METHODS OF MODULATING AN IMMUNE RESPONSE
20170065702 ยท 2017-03-09
Inventors
Cpc classification
C12N7/00
CHEMISTRY; METALLURGY
C12N2760/14222
CHEMISTRY; METALLURGY
G01N2469/10
PHYSICS
C12N2760/14134
CHEMISTRY; METALLURGY
C07K2317/33
CHEMISTRY; METALLURGY
C12N2760/14122
CHEMISTRY; METALLURGY
C07K2317/76
CHEMISTRY; METALLURGY
C07K2317/34
CHEMISTRY; METALLURGY
C12N2760/14234
CHEMISTRY; METALLURGY
International classification
C12N7/00
CHEMISTRY; METALLURGY
Abstract
The present invention relates to methods of modulating an immune response in a subject by using a binding protein (e.g., an antibody or an antigen-binding portion of an antibody) to mask or alter an epitope on an antigen that is administered to the subject. Such methods are useful for inducing an immune response (e.g., production of an antibody) in the subject to a non-immunodominant epitope on the antigen. The invention also encompasses an antigen-binding protein complex comprising at least one binding protein bound to at least one immunodominant epitope on an antigen.
Claims
1. A method of inducing an immune response in a subject comprising: (i) administering to the subject an immunogenic composition at least one time wherein the immunogenic composition masks at least one immunodominant epitope on an immunogenic antigen, and (ii) inducing an immune response in the subject to at least one non-immunodominant epitope on the immunogenic antigen.
2. The method of claim 1, further comprising administering the immunogenic antigen to a subject at least one time.
3. The method of claim 1 or 2, wherein the immunogenic antigen comprises at least one immunodominant epitope and at least one non-immunodominant epitope.
4. The method of any one of claims 1-3, wherein the immunogenic composition comprises an antigen-binding protein complex.
5. The method of claim 4, wherein the binding protein is an antibody or an antigen-binding portion thereof.
6. The method of claim 4 or 5, wherein the binding protein binds to an immunodominant epitope on the immunogenic antigen.
7. The method of claim 5 or 6, wherein the antibody or antigen-binding portion is selected from the group consisting of: (a) a whole immunoglobulin; (b) an scFv; (c) a Fab fragment; (d) an F(ab).sub.2; and (e) a disulfide linked Fv.
8. The method of any one of the preceding claims, wherein the immunogenic antigen is an infectious organism antigen or a tumor cell antigen.
9. The method of claim 8, wherein the infectious organism antigen is a viral antigen or a bacterial antigen.
10. The method of claim 9, wherein the viral antigen is a filovirus antigen.
11. The method of claim 10, wherein the filovirus antigen is a Marburg virus antigen or an Ebola virus antigen.
12. The method of claim 10 or 11, wherein the filovirus antigen is a filovirus glycoprotein.
13. The method of claim 12, wherein the filovirus glycoprotein comprises the GP2 subunit or the GP1 subunit of the Marburg virus glycoprotein.
14. The method of claim 9, wherein the bacterial antigen is a Clostridium difficile antigen.
15. The method of claim 14, wherein the Clostridium difficile antigen is C. difficile toxin A or C. difficile toxin B.
16. The method of any one of the preceding claims, wherein the immune response is a B-cell response.
17. The method of any one of the preceding claims, wherein the immune response is the production of an antibody specific to a non-immunodominant epitope on the immunogenic antigen.
18. The method of claim 17, further comprising harvesting the antibody specific to a non-immunodominant epitope on the immunogenic antigen from the subject.
19. The method of claim 17 or 18, wherein the antibody specific to a non-immunodominant epitope on the immunogenic antigen is a neutralizing antibody.
20. The method of any one of the preceding claims, wherein the subject is non-human.
21. Use of an immunogenic composition that masks at least one immunodominant epitope on an immunogenic antigen for inducing an immune response to at least one non-immunodominant epitope on the immunogenic antigen in a subject.
22. An antigen-binding protein complex comprising at least one binding protein bound to at least one immunodominant epitope on an immunogenic antigen.
23. The antigen-binding protein complex of claim 22, wherein the binding protein is an antibody or an antigen-binding portion thereof.
24. The antigen-binding protein complex of claim 23, wherein the antibody or antigen-binding portion is selected from the group consisting of: (a) a whole immunoglobulin; (b) an scFv; (c) a Fab fragment; (d) an F(ab).sub.2; and (e) a disulfide linked Fv.
25. A neutralizing antibody that binds specifically to a non-immunodominant epitope on an immunogenic antigen, wherein the antibody is produced by the method of any one of claims 17-20.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
DETAILED DESCRIPTION OF THE INVENTION
[0032] The invention provides methods of inducing an immune response in a subject to at least one non-immunodominant epitope on an immunogenic antigen by administering to the subject an immunogenic composition that masks at least one immunodominant, non-neutralizing, or ineffective epitope on the immunogenic antigen. The induced immune response may include production of an antibody that binds to the non-immunodominant epitope. The invention encompasses an antibody produced by the induction of an immune response by the methods described herein. In one aspect, the invention provides an antigen-binding protein complex comprising at least one binding protein bound to at least one immunodominant epitope on an immunogenic antigen.
[0033] The section headings used herein are for organizational purposes only and are not to be construed as limiting the subject matter described. All documents, or portions of documents, cited herein, including but not limited to patents, patent applications, articles, books, and treatises, are hereby expressly incorporated by reference in their entirety for any purpose. In the event that one or more of the incorporated documents or portions of documents define a term that contradicts that term's definition in the application, the definition that appears in this application controls. However, mention of any reference, article, publication, patent, patent publication, and patent application cited herein is not, and should not be taken as an acknowledgment, or any form of suggestion, that they constitute valid prior art or form part of the common general knowledge in any country in the world.
[0034] In the present description, any concentration range, percentage range, ratio range, or integer range is to be understood to include the value of any integer within the recited range and, when appropriate, fractions thereof (such as one tenth and one hundredth of an integer), unless otherwise indicated. As used herein, about means20% of the indicated range, value, or structure, unless otherwise indicated or apparent from context. It should be understood that the terms a and an as used herein refer to one or more of the enumerated components unless otherwise indicated. The use of the alternative (e.g., or) should be understood to mean either one, both, or any combination thereof of the alternatives. As used herein, the terms include and comprise are used synonymously.
[0035] The invention encompasses a method of inducing or eliciting an immune response in a subject to at least one non-immunodominant epitope on an immunogenic antigen. Immunogenicity is the property enabling a substance (e.g., an antigen) to provoke an immune response, or the degree to which a substance possesses this property. For humoral immunogenicity, immunodominance may be defined as the capacity of certain portions (e.g., epitopes) of the antigen to elicit a larger amount of antibody or more antibodies than other (non-immunodominant) portions of the antigen. B-cell immunodominance may be defined experimentally by characterizing those surfaces of an antigen that elicit the greatest number and/or titer of antibody responses in comparison to those that elicit reduced or absent responses. Focusing B-cell responses from immunodominant regions of an antigen towards immunorecessive regions of the antigen can be determined empirically using the disclosed invention.
[0036] In one embodiment, the invention encompasses a method of inducing an immune response in a subject comprising: (i) administering to the subject an immunogenic composition at least one time wherein the immunogenic composition masks at least one immunodominant epitope on an immunogenic antigen, and (ii) inducing an immune response in the subject to at least one non-immunodominant epitope on the immunogenic antigen. The immunogenic composition may be administered to the subject at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, or at least ten times, or indefinitely, as long as the desired immune response is induced. In some embodiments, the method may further comprise administering an immunogenic antigen to a subject at least one time. In such embodiments, the immunogenic antigen may be administered before, after, and/or at the same time as the immunogenic composition is administered. In certain embodiments, different immunogenic compositions (antigen-binding protein complexes) may be administered to a subject sequentially or simultaneously.
[0037] The invention encompasses an immunogenic antigen. An immunogenic antigen may contain one or more epitopes. For example, an antigen may comprise at least one immunodominant epitope and at least one non-immunodominant epitope. The epitopes may be linear or conformational and may become exposed after binding of a binding protein to the antigen. An immunodominant epitope is defined as an epitope present on an immunogenic antigen wherein the immunization of a subject with the immunogenic antigen elicits an immune response. The immune response generated from the immunization with the immunogenic antigen would result in a high titer of antibodies to the immunodominant epitope. A non-immunodominant epitope or immunorecessive epitope is defined as an epitope present on an immunogenic antigen wherein the immunization of a subject with the immunogenic antigen elicits an immune response with higher titer of antibodies to an immunodominant epitope compared to the immunorecessive or non-immunodominant epitope. In one embodiment, the titer of antibodies generated against the immunodominant epitope would be reduced by immunizing with an antigen-binding protein complex. In another embodiment, the titer of antibodies generated against a non-immunodominant epitope would be increased by immunizing with an antigen-binding protein complex. A non-neutralizing or ineffective epitope may also be masked by the methods and compositions of the invention (for example, identical epitopes on both soluble GP and trimeric GP on the surface of virus to promote immune response to surface GP).
[0038] The invention also encompasses a method of exposing a hidden epitope in a conformational antigen comprising complexing a binding protein with the conformational antigen wherein the complexing of the binding protein to the antigen results in a change from the original conformation. The binding protein can be specific to one or more epitopes on the conformational antigen. The change in conformation can be a result of steric hindrance. In certain instances, the binding of a binding protein (e.g., antibody) to one or more epitopes on an antigen may cause the antigen to change conformation thereby exposing epitopes that were hidden in the unbound antigen. Changing the confirmation of the antigen through binding with the binding protein and immunizing a subject with the antigen-antibody binding protein complex can lead to the development of antibodies and an immune response specific to epitopes that would not have been accessible had the subject been immunized with the unbound antigen. Masking of an immunodominant epitope with a binding protein (e.g., Fab) may reduce the creation of neoisotopes as compared to other immunization strategies (e.g., deletion of domains which can introduce new surfaces at the cutting zones as well as altered surfaces around the deleted region) as the antigen remains in a more native state. In the event that a conformation strain is induced on the antigen particle or intact (e.g., viral) target, the opportunity toward development of oligoclonal (or cocktail) antibody approach is also available as passive immunotherapy. In passive immunotherapy, one antibody may be used to induce a conformational change and/or expose an epitope, combined with an additional antibody to target the neoepitope and neutralize, block propagation, or activate classic complementation.
[0039] In some embodiments, the instant masking method offers the benefit of retaining the structures of envelope protein or surface molecules in an essentially native state (as monomers, trimers, binding cell surface receptors, membrane fusing moieties, etc.) and avoiding disadvantages of recombinant expression and purification of recombinant surface proteins.
[0040] The instant immunomodulating methods provide an advantage over glycan masking, which can lead to reduced immunogenicity in vivo and decrease protein expression levels, suggesting a negative impact on folding efficiency (see, e.g., Bosques et al., 2004, J Am Chem Soc, 126:8421-8425; Rudd et al., 1995, Biochim Biophys Acta, 1248:1-10; Wormald et al., 1999, Structure, 7:R155-160). Glycan masking can be used only at certain protein sites, while the instant methods can be used at a wider variety of sites. In one embodiment, the methods and compositions of the instant invention may be used in combination with glycan masking. For instance, such combination treatments may generate an immune response with a broader neutralization across viral clades.
