme) VRTPTNAREDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDT TADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDP EGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRIVVDKWEKSNDE EAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPD SVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLRVQELGLSAPL TVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLA GKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQ YHSTGKSSQRQMVEGVVTAIDLLNEVAAQERDQK Polypeptide 3 MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPD Sequenceof APSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINK r-hCSC IGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDT (recombinant IIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEI human VRTPTNAREDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDT carboxy- TADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDP truncated EGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRIVVDKWEKSNDE CBS) EAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPD SVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLR Nucleicacid 4 atgccgtcagaaaccccgcaggcagaagtgggtccgacgggttgcccgcac sequenceof cgtagcggtccgcattctgcaaaaggcagtctggaaaaaggttccccggaa r-hCSC gataaagaagccaaagaaccgctgtggattcgtccggacgcaccgtcacgc tgtacctggcagctgggtcgtccggcaagcgaatctccgcatcaccatacg gctccggcgaaaagtccgaaaattctgccggatatcctgaagaaaattggt gacaccccgatggttcgtatcaacaaaatcggcaaaaaattcggtctgaaa tgcgaactgctggctaaatgtgaatttttcaatgcgggcggttccgtgaaa gatcgtatctcactgcgcatgattgaagatgctgaacgcgacggcaccctg aaaccgggtgatacgattatcgaaccgacctctggcaacacgggtatcggt ctggcactggcggcggcagtccgtggttatcgctgcattatcgtgatgccg gaaaaaatgagctctgaaaaagttgatgtcctgcgtgctctgggcgcggaa attgttcgtaccccgacgaatgcccgcttcgacagtccggaatcccatgtg ggtgttgcatggcgcctgaaaaacgaaatcccgaattcgcacattctggat cagtatcgtaacgctagcaatccgctggcgcattacgataccacggccgac gaaatcctgcagcaatgtgatggcaaactggacatgctggtcgcttctgtg ggtaccggcggtaccattacgggcatcgcgcgtaaactgaaagaaaaatgc ccgggctgtcgcattatcggtgtggatccggaaggcagtattctggcggaa ccggaagaactgaaccagaccgaacaaaccacgtatgaagttgaaggcatc ggttacgattttattccgaccgtcctggatcgcacggtggttgacaaatgg ttcaaaagcaatgacgaagaagcctttaccttcgcacgtatgctgatcgct caggaaggtctgctgtgcggtggttcagcaggttcgacggtcgcagtggca gttaaagctgcgcaggaactgcaagaaggtcaacgttgtgtcgtgattctg ccggattctgttcgcaactacatgaccaaatttctgagtgaccgttggatg ctgcaaaaaggcttcctgaaagaagaagatctgaccgagaaaaaaccgtgg tggtggcacctgcgctaa
[0126] Having described the invention in detail and by reference to specific embodiments thereof, it will be apparent that modifications and variations are possible without departing from the scope of the invention defined in the appended claims. More specifically, although some aspects of the present invention are identified herein as particularly advantageous, it is contemplated that the present invention is not necessarily limited to these particular aspects of the invention.