[0041] In one aspect, the invention encompasses an antigen-binding protein complex comprising at least one binding protein bound to at least one immunodominant epitope on an immunogenic antigen. Similarly, an immunogenic composition used in the methods of the invention may be an antigen-binding protein complex. A binding protein may mask or alter one or more immunodominant epitopes on the antigen. Binding protein-antigen complexes used in the methods and compositions of the invention can be prepared where the binding protein is directed at one or more epitopes found in the antigen (see
[0042] A binding protein may be chemically cross-linked with an antigen to form a stable complex. Cross-linking may be accomplished using hetero- or homo-bifunctional cross-linking reagents (Pierce reagents), or other chemical reagents known to generate covalent bonds between molecules (e.g. linkages between intramolcular or intermolecular amino acid residues of two or more polypeptides) also sometimes referred to as bioconjugation. Cross linking reagents known to those in the art include but are not limited to glutaraldehyde, dimethyl adipimaidate, dimethyl adipimidate, dimethyl suberimidate, dimethyl pimelimidate for homo-biofunctional reagents and maleimide, Bis[2-(4-azidosalicylamido)ethyl)] disulfide, succinimidyl 3-(2-pyridyldithio)priopionate], succinimdyl trans-4-(maleimidylmethyl)cyclohexane-1-carboxylate] for hetero-functional reagents. Alternatively chemical oxidation could be used to cross link free sulhydryl groups in close proximity with reagents such as copper (II) chloride, ferric salts, etc. engineered into the binding protein to cross link with antigen.
[0043] A binding protein used in the methods of the invention is a macromolecule comprising one or more polypeptide chains. A protein can also comprise non-peptidic components, such as carbohydrate groups. Carbohydrates and other non-peptidic substituents can be added to a protein by the cell in which the protein is produced, and will vary with the type of cell. Proteins are defined herein in terms of their amino acid backbone structures; substituents such as carbohydrate groups are generally not specified, but may be present nonetheless.
[0044] As used herein, a polypeptide or polypeptide chain is a single, linear and contiguous arrangement of covalently linked amino acids. Polypeptides can have or form one or more intrachain disulfide bonds. With regard to polypeptides as described herein, reference to amino acid residues corresponding to those specified by SEQ ID NO includes post-translational modifications of such residues. The terms amino-terminal and carboxyl-terminal are used herein to denote positions within polypeptides. Where the context allows, these terms are used with reference to a particular sequence or portion of a polypeptide to denote proximity or relative position. For example, a certain sequence positioned carboxyl-terminal to a reference sequence within a polypeptide is located proximal to the carboxyl-terminus of the reference sequence, but is not necessarily at the carboxyl-terminus of the complete polypeptide.
[0045] A binding protein used in the methods and compositions of the invention may be an antibody (e.g., neutralizing or non-neutralizing) or an antigen-binding portion thereof. A binding protein may be a whole immunoglobulin, Fab, F(ab).sub.2, Fab, F(ab), Fv, single chain Fv (scFv), bivalent scFv (bi-scFv), trivalent scFv (tri-scFv), disulfide linked Fv, Fc, Fd, dAb fragment (e.g., Ward et al., Nature, 341:544-546 (1989)), an isolated CDR, an affibody, a diabody, a triabody, a tetrabody, a linear antibody, a single-chain molecule, a bispecific molecule, a multispecific molecule, or variants, derivatives, combinations and/or mixtures of any of the above. In one embodiment, an immunogenic composition is a Fab-antigen complex. In another embodiment, an immunogenic composition is a F(ab).sub.2-antigen complex. As used herein, the term derivative refers to a modification of one or more amino acid residues of a peptide by chemical or biological means, either with or without an enzyme, e.g., by glycosylation, alkylation, acylation, ester formation, or amide formation. As used herein, the term variant or variants refers to a nucleic acid or polypeptide differing from a reference nucleic acid or polypeptide, but retaining essential properties thereof. Generally, variants are overall closely similar, and, in many regions, identical to the reference nucleic acid or polypeptide. For instance, a variant may exhibit at least about 70%, at least about 80%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98% or at least about 99% sequence identity compared to the active portion or full length reference nucleic acid or polypeptide.
[0046] In some embodiments, a binding protein may be an scFv-scFv dimer, a SMIP, a SCORPION molecule, a BiTE (Bispecific T-cell Engager) or a diabody. As used herein, the term SMIP is used to refer to protein scaffolds as generally disclosed in, for example, in US Patent Application Publication Nos. 2003/0133939, 2003/0118592, and 2005/0136049. A SMIP protein can comprise a polypeptide chain having a binding domain, a hinge region and an immunoglobulin constant region. A SMIP molecule should be understood to be a binding protein comprising SMIP scaffolding, e.g., in order from amino to carboxyl-terminus or carboxyl-terminus to amino-terminus, a first binding domain, a hinge region, and an immunoglobulin constant constant region. As used herein, the term PIMS is used to refer to protein scaffolds as generally disclosed in, for example, in US Patent Application Publication No. 2009/0148447. A PIMS molecule should be understood to be a binding protein comprising PIMS scaffolding, e.g., in order from amino to carboxyl-terminus or carboxyl-terminus to amino-terminus, an immunoglobulin constant region, a hinge region and a first binding domain. As used herein, SCORPION is a term used to refer to a multi-specific binding protein scaffold. Multi-specific binding proteins and polypeptides are disclosed, for instance, in PCT Application Publication No. WO 2007/146968, U.S. Patent Application Publication No. 2006/0051844, PCT Application Publication No. WO 2010/040105, PCT Application Publication No. WO 2010/003108, U.S. Pat. No. 7,166,707 and U.S. Pat. No. 8,409,577. A SCORPION polypeptide comprises two binding domains (the domains can be designed to specifically bind the same or different targets), two hinge regions, and an immunoglobulin constant region. SCORPION proteins are homodimeric proteins comprising two identical, disulfide-bonded SCORPION polypeptides. A SCORPION molecule should be understood to be a binding protein comprising SCORPION scaffolding, e.g., two binding domains (the domains can be designed to specifically bind the same or different targets), two hinge regions, and an immunoglobulin constant region. BiTE molecules typically comprise or consist of an anti-antigen scFv linked to an anti-CD3 scFv and typically do not include other sequences such as an immunoglobulin constant region.
[0047] A binding protein used in an immunogenic composition of the invention may comprise a binding domain or binding region. As used herein, the term binding domain or binding region refers to the domain, region, portion, or site of a protein, polypeptide, oligopeptide, or peptide or antibody or binding domain derived from an antibody that possesses the ability to specifically recognize and bind to a target molecule, such as an antigen. Exemplary binding domains include single-chain antibody variable regions (e.g., domain antibodies, sFv, scFv, scFab), receptor ectodomains, and ligands (e.g., cytokines, chemokines). In certain embodiments, the binding domain comprises or consists of an antigen binding site (e.g., comprising a variable heavy chain sequence and variable light chain sequence or three light chain complementary determining regions (CDRs) and three heavy chain CDRs from an antibody placed into alternative framework regions (FRs) (e.g., human FRs optionally comprising one or more amino acid substitutions). A variety of assays are known for identifying binding domains that specifically bind a particular target, including Western blot, ELISA, phage display library screening, and BIACORE interaction analysis.
[0048] In addition, it should be understood that the polypeptides comprising the various combinations of the components (e.g., domains or regions) and substituents described herein, are disclosed by the present application to the same extent as if each polypeptide was set forth individually. Thus, selection of particular components of individual polypeptides is within the scope of the present disclosure. As used herein, a binding protein can have a first binding domain and, optionally, a second binding domain. In certain embodiments, the first binding domain binds to an infectious organism antigen or a tumor antigen and the format is an antibody or antibody-like protein or domain. In certain embodiments comprising both the first and second binding domains, the second binding domain is a T-cell binding domain such as a scFv derived from a mouse monoclonal antibody (e.g., CRIS-7) or phage display (e.g., I2C) that binds to a T-cell surface antigen (e.g., CD3).
[0049] A whole (or full length) immunoglobulin may be a tetrameric molecule. A tetramer may be composed of two identical pairs of polypeptide chains, each pair having one light and one heavy chain. The amino-terminal portion of each chain includes a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition. The carboxy-terminal portion of each chain defines a constant region primarily responsible for effector function. Human light chains are classified as K and A light chains. Heavy chains are classified as , , , , or , and define the antibody's isotype as IgM, IgD, IgG, IgA, and IgE, respectively. Within light and heavy chains, the variable and constant regions are joined by a J region of about 12 or more amino acids, with the heavy chain also including a D region of about 10 or more amino acids. See generally, Fundamental Immunology, Ch. 7 (Paul, W., ed., 2nd ed. Raven Press, N.Y. (1989)). The variable regions of each light/heavy chain pair form the antibody binding site such that an intact immunoglobulin has two binding sites. The terms light chain variable region (also referred to as light chain variable domain or VL or V.sub.L) and heavy chain variable region (also referred to as heavy chain variable domain or VH or V.sub.H) refer to the variable binding region from an antibody light and heavy chain, respectively. The variable binding regions are made up of discrete, well-defined sub-regions known as complementarity determining regions (CDRs) and framework regions (FRs). A light chain CDR may be referred to as LCDR or K, CDR. A heavy chain CDR may be referred to as HCDR or H, CDR. The heavy chain variable region (or light chain variable region) contains three CDRs and four framework regions (FRs), arranged from amino-terminus to carboxyl-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. Kabat, E. A., et al. Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242, 1991. Chothia, C. et al., J. Mol. Biol. 196:901-917, 1987. In one embodiment, the FRs are humanized. The term CL refers to an immunoglobulin light chain constant region or a light chain constant region, i.e., a constant region from an antibody light chain. The term CH refers to an immunoglobulin heavy chain constant region or a heavy chain constant region, which is further divisible, depending on the antibody isotype into CH1, CH2, and CH3 (IgA, IgD, IgG), or CH1, CH2, CH3, and CH4 domains (IgE, IgM). A Fab (fragment antigen binding) is the part of an antibody that binds to antigens and includes the variable region and CH1 domain of the heavy chain linked to the light chain via an inter-chain disulfide bond.
[0050] A binding domain or protein specifically binds a target if it binds the target with an affinity or K.sub.a (i.e., an equilibrium association constant of a particular binding interaction with units of 1/M) equal to or greater than 10.sup.5 M.sup.1, while not significantly binding other components present in a test sample. Binding domains can be classified as high affinity binding domains and low affinity binding domains. High affinity binding domains refer to those binding domains with a K.sub.a of at least about 10.sup.7 M.sup.1, at least about 10.sup.8 M.sup.1, at least about 10.sup.9 M.sup.1, at least about 10.sup.10 M.sup.1, at least about 10.sup.11 M.sup.1, at least about 10.sup.12 M.sup.1, or at least about 10.sup.13 M.sup.1. Low affinity binding domains refer to those binding domains with a K.sub.a of up to about 10.sup.7 M.sup.1, up to about 10.sup.6 M.sup.1, up to about 10.sup.5 M.sup.1. Alternatively, affinity can be defined as an equilibrium dissociation constant (K.sub.d) of a particular binding interaction with units of M (e.g., about 10.sup.5 M to about 10.sup.13 M). Affinities of binding domain polypeptides and single chain polypeptides according to the present disclosure can be readily determined using conventional techniques (see, e.g., Scatchard et al. (1949) Ann. N.Y. Acad. Sci. 51:660; and U.S. Pat. Nos. 5,283,173, 5,468,614, or the equivalent). In some embodiments, the binding protein (e.g., Fab or F(ab).sub.2) may possess a submicromolar affinity constant to retain binding and/or masking of the epitope during administration to the subject.
[0051] A binding protein or domain can comprise a conservative substitution compared to a known sequence. As used herein, a conservative substitution is recognized in the art as a substitution of one amino acid for another amino acid that has similar properties. Exemplary conservative substitutions are well-known in the art (see, e.g., WO 97/09433, page 10, published Mar. 13, 1997; Lehninger, Biochemistry, Second Edition; Worth Publishers, Inc. NY:NY (1975), pp. 71-77; Lewin, Genes IV, Oxford University Press, NY and Cell Press, Cambridge, Mass. (1990), p. 8). In certain embodiments, a conservative substitution includes a leucine to serine substitution.
[0052] A binding protein or domain can be derived from an antibody, e.g., a Fab, F(ab).sub.2, Fab, scFv, single domain antibody (sdAb), etc. As used herein, a polypeptide or amino acid sequence derived from a designated polypeptide or protein refers to the origin of the polypeptide. In certain embodiments, the polypeptide or amino acid sequence which is derived from a particular sequence (sometimes referred to as the starting or parent or parental sequence) has an amino acid sequence that is essentially identical to the starting sequence or a portion thereof, wherein the portion consists of at least 10-20 amino acids, at least 20-30 amino acids, or at least 30-50 amino acids, or at least 50-150 amino acids, or which is otherwise identifiable to one of ordinary skill in the art as having its origin in the starting sequence.
[0053] Polypeptides derived from another polypeptide can have one or more mutations relative to the starting polypeptide, e.g., one or more amino acid residues which have been substituted with another amino acid residue or which has one or more amino acid residue insertions or deletions. The polypeptide can comprise an amino acid sequence which is not naturally occurring. Such variations necessarily have less than 100% sequence identity or similarity with the starting polypeptide. In one embodiment, the variant will have an amino acid sequence from about 60% to less than 100% amino acid sequence identity or similarity with the amino acid sequence of the starting polypeptide. In another embodiment, the variant will have an amino acid sequence from about 75% to less than 100%, from about 80% to less than 100%, from about 85% to less than 100%, from about 90% to less than 100%, from about 95% to less than 100% amino acid sequence identity or similarity with the amino acid sequence of the starting polypeptide.
[0054] As used herein, the term sequence identity refers to a relationship between two or more polynucleotide sequences or between two or more polypeptide sequences. When a position in one sequence is occupied by the same nucleic acid base or amino acid residue in the corresponding position of the comparator sequence, the sequences are said to be identical at that position. The percentage sequence identity is calculated by determining the number of positions at which the identical nucleic acid base or amino acid residue occurs in both sequences to yield the number of identical positions. The number of identical positions is then divided by the total number of positions in the comparison window and multiplied by 100 to yield the percentage of sequence identity. Percentage of sequence identity is determined by comparing two optimally aligned sequences over a comparison window. The comparison window for nucleic acid sequences can be, for instance, at least about 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 300, 400, 500, 600, 700, 800, 900 or 1000 or more nucleic acids in length. The comparison window for polypeptide sequences can be, for instance, at least about 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 300 or more amino acids in length. In order to optimally align sequences for comparison, the portion of a polynucleotide or polypeptide sequence in the comparison window can comprise additions or deletions termed gaps while the reference sequence is kept constant. An optimal alignment is that alignment which, even with gaps, produces the greatest possible number of identical positions between the reference and comparator sequences. Percentage sequence identity between two sequences can be determined using the version of the program BLAST 2 Sequences which was available from the National Center for Biotechnology Information as of Sep. 1, 2004, which program incorporates the programs BLASTN (for nucleotide sequence comparison) and BLASTP (for polypeptide sequence comparison), which programs are based on the algorithm of Karlin and Altschul (Proc. Natl. Acad. Sci. USA 90(12):5873-5877, 1993). When utilizing BLAST 2 Sequences, parameters that were default parameters as of Sep. 1, 2004, can be used for word size (3), open gap penalty (11), extension gap penalty (1), gap dropoff (50), expect value (10) and any other required parameter including but not limited to matrix option. Two nucleotide or amino acid sequences are considered to have substantially similar sequence identity or substantial sequence identity if the two sequences have at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity relative to each other.
[0055] As used herein, unless otherwise provided, a position of an amino acid residue in a variable region of an immunoglobulin molecule is numbered according to the Kabat numbering convention (Kabat, Sequences of Proteins of Immunological Interest, 5.sup.th ed. Bethesda, Md.: Public Health Service, National Institutes of Health (1991)), and a position of an amino acid residue in a constant region of an immunoglobulin molecule is numbered according to EU nomenclature (Ward et al., 1995 Therap. Immunol. 2:77-94).
[0056] In some embodiments, a binding protein used in the methods and compositions of the invention is a dimer. As used herein, the term dimer refers to a biological entity that consists of two subunits associated with each other via one or more forms of intramolecular forces, including covalent bonds (e.g., disulfide bonds) and other interactions (e.g., electrostatic interactions, salt bridges, hydrogen bonding, and hydrophobic interactions), and is stable under appropriate conditions (e.g., under physiological conditions, in an aqueous solution suitable for expressing, purifying, and/or storing recombinant proteins, or under conditions for non-denaturing and/or non-reducing electrophoresis). A heterodimer or heterodimeric protein, as used herein, refers to a dimer formed from two different polypeptides. A heterodimer does not include an antibody formed from four polypeptides (i.e., two light chains and two heavy chains). A homodimer or homodimeric protein, as used herein, refers to a dimer formed from two identical polypeptides.
[0057] A binding protein may comprise a peptide linker. As used herein, the term peptide linker refers to an amino acid sequence that connects a heavy chain variable region to a light chain variable region and provides a spacer function compatible with interaction of the two sub-binding domains so that the resulting polypeptide retains a specific binding affinity to the same target molecule as an antibody that comprises the same light and heavy chain variable regions. In certain embodiments, a linker is comprised of five to about 35 amino acids, for instance, about 15 to about 25 amino acids.
[0058] A binding protein or an antibody produced after immunization with an antigen-binding protein complex may be a humanized antibody or antigen-binding portion thereof. As used herein, the term humanized refers to a process of making an antibody or immunoglobulin binding proteins and polypeptides derived from a non-human species (e.g., mouse or rat) less immunogenic to humans, while still retaining antigen-binding properties of the original antibody, using genetic engineering techniques. In some embodiments, the binding domain(s) of an antibody or an immunoglobulin binding protein or polypeptide (e.g., light and heavy chain variable regions, Fab, scFv) are humanized. Non-human binding domains can be humanized using techniques known as CDR grafting (Jones et al., Nature 321:522 (1986)) and variants thereof, including reshaping (Verhoeyen, et al., 1988 Science 239:1534-1536; Riechmann, et al., 1988 Nature 332:323-337; Tempest, et al., Bio/Technol 1991 9:266-271), hyperchimerization (Queen, et al., 1989 Proc Natl Acad Sci USA 86:10029-10033; Co, et al., 1991 Proc Natl Acad Sci USA 88:2869-2873; Co, et al., 1992 J Immunol 148:1149-1154), and veneering (Mark, et al., Derivation of therapeutically active humanized and veneered anti-CD18 antibodies. In: Metcalf B W, Dalton B J, eds. Cellular adhesion: molecular definition to therapeutic potential. New York: Plenum Press, 1994: 291-312). If derived from a non-human source, other regions of the antibody or immunoglobulin binding proteins and polypeptides, such as the hinge region and constant region domains, can also be humanized.
[0059] In some embodiments, a binding protein used in the methods and compositions of the invention comprises an immunoglobulin constant region. An immunoglobulin constant region or constant region is a term defined herein to refer to a peptide or polypeptide sequence that corresponds to or is derived from part or all of one or more constant region domains. In certain embodiments, the immunoglobulin constant region corresponds to or is derived from part or all of one or more constant region domains, but not all constant region domains of a source antibody. In certain embodiments, the constant region comprises IgG CH2 and CH3 domains, e.g., IgG1 CH2 and CH3 domains. In certain embodiments, the constant region does not comprise a CH1 domain. In certain embodiments, the constant region domains making up the constant region are human. In some embodiments, the constant region domains of a binding protein used in this invention lack or have minimal effector functions of antibody-dependent cell-mediated cytotoxicity (ADCC) and complement activation and complement-dependent cytotoxicity (CDC), while retaining the ability to bind some F.sub.c receptors (such as FcRn, the neonatal Fc receptor) and retaining a relatively long half life in vivo. In other variations, a binding protein of this invention includes constant domains that retain such effector function of one or both of ADCC and CDC. In certain embodiments, a binding domain of this disclosure is fused to a human IgG1 constant region, wherein the IgG1 constant region has one or more of the following amino acids mutated: leucine at position 234 (L234), leucine at position 235 (L235), glycine at position 237 (G237), glutamate at position 318 (E318), lysine at position 320 (K320), lysine at position 322 (K322), or any combination thereof (numbering according to EU). For example, any one or more of these amino acids can be changed to alanine. In a further embodiment, an IgG1 Fc domain has each of L234, L235, G237, E318, K320, and K322 (according to EU numbering) mutated to an alanine (i.e., L234A, L235A, G237A, E318A, K320A, and K322A, respectively), and optionally an N297A mutation as well (i.e., essentially eliminating glycosylation of the CH2 domain).
[0060] Fc region or Fc domain refers to a polypeptide sequence corresponding to or derived from the portion of a source antibody that is responsible for binding to antibody receptors on cells and the C1q component of complement. Fc stands for fragment crystalline, the fragment of an antibody that will readily form a protein crystal. Distinct protein fragments, which were originally described by proteolytic digestion, can define the overall general structure of an immunoglobulin protein. As originally defined in the literature, the Fc fragment consists of the disulfide-linked heavy chain hinge regions, CH2, and CH3 domains. However, more recently the term has been applied to a single chain consisting of CH3, CH2, and at least a portion of the hinge sufficient to form a disulfide-linked dimer with a second such chain. For a review of immunoglobulin structure and function, see Putnam, The Plasma Proteins, Vol. V (Academic Press, Inc., 1987), pp. 49-140; and Padlan, Mol. Immunol. 31:169-217, 1994. As used herein, the term Fc includes variants of naturally occurring sequences.
[0061] Antibody-dependent cell-mediated cytotoxicity and ADCC, as used herein, refer to a cell-mediated process in which nonspecific cytotoxic cells that express FcRs (e.g., monocytic cells such as Natural Killer (NK) cells and macrophages) recognize bound antibody (or other protein capable of binding FcRs) on a target cell and subsequently cause lysis of the target cell. In principle, any effector cell with an activating FcR can be triggered to mediate ADCC. The primary cells for mediating ADCC are NK cells, which express only FcRIII, whereas monocytes, depending on their state of activation, localization, or differentiation, can express FcRI, FcRII, and FcRIII. For a review of FcR expression on hematopoietic cells, see, e.g., Ravetch et al., 1991, Annu. Rev. Immunol., 9:457-92.
[0062] The term having ADCC activity, as used herein in reference to a polypeptide or protein, means that the polypeptide or protein (for example, one comprising an immunoglobulin hinge region and an immunoglobulin constant region having CH2 and CH3 domains, such as derived from IgG (e.g., IgG1)), is capable of mediating antibody-dependent cell-mediated cytotoxicity (ADCC) through binding of a cytolytic Fc receptor (e.g., FcRIII) on a cytolytic immune effector cell expressing the Fc receptor (e.g., an NK cell).
[0063] Complement-dependent cytotoxicity and CDC, as used herein, refer to a process in which components in normal serum (complement), together with an antibody or other C1q-complement-binding protein bound to a target antigen, exhibit lysis of a target cell expressing the target antigen. Complement consists of a group of serum proteins that act in concert and in an orderly sequence to exert their effect.
[0064] The terms classical complement pathway and classical complement system, as used herein, are synonymous and refer to a particular pathway for the activation of complement. The classical pathway requires antigen-antibody complexes for initiation and involves the activation, in an orderly fashion, of nine major protein components designated C1 through C9. For several steps in the activation process, the product is an enzyme that catalyzes the subsequent step. This cascade provides amplification and activation of large amounts of complement by a relatively small initial signal.
[0065] The term having CDC activity, as used herein in reference to a polypeptide or protein, means that the polypeptide or protein (for example, one comprising an immunoglobulin hinge region and an immunoglobulin constant region having CH2 and CH3 domains, such as derived from IgG (e.g., IgG1)) is capable of mediating complement-dependent cytotoxicity (CDC) through binding of C1q complement protein and activation of the classical complement system.
[0066] As indicated herein, in certain embodiments, the binding proteins used in the methods and compositions of the invention comprise an immunoglobulin constant region (also referred to as a constant region) in a polypeptide chain. By mutations or other alterations, an immunoglobulin constant region further enables relatively easy modulation of dimeric polypeptide effector functions (e.g., ADCC, ADCP, CDC, complement fixation, and binding to Fc receptors), which can either be increased or decreased depending on the disease being treated, as known in the art and described herein. In certain embodiments, an immunoglobulin constant region of one or both of the polypeptide chains of the polypeptide homodimers and heterodimers of the present invention will be capable of mediating one or more of these effector functions In other embodiments, one or more of these effector functions are reduced or absent in an immunoglobulin constant region of one or both of the polypeptide chains of the polypeptide homodimers and heterodimers of the present disclosure, as compared to a corresponding wild-type immunoglobulin constant region. For example, for dimeric binding proteins designed to elicit RTCC, such as, e.g., via the inclusion of a CD3-binding domain, an immunoglobulin constant region preferably has reduced or no effector function relative to a corresponding wild-type immunoglobulin constant region.
[0067] An immunoglobulin constant region present in binding proteins of the present invention can comprise or be derived from part or all of: a CH2 domain, a CH3 domain, a CH4 domain, or any combination thereof. For example, an immunoglobulin constant region can comprise a CH2 domain, a CH3 domain, both CH2 and CH3 domains, both CH3 and CH4 domains, two CH3 domains, a CH4 domain, two CH4 domains, and a CH2 domain and part of a CH3 domain.
[0068] A CH2 domain that can form an immunoglobulin constant region of a binding protein of the present invention can be a wild type immunoglobulin CH2 domain or an altered immunoglobulin CH2 domain thereof from certain immunoglobulin classes or subclasses (e.g., IgG1, IgG2, IgG3, IgG4, IgA1, IgA2, or IgD) and from various species (including human, mouse, rat, and other mammals).
[0069] In certain embodiments, a CH2 domain is a wild type human immunoglobulin CH2 domain, such as wild type CH2 domains of human IgG1, IgG2, IgG3, IgG4, IgA1, IgA2, or IgD, as set forth in SEQ ID NOS:115, 199-201 and 195-197, respectively, of PCT Publication WO2011/090762 (said sequences incorporated by reference herein). In certain embodiments, the CH2 domain is a wild type human IgG1 CH2 domain as set forth in SEQ ID NO:115 of WO2011/090762 (said sequence incorporated by reference herein).
[0070] In certain embodiments, a CH2 domain is an altered immunoglobulin CH2 region (e.g., an altered human IgG1 CH2 domain) that comprises an amino acid substitution at the asparagine of position 297 (e.g., asparagine to alanine). Such an amino acid substitution reduces or eliminates glycosylation at this site and abrogates efficient Fc binding to FcR and C1q. The sequence of an altered human IgG1 CH2 domain with an Asn to Ala substitution at position 297 is set forth in SEQ ID NO:324 of WO2011/090762 said (sequence incorporated by reference herein).
[0071] In certain embodiments, a CH2 domain is an altered immunoglobulin CH2 region (e.g., an altered human IgG1 CH2 domain) that comprises at least one substitution or deletion at positions 234 to 238. For example, an immunoglobulin CH2 region can comprise a substitution at position 234, 235, 236, 237 or 238, positions 234 and 235, positions 234 and 236, positions 234 and 237, positions 234 and 238, positions 234-236, positions 234, 235 and 237, positions 234, 236 and 238, positions 234, 235, 237, and 238, positions 236-238, or any other combination of two, three, four, or five amino acids at positions 234-238. In addition or alternatively, an altered CH2 region can comprise one or more (e.g., two, three, four or five) amino acid deletions at positions 234-238, for instance, at one of position 236 or position 237 while the other position is substituted. The above-noted mutation(s) decrease or eliminate the antibody-dependent cell-mediated cytotoxicity (ADCC) activity or Fc receptor-binding capability of a polypeptide heterodimer that comprises the altered CH2 domain. In certain embodiments, the amino acid residues at one or more of positions 234-238 has been replaced with one or more alanine residues. In further embodiments, only one of the amino acid residues at positions 234-238 have been deleted while one or more of the remaining amino acids at positions 234-238 can be substituted with another amino acid (e.g., alanine or serine).
[0072] In certain other embodiments, a CH2 domain is an altered immunoglobulin CH2 region (e.g., an altered human IgG1 CH2 domain) that comprises one or more amino acid substitutions at positions 253, 310, 318, 320, 322, and 331. For example, an immunoglobulin CH2 region can comprise a substitution at position 253, 310, 318, 320, 322, or 331, positions 318 and 320, positions 318 and 322, positions 318, 320 and 322, or any other combination of two, three, four, five or six amino acids at positions 253, 310, 318, 320, 322, and 331. The above-noted mutation(s) decrease or eliminate the complement-dependent cytotoxicity (CDC) of a polypeptide heterodimer that comprises the altered CH2 domain.
[0073] In certain other embodiments, in addition to the amino acid substitution at position 297, an altered CH2 region (e.g., an altered human IgG1 CH2 domain) can further comprise one or more (e.g., two, three, four, or five) additional substitutions at positions 234-238. For example, an immunoglobulin CH2 region can comprise a substitution at positions 234 and 297, positions 234, 235, and 297, positions 234, 236 and 297, positions 234-236 and 297, positions 234, 235, 237 and 297, positions 234, 236, 238 and 297, positions 234, 235, 237, 238 and 297, positions 236-238 and 297, or any combination of two, three, four, or five amino acids at positions 234-238 in addition to position 297. In addition or alternatively, an altered CH2 region can comprise one or more (e.g., two, three, four or five) amino acid deletions at positions 234-238, such as at position 236 or position 237. The additional mutation(s) decreases or eliminates the antibody-dependent cell-mediated cytotoxicity (ADCC) activity or Fc receptor-binding capability of a polypeptide heterodimer that comprises the altered CH2 domain. In certain embodiments, the amino acid residues at one or more of positions 234-238 have been replaced with one or more alanine residues. In further embodiments, only one of the amino acid residues at positions 234-238 has been deleted while one or more of the remaining amino acids at positions 234-238 can be substituted with another amino acid (e.g., alanine or serine).
[0074] In certain embodiments, in addition to one or more (e.g., 2, 3, 4, or 5) amino acid substitutions at positions 234-238, a mutated CH2 region (e.g., an altered human IgG1 CH2 domain) in a fusion protein of the present disclosure can contain one or more (e.g., 2, 3, 4, 5, or 6) additional amino acid substitutions (e.g., substituted with alanine) at one or more positions involved in complement fixation (e.g., at positions 1253, H310, E318, K320, K322, or P331). Examples of mutated immunoglobulin CH2 regions include human IgG1, IgG2, IgG4 and mouse IgG2a CH2 regions with alanine substitutions at positions 234, 235, 237 (if present), 318, 320 and 322. An exemplary mutated immunoglobulin CH2 region is mouse IGHG2c CH2 region with alanine substitutions at L234, L235, G237, E318, K320, and K322.
[0075] In still further embodiments, in addition to the amino acid substitution at position 297 and the additional deletion(s) or substitution(s) at positions 234-238, an altered CH2 region (e.g., an altered human IgG1 CH2 domain) can further comprise one or more (e.g., two, three, four, five, or six) additional substitutions at positions 253, 310, 318, 320, 322, and 331. For example, an immunoglobulin CH2 region can comprise a (1) substitution at position 297, (2) one or more substitutions or deletions or a combination thereof at positions 234-238, and one or more (e.g., 2, 3, 4, 5, or 6) amino acid substitutions at positions 1253, H310, E318, K320, K322, and P331, such as one, two, three substitutions at positions E318, K320 and K322. The amino acids at the above-noted positions can be substituted by alanine or serine.
[0076] In certain embodiments, an immunoglobulin CH2 region polypeptide comprises: (i) an amino acid substitution at the asparagines of position 297 and one amino acid substitution at position 234, 235, 236 or 237; (ii) an amino acid substitution at the asparagine of position 297 and amino acid substitutions at two of positions 234-237; (iii) an amino acid substitution at the asparagine of position 297 and amino acid substitutions at three of positions 234-237; (iv) an amino acid substitution at the asparagine of position 297, amino acid substitutions at positions 234, 235 and 237, and an amino acid deletion at position 236; (v) amino acid substitutions at three of positions 234-237 and amino acid substitutions at positions 318, 320 and 322; or (vi) amino acid substitutions at three of positions 234-237, an amino acid deletion at position 236, and amino acid substitutions at positions 318, 320 and 322.
[0077] Exemplary altered immunoglobulin CH2 regions with amino acid substitutions at the asparagine of position 297 include: human IgG1 CH2 region with alanine substitutions at L234, L235, G237 and N297 and a deletion at G236 (SEQ ID NO:325 of WO2011/090762, said sequence incorporated by reference herein), human IgG2 CH2 region with alanine substitutions at V234, G236, and N297 (SEQ ID NO:326 of WO2011/090762, said sequence incorporated by reference herein), human IgG4 CH2 region with alanine substitutions at F234, L235, G237 and N297 and a deletion of G236 (SEQ ID NO:322 of WO2011/090762, said sequence incorporated by reference herein), human IgG4 CH2 region with alanine substitutions at F234 and N297 (SEQ ID NO:343 of WO2011/090762, said sequence incorporated by reference herein), human IgG4 CH2 region with alanine substitutions at L235 and N297 (SEQ ID NO:344 of WO2011/090762, said sequence incorporated by reference herein), human IgG4 CH2 region with alanine substitutions at G236 and N297 (SEQ ID NO:345 of WO2011/090762, said sequence incorporated by reference herein), and human IgG4 CH2 region with alanine substitutions at G237 and N297 (SEQ ID NO:346 of WO2011/090762, said sequence incorporated by reference herein).
[0078] In certain embodiments, in addition to the amino acid substitutions described above, an altered CH2 region (e.g., an altered human IgG1 CH2 domain) can contain one or more additional amino acid substitutions at one or more positions other than the above-noted positions. Such amino acid substitutions can be conservative or non-conservative amino acid substitutions. For example, in certain embodiments, P233 can be changed to E233 in an altered IgG2 CH2 region (see, e.g., SEQ ID NO:326 of WO2011/090762, said sequence incorporated by reference herein). In addition or alternatively, in certain embodiments, the altered CH2 region can contain one or more amino acid insertions, deletions, or both. The insertion(s), deletion(s) or substitution(s) can be anywhere in an immunoglobulin CH2 region, such as at the N- or C-terminus of a wild type immunoglobulin CH2 region resulting from linking the CH2 region with another region (e.g., a binding domain or an immunoglobulin heterodimerization domain) via a hinge.
[0079] In certain embodiments, an altered CH2 region in a polypeptide of the present disclosure comprises or is a sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% identical to a wild type immunoglobulin CH2 region, such as the CH2 region of wild type human IgG1, IgG2, or IgG4, or mouse IgG2a (e.g., IGHG2c).
[0080] An altered immunoglobulin CH2 region in a binding protein of the present invention can be derived from a CH2 region of various immunoglobulin isotypes, such as IgG1, IgG2, IgG3, IgG4, IgA1, IgA2, and IgD, from various species (including human, mouse, rat, and other mammals). In certain embodiments, an altered immunoglobulin CH2 region in a fusion protein of the present disclosure can be derived from a CH2 region of human IgG1, IgG2 or IgG4, or mouse IgG2a (e.g., IGHG2c), whose sequences are set forth in SEQ ID NOS:115, 199, 201, and 320 of WO2011/090762 (said sequences incorporated by reference herein).
[0081] In certain embodiments, an altered CH2 domain is a human IgG1 CH2 domain with alanine substitutions at positions 235, 318, 320, and 322 (i.e., a human IgG1 CH2 domain with L235A, E318A, K320A and K322A substitutions) (SEQ ID NO:595 of WO2011/090762, said sequence incorporated by reference herein), and optionally an N297 mutation (e.g., to alanine). In certain other embodiments, an altered CH2 domain is a human IgG1 CH2 domain with alanine substitutions at positions 234, 235, 237, 318, 320 and 322 (i.e., a human IgG1 CH2 domain with L234A, L235A, G237A, E318A, K320A and K322A substitutions) (SEQ ID NO:596 of WO2011/090762, said sequence incorporated by reference herein), and optionally an N297 mutation (e.g., to alanine).
[0082] In certain embodiments, an altered CH2 domain is an altered human IgG1 CH2 domain with mutations known in the art that enhance immunological activities such as ADCC, ADCP, CDC, complement fixation, Fc receptor binding, or any combination thereof.
[0083] The CH3 domain that can form an immunoglobulin constant region of a binding protein of the present invention can be a wild type immunoglobulin CH3 domain or an altered immunoglobulin CH3 domain thereof from certain immunoglobulin classes or subclasses (e.g., IgG1, IgG2, IgG3, IgG4, IgA1, IgA2, IgD, IgE, IgM) of various species (including human, mouse, rat, and other mammals). In certain embodiments, a CH3 domain is a wild type human immunoglobulin CH3 domain, such as wild type CH3 domains of human IgG1, IgG2, IgG3, IgG4, IgA1, IgA2, IgD, IgE, or IgM as set forth in SEQ ID NOS:116, 208-210, 204-207, and 212, respectively of WO2011/090762 (said sequences incorporated by reference herein). In certain embodiments, the CH3 domain is a wild type human IgG1 CH3 domain as set forth in SEQ ID NO:116 of WO2011/090762 (said sequence incorporated by reference herein). In certain embodiments, a CH3 domain is an altered human immunoglobulin CH3 domain, such as an altered CH3 domain based on or derived from a wild-type CH3 domain of human IgG1, IgG2, IgG3, IgG4, IgA1, IgA2, IgD, IgE, or IgM antibodies. For example, an altered CH3 domain can be a human IgG1 CH3 domain with one or two mutations at positions H433 and N434 (positions are numbered according to EU numbering). The mutations in such positions can be involved in complement fixation. In certain other embodiments, an altered CH3 domain can be a human IgG1 CH3 domain but with one or two amino acid substitutions at position F405 or Y407. The amino acids at such positions are involved in interacting with another CH3 domain. In certain embodiments, an altered CH3 domain can be an altered human IgG1 CH3 domain with its last lysine deleted. The sequence of this altered CH3 domain is set forth in SEQ ID NO:761 of WO2011/090762 (said sequence incorporated by reference herein).
[0084] In certain embodiments, binding proteins of the present invention forming a polypeptide heterodimer comprise a CH3 pair that comprises so called knobs-into-holes mutations (see, Marvin and Zhu, Acta Pharmacologica Sinica 26:649-58, 2005; Ridgway et al., Protein Engineering 9:617-21, 1966). More specifically, mutations can be introduced into each of the two CH3 domains of each polypeptide chain so that the steric complementarity required for CH3/CH3 association obligates these two CH3 domains to pair with each other. For example, a CH3 domain in one single chain polypeptide of a polypeptide heterodimer can contain a T366W mutation (a knob mutation, which substitutes a small amino acid with a larger one), and a CH3 domain in the other single chain polypeptide of the polypeptide heterodimer can contain a Y407A mutation (a hole mutation, which substitutes a large amino acid with a smaller one). Other exemplary knobs-into-holes mutations include (1) a T366Y mutation in one CH3 domain and a Y407T in the other CH3 domain, and (2) a T366W mutation in one CH3 domain and T366S, L368A and Y407V mutations in the other CH3 domain.
[0085] The CH4 domain that can form an immunoglobulin constant region of a binding protein of the present invention can be a wild type immunoglobulin CH4 domain or an altered immunoglobulin CH4 domain thereof from IgE or IgM molecules. In certain embodiments, the CH4 domain is a wild type human immunoglobulin CH4 domain, such as wild type CH4 domains of human IgE and IgM molecules as set forth in SEQ ID NOS:213 and 214, respectively, of WO2011/090762 (said sequences incorporated by reference herein). In certain embodiments, a CH4 domain is an altered human immunoglobulin CH4 domain, such as an altered CH4 domain based on or derived from a CH4 domain of human IgE or IgM molecules, which have mutations that increase or decrease an immunological activity known to be associated with an IgE or IgM Fc region.
[0086] In certain embodiments, an immunoglobulin constant region of a binding protein of the present invention comprises a combination of CH2, CH3 or CH4 domains (i.e., more than one constant region domain selected from CH2, CH3 and CH4). For example, the immunoglobulin constant region can comprise CH2 and CH3 domains or CH3 and CH4 domains. In certain other embodiments, the immunoglobulin constant region can comprise two CH3 domains and no CH2 or CH4 domains (i.e., only two or more CH3). The multiple constant region domains that form an immunoglobulin constant region can be based on or derived from the same immunoglobulin molecule, or the same class or subclass immunoglobulin molecules. In certain embodiments, the immunoglobulin constant region is an IgG CH2CH3 (e.g., IgG1 CH2CH3, IgG2 CH2CH3, and IgG4 CH2CH3) and can be a human (e.g., human IgG1, IgG2, and IgG4) CH2CH3. For example, in certain embodiments, the immunoglobulin constant region comprises (1) wild type human IgG1 CH2 and CH3 domains, (2) human IgG1 CH2 with N297A substitution (i.e., CH2(N297A)) and wild type human IgG1 CH3, or (3) human IgG1 CH2(N297A) and an altered human IgG1 CH3 with the last lysine deleted.
[0087] Alternatively, the multiple constant region domains can be based on or derived from different immunoglobulin molecules, or different classes or subclasses immunoglobulin molecules. For example, in certain embodiments, an immunoglobulin constant region comprises both human IgM CH3 domain and human IgG1 CH3 domain. The multiple constant region domains that form an immunoglobulin constant region can be directly linked together or can be linked to each other via one or more (e.g., about 2-10) amino acids.
[0088] Exemplary immunoglobulin constant regions are set forth in SEQ ID NOS:305-309, 321, 323, 341, 342, and 762 of WO2011/090762 (said sequences incorporated by reference herein).
[0089] In certain embodiments, the immunoglobulin constant regions of both binding proteins of a polypeptide homodimer or heterodimer are identical to each other. In certain other embodiments, the immunoglobulin constant region of one polypeptide chain of a heterodimeric protein is different from the immunoglobulin constant region of the other polypeptide chain of the heterodimer. For example, one immunoglobulin constant region of a heterodimeric protein can contain a CH3 domain with a knob mutation, whereas the other immunoglobulin constant region of the heterodimeric protein can contain a CH3 domain with a hole mutation.
[0090] In some embodiments, a binding protein used in the methods and compositions of the invention is a multispecific molecule that binds to a T-cell receptor, a T-cell receptor complex, or a component of a T-cell receptor complex and may be capable of redirected T-cell cytotoxicity. The binding protein may be a non-neutralizing antibody. T-cell receptor (TCR) is a molecule found on the surface of T-cells that, along with CD3, is generally responsible for recognizing antigens bound to major histocompatibility complex (MHC) molecules. It consists of a disulfide-linked heterodimer of the highly variable and chains in most T-cells. In other T-cells, an alternative receptor made up of variable and chains is expressed. Each chain of the TCR is a member of the immunoglobulin superfamily and possesses one N-terminal immunoglobulin variable domain, one immunoglobulin constant domain, a transmembrane region, and a short cytoplasmic tail at the C-terminal end (see Abbas and Lichtman, Cellular and Molecular Immunology (5th Ed.), Editor: Saunders, Philadelphia, 2003; Janeway et al., Immunobiology: The Immune System in Health and Disease, 4.sup.th Ed., Current Biology Publications, p 148, 149, and 172, 1999). TCR as used in the present disclosure can be from various animal species, including human, mouse, rat, or other mammals.
[0091] TCR complex, as used herein, refers to a complex formed by the association of CD3 chains with other TCR chains. For example, a TCR complex can be composed of a CD3 chain, a CD3 chain, two CD3 chains, a homodimer of CD3 chains, a TCR chain, and a TCR chain. Alternatively, a TCR complex can be composed of a CD3 chain, a CD3 chain, two CD3 chains, a homodimer of CD3 chains, a TCR chain, and a TCR chain.
[0092] A component of a TCR complex, as used herein, refers to a TCR chain (i.e., TCR, TCR, TCR or TCR), a CD3 chain (i.e., CD3, CD3, CD3 or CD3), or a complex formed by two or more TCR chains or CD3 chains (e.g., a complex of TCR and TCR, a complex of TCR and TCR, a complex of CD3 and CD3, a complex of CD3 and CD3, or a sub-TCR complex of TCR, TCR, CD3, CD3, and two CD3 chains).
[0093] Redirected T-cell cytotoxicity and RTCC, as used herein, refer to a T-cell-mediated process in which a cytotoxic T-cell is recruited to a target cell using a multispecific protein that is capable of specifically binding both the cytotoxic T-cell and the target cell, and whereby a target-dependent cytotoxic T-cell response is elicited against the target cell.
[0094] A binding protein used in the methods and compositions of the invention may bind to any suitable immunogenic antigen. An antigen may be used in its native conformation. An antigen may be an infectious organism antigen or a tumor cell antigen. In some embodiments, an antigen is a viral antigen. A viral antigen may be a recombinant viral subunit, inactivated virus, or live-attenuated virus. Non-limiting example of viral antigens include antigens from filovirus, human immunodeficiency virus, influenza virus A, influenza virus B, and influenza virus C. The filovirus family (Filoviridae) includes two accepted genera, Ebolavirus and Marburgvirus. The Ebolavirus genus includes EBOV (Ebola virus), SUDV (Sudan virus), BDBV (Bundibugyo virus), TAFV (Tai Forest virus) and RESTV (Reston virus). The Marburgvirus genus includes MARV (Marburg virus). All strains of MARV are contemplated for use in this invention (e.g., Ravn, Angola, Musoke, Popp, and Ci67). A filovirus antigen may be a filovirus glycoprotein (GP), which may comprise the GP2 subunit or the GP1 subunit of the Marburg virus glycoprotein. In other embodiments, an antigen is a bacterial antigen. In some embodiments, a filovirus antigen comprises a glycoprotein or glycoprotein precursor amino acid sequence provided in Table 1 (e.g., one of SEQ ID NOs:173-183) or a portion of these sequences. A bacterial antigen may be a Clostridium difficile antigen (e.g., C. difficile toxin A or C. difficile toxin B). The invention also encompasses biological antigens from fungus, plants or other eukaryotic organisms, such as ricin, from which immunotherapies may offer treatment by directing an immune response against immunorecessive epitopes. The invention also encompasses antigens produced synthetically or recombinantly through heterologous expression. In other aspects the antigen can be derived from diseased tissues including but not limited to cancerous tumors. The antigen may be an autoimmune antigen.
[0095] The present invention provides methods for inducing an immune response to at least one non-immunodominant epitope on an immunogenic antigen in a subject or patient in need thereof. As used herein, the term patient in need refers to a patient at risk of, or suffering from, a disease, disorder or condition that is amenable to treatment or amelioration with a method or composition provided herein. As used herein, the term treatment, treating, or ameliorating refers to either a therapeutic treatment or prophylactic/preventative treatment. A treatment is therapeutic if at least one symptom of disease in an individual receiving treatment improves or a treatment can delay worsening of a progressive disease in an individual, or prevent onset of additional associated diseases.
[0096] In the methods of the invention, an immunogenic composition (e.g., an antigen-binding protein complex) may be administered to a subject. In therapeutic applications, compositions or medicants are administered to a patient suspected of, or already suffering from such a disorder in an amount sufficient to cure, or at least partially arrest, the symptoms of the disorder and its complications. An amount adequate to accomplish this is referred to as a therapeutically effective dose or amount. As used herein, the term therapeutically effective amount (or dose) or effective amount (or dose) of a specific binding molecule or compound refers to that amount of the compound sufficient to result in amelioration of one or more symptoms of the disease being treated in a statistically significant manner or a statistically significant improvement in organ function. When referring to an individual active ingredient, administered alone, a therapeutically effective dose refers to that ingredient alone. When referring to a combination, a therapeutically effective dose refers to combined amounts of the active ingredients that result in the therapeutic effect, whether administered serially or simultaneously (in the same formulation or concurrently in separate formulations).
[0097] In prophylactic applications, pharmaceutical compositions or medicants are administered to a patient susceptible to, or otherwise at risk of, a particular disorder in an amount sufficient to eliminate or reduce the risk or delay the onset of the disorder. In both prophylactic and therapeutic regimes, agents are usually administered in several dosages until a sufficient response has been achieved. Typically, the response is monitored and repeated dosages are given if the desired response starts to fade. The methods and compositions of the invention may be used in vaccine applications.
[0098] An immunogenic composition used herein may comprise a pharmaceutically acceptable carrier, excipient or diluent. As used herein, the term pharmaceutically acceptable refers to molecular entities and compositions that do not generally produce allergic or other serious adverse reactions when administered using routes well known in the art. Molecular entities and compositions approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in animals, and more particularly in humans are considered to be pharmaceutically acceptable. A carrier is said to be a pharmaceutically acceptable carrier if its administration can be tolerated by a recipient patient. Sterile phosphate-buffered saline is one example of a pharmaceutically acceptable carrier. Other suitable carriers, diluents or excipients are well-known to those in the art. (See, e.g., Gennaro (ed.), Remington's Pharmaceutical Sciences (Mack Publishing Company, 19th ed. 1995).) Formulations can further include one or more excipients, preservatives, solubilizers, buffering agents, albumin to prevent protein loss on vial surfaces, etc.
[0099] A pharmaceutical composition comprising an immunogenic composition as described herein may be formulated in a dosage form selected from the group consisting of: an oral unit dosage form, an intravenous unit dosage form, an intranasal unit dosage form, a suppository unit dosage form, an intradermal unit dosage form, an intramuscular unit dosage form, an intraperitoneal unit dosage form, a subcutaneous unit dosage form, an epidural unit dosage form, a sublingual unit dosage form, and an intracerebral unit dosage form. The oral unit dosage form may be selected from the group consisting of: tablets, pills, pellets, capsules, powders, lozenges, granules, solutions, suspensions, emulsions, syrups, elixirs, sustained-release formulations, aerosols, and sprays.
[0100] Pharmaceutical compositions can be supplied as a kit comprising a container that comprises the pharmaceutical composition as described herein. A pharmaceutical composition can be provided, for example, in the form of an injectable solution for single or multiple doses, or as a sterile powder that will be reconstituted before injection. Alternatively, such a kit can include a dry-powder disperser, liquid aerosol generator, or nebulizer for administration of a pharmaceutical composition. Such a kit can further comprise written information on indications and usage of the pharmaceutical composition.
[0101] A pharmaceutical composition comprising an immunogenic composition may be administered to a subject in a therapeutically effective amount. According to the methods of the present disclosure, an immunogenic composition can be administered to subjects by a variety of administration modes, including, for example, by intramuscular, subcutaneous, intravenous, intra-atrial, intra-articular, parenteral, intranasal, intrapulmonary, transdermal, intrapleural, intrathecal, and oral routes of administration. For prevention and treatment purposes, an antagonist can be administered to a subject in a single bolus delivery, via continuous delivery (e.g., continuous transdermal delivery) over an extended time period, or in a repeated administration protocol (e.g., on an hourly, daily, weekly, or monthly basis).
[0102] An immunogenic composition may comprise at least one adjuvant. Adjuvants that may be used to increase the immunogenicity of an antigen, e.g., an immunodominant epitope, include any compound or compounds that act to increase an immune response to peptides or combination of peptides. Non-limiting examples of adjuvants include alum, aluminum phosphate, aluminum hydroxide, MF59 (4.3% w/v squalene, 0.5% w/v polysorbate 80 (Tween 80), 0.5% w/v sorbitan trioleate (Span 85)), CpG-containing nucleic acid, QS21 (saponin adjuvant), MPL (Monophosphoryl Lipid A), 3DMPL (3-O-deacylated MPL), extracts from Aquilla, ISCOMS (see, e.g., Sjolander et al. (1998) J. Leukocyte Biol. 64:713; WO90/03184; WO96/11711; WO 00/48630; WO98/36772; WO00/41720; WO06/134423 and WO07/026190), LT/CT mutants, poly(D,L-lactide-co-glycolide) (PLG) microparticles, Quil A, interleukins, Freund's, N-acetyl-muramyl-L-threonyl-D-isoglutamine (thr-MDP), N-acetyl-nor-muramyl-L-alanyl-D-isoglutamine (CGP 11637, referred to as nor-MDP), N-acetylmuramyl-L-alanyl-D-isoglutaminyl-L-alanine-2-(1-2-dip-almitoyl-sn-glycero-3-hydroxyphosphoryloxy)-ethylamine (CGP 19835A, referred to as MTP-PE), and RIBI, which contains three components extracted from bacteria, monophosphoryl lipid A, trehalose dimycolate and cell wall skeleton (MPL+TDM+CWS) in a 2% squalene/Tween 80 emulsion.
[0103] In one aspect, an immune response induced by the methods and compositions described herein is a B-cell response (e.g, the production of an antibody specific to a non-immunodominant epitope on the immunogenic antigen). In some embodiments, the invention further comprises harvesting the antibody specific to a non-immunodominant epitope on the immunogenic antigen from the subject. The harvested antibody may be a neutralizing antibody. A panel of harvested antibodies may be screened for binding (e.g., by ELISA, surface plasmon resonance or Western blot) to the antigen and/or the binding protein used to immunize the subject. Antibodies that bind to the binding protein may be eliminated or subtracted from the panel. As described in Examples 1-3, antibodies CAN54G1, CAN54G2, and CAN54G3 were generated using the methods and compositions of the invention. The amino acid and nucleic acid sequences of the harvested antibody may be obtained and used to generate a humanized antibody by any of the methods described above or generally known in the art. One or more antibodies produced by a subject after immunization by the methods of the invention may be used in a prophylactic (e.g., vaccine) or therapeutic treatment of a disease or disorder caused by an infectious organism comprising the antigen used in the immunization.
[0104] In some embodiments, a subject to be immunized or treated by the methods or compositions of the invention is a vertebrate, e.g., a mammal or a non-mammal, including humans, mice, rats, guinea pigs, hamsters, dogs, cats, cows, horses, goats, sheep, pigs, non-human primates, monkeys, apes, gorillas, chimpanzees, rabbits, ducks, geese, chickens, amphibians, reptiles and other animals. The present compositions and methods may be for veterinary use. A subject may be an experimental animal or a transgenic animal. In one aspect, a subject is transgenic and produces human antibodies, e.g., a mouse expressing the human immunoglobulin gene segments (see, e.g., U.S. Pat. Nos. 8,236,311; 7,625,559 and 5,770,429; Lonberg et al., Nature 368(6474): 856-859, 1994; Lonberg, N., Handbook of Experimental Pharmacology 113:49-101, 1994; Lonberg, N. and Huszar, D., Intern. Rev. Immunol., 13: 65-93, 1995; Harding, F. and Lonberg, N., Ann. N.Y. Acad. Sci., 764:536-546, 1995). The invention further encompasses hybridomas generated from animals immunized by the methods and compositions of the invention. Methods of producing hybridomas are generally known in the art and are also described in the Examples.
[0105] The present invention provides methods for inducing an immune response to at least one non-immunodominant epitope on an immunogenic antigen in a subject. In some embodiments, a subject treated by the methods or compositions of the invention may be used to generate a hyperimmune. The term hyperimmune, hyperimmune preparation or hyperimmune composition refers to a composition enriched with antibodies specific to one or more particular epitopes. In another embodiment, a subject treated by the methods or compositions of the invention may be used to generate a hyperimmune composition enriched with antibodies to one or more non-immunodominant epitopes and may contain a high titer or concentration of antibodies to one or more non-immunodominant epitopes. In a further embodiment, the antibodies to the non-immunodominant epitopes enriched in the hyperimmune composition are neutralizing.
[0106] A hyperimmune preparation of the present disclosure comprises antibodies that may be derived from human or animal plasma after undergoing a series of processing steps. The first step comprises the screening of donor's plasma to identify and collect plasma that demonstrates high titers or elevated serum levels of polyclonal antibodies, particularly high antibody titers to non-immunodominant epitopes. Plasma donors samples having high antibody titers is pooled and fractionated. The primary component of the fractionated pooled plasma is IgG.
[0107] Hyperimmune preparations may be prepared by various methods using animal plasma or serum. As used herein, animals can include both humans, non-human primates, as well as other animals, such as horse, sheep, goat, mouse, rabbit, dog, etc. The animal may be artificially immunized with an immunogenic composition via intramuscular, subcutaneous, intraperitoneal or intraocular injection, with or without adjuvant. Samples of serum are collected and tested for reactivity to the non-immunodominant epitope and if required may be boosted with the immunogenic composition one or more times. Once the titer of the animal has reached a plateau in terms of antigen reactivity, larger quantities of antisera may be obtained readily either by periodic bleeding or exsanguinating the non-human animal.
[0108] The present invention provides methods for inducing an immune response to at least one non-immunodominant epitope on an immunogenic antigen in a subject. In some embodiments, the immunogenic composition is a vaccine. A vaccine may comprise the antigen-binding protein complex in combination with a pharmaceutically acceptable adjuvant. In one embodiment, the vaccine may be administered to a patient population at risk for developing a disease or at risk of a disease progressing. In one embodiment, for treatment with a vaccine, subjects may be immunized on a schedule that may vary from once a day to once a week, to once a month, to once a year or longer. The schedule may require a booster injection depending on the immune response and physiological condition of the subject. In one embodiment, the antibodies generated on administration of a vaccine to a subject in need may be therapeutic. Treatment with a vaccine is considered therapeutic if at least one symptom of disease in a subject receiving treatment improves or a treatment can delay worsening of a progressive disease in an individual, or prevent onset of additional associated diseases.
[0109] The invention will be further clarified by the following examples, which are intended to be purely exemplary of the invention and in no way limiting.
EXAMPLES
Example 1
Production of Immunogenic Composition
[0110] An exemplary immunogenic composition binding to a Marburg virus (Ravn strain) glycoprotein (GP) variant was produced as follows. Ravn GPemuc (SEQ ID NO:169; see
[0111]
Example 2
Antigen Preparation
[0112] Marburgvirus (MARV; Ravn and Angola strains) and ebolavirus glycoprotein (GP) antigens were produced by stable cell line expression in Drosophila S2 and Spodoptera Sf9, or by transient transfection in Gnt/ HEK293 cells. Proteins were engineered with either a strep or HA tag at the C-terminus to facilitate purification using streptactin (Qiagen) or anti-HA affinity resin (Roche), respectively. GP ectodomain constructs (GPe) lack the transmembrane (TM) domain and consist of residues 1-637. GP ectodomain mucin-deleted constructs (GPemuc) also lack the mucin-like domain: 257-425 for all MARV strains, 314-463 for EBOV (Ebola virus), SUDV (Sudan virus), BDBV (Bundibugyo virus) and 316-470 for RESTV (Reston virus). As a control for epitope-mapping experiments, an additional MARV GP construct was purified from S2 cells lacking both the GP1 mucin domain (257-425) and the GP2-wing (436-483), termed GPemucw. GP and GP construct sequences are provided in Table 1. To mimic endosomal cathepsin protease cleavage, cleaved MARV GP (GPcl) was produced by incubation of MARV Ravn strain GPemuc with trypsin a ratio of 1:100 in TBS pH 7.5 at 37 C. for 1 hour. Cleaved EBOV GP was produced by treatment with thermolysin at a ratio of 1:50 overnight at room temperature in TBS pH 7.5 containing 1 mM CaCl.sub.2. GPe proteins were further purified by Superose 6 and all other GP proteins were purified by Superdex 200 size exclusion chromatography. The GP schematic and construct design for the engineered peptides are shown in the diagram in
TABLE-US-00001 TABLE1 Aminoacidandnucleotidesequencesofantibodydomainsandantigens SEQ Antibody Chain, ID Name Region Origin Sequence NO CAN30G5 K, Murine gatattgtgctgacccaatctccactctccctgcctgtcagtcttgg 1 Variable sequence agatcaagcctccatctcttgcagatctagtcagagccttgtaca region cagtaatggaaacacctatttacattggtacctgcagaagccag gccagtctccaaacctcctgatctacaaagtttccaaccgattttct ggggtcccagacaggttcagtggcagtggatcagggacagatt tcacactcaagatcagcagagtggaggctgaggatctgggagt ttatttctgctctcaaagtacacatgttccgtggacgttcggtggag gcaccaagctggaaatcaaa CAN30G5 K, Murine DIVLTQSPLSLPVSLGDQASISCRSSQSLVHSN 2 variable sequence GNTYLHWYLQKPGQSPNLLIYKVSNRFSGVP region DRFSGSGSGTDFTLKISRVEAEDLGVYFCSQS THVPWTFGGGTKLEIK CAN30G5 K, Murine cagagccttgtacacagtaatggaaacacctat 3 CDR1 sequence CAN30G5 K, Murine aaagtttcc 4 CDR2 sequence CAN30G5 K, Murine tctcaaagtacacatgttccgtggacg 5 CDR3 sequence CAN30G5 K, Murine QSLVHSNGNTY 6 CDR1 sequence CAN30G5 K, Murine KVS 7 CDR2 sequence CAN30G5 K, Murine SQSTHVPWT 8 CDR3 sequence CAN30G5 K,FR1 Murine gatattgtgctgacccaatctccactctccctgcctgtcagtcttgg 9 sequence agatcaagcctccatctcttgcagatctagt CAN30G5 K,FR2 Murine ttacattggtacctgcagaagccaggccagtctccaaacctcctg 10 sequence atctac CAN30G5 K,FR3 Murine aaccgattttctggggtcccagacaggttcagtggcagtggatca 11 sequence gggacagatttcacactcaagatcagcagagtggaggctgag gatctgggagtttatttctgc CAN30G5 K,FR4 Murine ttcggtggaggcaccaagctggaaatcaaa 12 sequence CAN30G5 H, Murine gaggtgcagcttgttgagtctggtggaggattggtgcagcctaaa 13 Variable sequence ggatcattgaaactctcatgtgccgcctctggtttcgccttcaattcc region tatgccatgcactgggtctgccaggctccaggaaagggtttgga atgggttgctcgcataagaattaaaagtggtaattatgcaacatct tatgccggttcagtgacagacagattcaccgtctccagagatgat tcacaaaacttgttctatctgcaaatgaacaacctgaaaactgag gacacagccatgtattactgtgtgagagagtgggaaggggctat ggactactggggtcaaggaacctcagtcaccgtctcctcag CAN30G5 H, Murine EVQLVESGGGLVQPKGSLKLSCAASGFAFNS 14 variable sequence YAMHWVCQAPGKGLEWVARIRIKSGNYATSY region AGSVTDRFTVSRDDSQNLFYLQMNNLKTEDT AMYYCVREWEGAMDYWGQGTSVTVSS CAN30G5 H,CDR1 Murine ggtttcgccttcaattcctatgcc 15 sequence CAN30G5 H,CDR2 Murine ataagaattaaaagtggtaattatgcaaca 16 sequence CAN30G5 H,CDR3 Murine gtgagagagtgggaaggggctatggactac 17 sequence CAN30G5 H,CDR1 Murine GFAFNSYA 18 sequence CAN30G5 H,CDR2 Murine IRIKSGNYAT 19 sequence CAN30G5 H,CDR3 Murine VREWEGAMDY 20 sequence CAN30G5 H,FR1 Murine gaggtgcagcttgttgagtctggtggaggattggtgcagcctaaa 21 sequence ggatcattgaaactctcatgtgccgcctct CAN30G5 H,FR2 Murine atgcactgggtctgccaggctccaggaaagggtttggaatgggt 22 sequence tgctcgc CAN30G5 H,FR3 Murine tcttatgccggttcagtgacagacagattcaccgtctccagagat 23 sequence gattcacaaaacttgttctatctgcaaatgaacaacctgaaaact gaggacacagccatgtattactgt CAN30G5 H,FR4 Murine tggggtcaaggaacctcagtcaccgtctcctcag 24 sequence CAN54G2 K, Murine gatgttgtgatgacccagactcccctcactttgtcggttaccattgg 25 Variable sequence acagccagcctccatctcttgcacgtcaagtcagagcctcttaaa region tagtgatggggagacatatttgaattggttgttacagaggccagg ccagtctccaaagcgcctaatccatctggtgtctaaactggactct ggagtccctgacaggatcactggcagtggatctgggacagattt cacactgaaaatcaacagagtggaggctgaggatttgggaattt attattgctggcaaggtacacattttccgtggacgttcggtggagg caccaagctggaaatcaaac CAN54G2 K, Murine DVVMTQTPLTLSVTIGQPASISCTSSQSLLNSD 26 variable sequence GETYLNWLLQRPGQSPKRLIHLVSKLDSGVPD region RITGSGSGTDFTLKINRVEAEDLGIYYCWQGT HFPWTFGGGTKLEIK CAN54G2 K,CDR1 Murine cagagcctcttaaatagtgatggggagacatat 27 sequence CAN54G2 K,CDR2 Murine ctggtgtct 28 sequence CAN54G2 K,CDR3 Murine tggcaaggtacacattttccgtggacg 29 sequence CAN54G2 K,CDR1 Murine QSLLNSDGETY 30 sequence CAN54G2 K,CDR2 Murine LVS 31 sequence CAN54G2 K,CDR3 Murine WQGTHFPWT 32 sequence CAN54G2 K,FR1 Murine gatgttgtgatgacccagactcccctcactttgtcggttaccattgg 33 sequence acagccagcctccatctcttgcacgtcaagt CAN54G2 K,FR2 Murine ttgaattggttgttacagaggccaggccagtctccaaagcgccta 34 sequence atccat CAN54G2 K,FR3 Murine aaactggactctggagtccctgacaggatcactggcagtggatc 35 sequence tgggacagatttcacactgaaaatcaacagagtggaggctgag gatttgggaatttattattgc CAN54G2 K,FR4 Murine ttcggtggaggcaccaagctggaaatcaaac 36 sequence CAN54G2 H, Murine caggtccagttgcagcagtctggaactgagctggtaaggcctgg 37 Variable sequence gacttcagtgaagatatcctgcaaggcttctggatacgacttcact region aacttttggctaggttggataaagcagaggcctggacatggactt gaatggattggagatatttaccctggaggtgataatacttactaca atgagaagttcaagggcaaagtcacgctgactgcagacaaat cctcgaacacagcctatatgcagttcagtagcctgacatctgag gactctgctgtctatttctgttttatgattctctatactttggactactgg ggtcaaggaacctcagtcaccgtctcctcag CAN54G2 H, Murine QVQLQQSGTELVRPGTSVKISCKASGYDFTN 38 variable sequence FWLGWIKQRPGHGLEWIGDIYPGGDNTYYNE region KFKGKVTLTADKSSNTAYMQFSSLTSEDSAVY FCFMILYTLDYWGQGTSVTVSS CAN54G2 H,CDR1 Murine ggatacgacttcactaacttttgg 39 sequence CAN54G2 H,CDR2 Murine atttaccctggaggtgataatact 40 sequence CAN54G2 H,CDR3 Murine tttatgattctctatactttggactac 41 sequence CAN54G2 H,CDR1 Murine GYDFTNFW 42 sequence CAN54G2 H,CDR2 Murine IYPGGDNT 43 sequence CAN54G2 H,CDR3 Murine FMILYTLDY 44 sequence CAN54G2 H,FR1 Murine caggtccagttgcagcagtctggaactgagctggtaaggcctgg 45 sequence gacttcagtgaagatatcctgcaaggcttct CAN54G2 H,FR2 Murine ctaggttggataaagcagaggcctggacatggacttgaatggat 46 sequence tggagat CAN54G2 H,FR3 Murine tactacaatgagaagttcaagggcaaagtcacgctgactgcag 47 sequence acaaatcctcgaacacagcctatatgcagttcagtagcctgaca tctgaggactctgctgtctatttctgt CAN54G2 H,FR4 Murine tggggtcaaggaacctcagtcaccgtctcctcag 48 sequence CAN30G2 K, Murine gatgttttgatgacccaaactccactctccctgcctgtcagtcttgg 49 Variable sequence agatcaagcctccatctcttgcagatctagtcagagcattgtacat region agtaatggagacacctatttagaatggtacctgcagaaaccag gccagtctccaaagctcctgatctacaaagtttccaaccgattttct ggggtcccagacaggttcagtggcagtggatcagggacagatt tcacactcaggatcagcagagtggaggctgaggatctgggagt ttattactgctttcaaggttcacattttccgtggacgttcggtggagg caccaagctggaaatcaaac CAN30G2 K, Murine DVLMTQTPLSLPVSLGDQASISCRSSQSIVHS 50 variable sequence NGDTYLEWYLQKPGQSPKLLIYKVSNRFSGV region PDRFSGSGSGTDFTLRISRVEAEDLGVYYCFQ GSHFPWTFGGGTKLEIK CAN30G2 K,CDR1 Murine cagagcattgtacatagtaatggagacacctat 51 sequence CAN30G2 K,CDR2 Murine aaagtttcc 52 sequence CAN30G2 K,CDR3 Murine tttcaaggttcacattttccgtggacg 53 sequence CAN30G2 K,CDR1 Murine QSIVHSNGDTY 54 sequence CAN30G2 K,CDR2 Murine KVS 55 sequence CAN30G2 K,CDR3 Murine FQGSHFPWT 56 sequence CAN30G2 K,FR1 Murine gatgttttgatgacccaaactccactctccctgcctgtcagtcttgg 57 sequence agatcaagcctccatctcttgcagatctagt CAN30G2 K,FR2 Murine ttagaatggtacctgcagaaaccaggccagtctccaaagctcct 58 sequence gatctac CAN30G2 K,FR3 Murine aaccgattttctggggtcccagacaggttcagtggcagtggatca 59 sequence gggacagatttcacactcaggatcagcagagtggaggctgag gatctgggagtttattactgc CAN30G2 K,FR4 Murine ttcggtggaggcaccaagctggaaatcaaac 60 sequence CAN30G2 H, Murine gatgtgcagctggtggagtctgggggaggcttagtgcagcctgg 61 Variable sequence agggtcccggaaactctcctgtacagcctctggattcactttcagt region agctttggaatgcactgggttcgtcaggctccagagaaggggct ggagtgggtcgcatacattagtagtggcagtagtaaaatctacta tgcagacacggtgaagggccgattcaccatctccagagacaat cccaagaacaccctgttcctgcaaatgaccagtctaaggtctga ggacacggccatgtattactgtgcaagagggtggtacgagggg gcctggtttgcttactggggccaagggactctggtcactgtctctg cag CAN30G2 H, Murine DVQLVESGGGLVQPGGSRKLSCTASGFTFSS 62 variable sequence FGMHWVRQAPEKGLEWVAYISSGSSKIYYAD region TVKGRFTISRDNPKNTLFLQMTSLRSEDTAMY YCARGWYEGAWFAYWGQGTLVTVSA CAN30G2 H,CDR1 Murine ggattcactttcagtagctttgga 63 sequence CAN30G2 H,CDR2 Murine attagtagtggcagtagtaaaatc 64 sequence CAN30G2 H,CDR3 Murine gcaagagggtggtacgagggggcctggtttgcttac 65 sequence CAN30G2 H,CDR1 Murine GFTFSSFG 66 sequence CAN30G2 H,CDR2 Murine ISSGSSKI 67 sequence CAN30G2 H,CDR3 Murine ARGWYEGAWFAY 68 sequence CAN30G2 H,FR1 Murine gatgtgcagctggtggagtctgggggaggcttagtgcagcctgg 69 sequence agggtcccggaaactctcctgtacagcctct CAN30G2 H,FR2 Murine atgcactgggttcgtcaggctccagagaaggggctggagtggg 70 sequence tcgcatac CAN30G2 H,FR3 Murine tactatgcagacacggtgaagggccgattcaccatctccagag 71 sequence acaatcccaagaacaccctgttcctgcaaatgaccagtctaag gtctgaggacacggccatgtattactgt CAN30G2 H,FR4 Murine tggggccaagggactctggtcactgtctctgcag 72 sequence CAN40G1 K, Murine gacattgtgctgacccaatctccagcttctttggctgtgtctctagg 73 Variable sequence gcagagggcctccatctcctgcaaggccagccaaagtgttgat region catgatggtgatagttatatgaactggtaccaacagaaaccagg acagccacccaaactcctcatctatgctacatccaatctagaatc tgggatcccagccaggtttagtggcagtgggtctgggacagact tcaccctcaacatccatcctgtggaggaggaggatgctgcaac ctattactgtcagcagagttatgaggttccgctcacgttaggtgctg ggaccaagctggagctgaaac CAN40G1 K, Murine DIVLTQSPASLAVSLGQRASISCKASQSVDHD 74 variable sequence GDSYMNWYQQKPGQPPKLLIYATSNLESGIP region ARFSGSGSGTDFTLNIHPVEEEDAATYYCQQ SYEVPLTFGAGTKLELK CAN40G1 K,CDR1 Murine caaagtgttgatcatgatggtgatagttat 75 sequence CAN40G1 K,CDR2 Murine gctacatcc 76 sequence CAN40G1 K,CDR3 Murine cagcagagttatgaggttccgctcacg 77 sequence CAN40G1 K,CDR1 Murine QSVDHDGDSY 78 sequence CAN40G1 K,CDR2 Murine ATS 79 sequence CAN40G1 K,CDR3 Murine QQSYEVPLT 80 sequence CAN40G1 K,FR1 Murine gacattgtgctgacccaatctccagcttctttggctgtgtctctagg 81 sequence gcagagggcctccatctcctgcaaggccagc CAN40G1 K,FR2 Murine atgaactggtaccaacagaaaccaggacagccacccaaact 82 sequence cctcatctat CAN40G1 K,FR3 Murine aatctagaatctgggatcccagccaggtttagtggcagtgggtct 83 sequence gggacagacttcaccdcaacatccatcctgtggaggaggagg atgctgcaacctattactgt CAN40G1 K,FR4 Murine ttcggtgctgggaccaagctggagctgaaac 84 sequence CAN40G1 H, Murine gaggtccagctgcaacagtctggacctgagctggtgaagcctg 85 Variable sequence gggcttcagtgaagatatcctgcaggacttctggatacacattca region ctgaatacaccattcactgggtgaagcagagccgtggaaaga gccttgagtggattggaggtattaatcctaaccatggtggtactct ctacaaccagaagttcaaggtcaaggccacattgactgtagac aagtcctccagcacagcctacatggagctccgcagcctgacat ctgaggattctgcagtctattactgtgcaagatttacttacgactact ggggccaaggcaccactctcacagtctcctcag CAN40G1 H, Murine EVQLQQSGPELVKPGASVKISCRTSGYTFTEY 86 variable sequence TIHWVKQSRGKSLEWIGGINPNHGGTLYNQK region FKVKATLTVDKSSSTAYMELRSLTSEDSAVYY CARFTYDYWGQGTTLTVSS CAN40G1 H,CDR1 Murine ggatacacattcactgaatacacc 87 sequence CAN40G1 H,CDR2 Murine attaatcctaaccatggtggtact 88 sequence CAN40G1 H,CDR3 Murine gcaagatttacttacgactac 89 sequence CAN40G1 H,CDR1 Murine GYTFTEYT 90 sequence CAN40G1 H,CDR2 Murine INPNHGGT 91 sequence CAN40G1 H,CDR3 Murine ARFTYDY 92 sequence CAN40G1 H,FR1 Murine gaggtccagctgcaacagtctggacctgagctggtgaagcctg 93 sequence gggcttcagtgaagatatcctgcaggacttct CAN40G1 H,FR2 Murine attcactgggtgaagcagagccgtggaaagagccttgagtgga 94 sequence ttggaggt CAN40G1 H,FR3 Murine ctctacaaccagaagttcaaggtcaaggccacattgactgtaga 95 sequence caagtcctccagcacagcctacatggagctccgcagcctgaca tctgaggattctgcagtctattactgt CAN40G1 H,FR4 Murine tggggccaaggcaccactctcacagtctcctcag 96 sequence CAN30G1 K, Murine gaaaatgttctcacccagtctccagcaatcatgtctgcatctccag 97 Variable sequence gggaaaaggtcaccatgacctgcagtgccagctcaagtgtaac region ttacatgcactggtaccagcagaagtcaagcacctcccccaaa ctctggatttatgacacatccaaactggcttctggagtccaggtc gcttcagtggcagtgggtctggaaactcttactctctcacgatcag cagcatggaggctgaagatgttgccacttattactgttttcagggg agtgggtacccgtacacgttcggaggggggaccaagctggaa ataaaac CAN30G1 K, Murine ENVLTQSPAIMSASPGEKVTMTCSASSSVTY 98 variable sequence MHWYQQKSSTSPKLWIYDTSKLASGVPGRFS region GSGSGNSYSLTISSMEAEDVATYYCFQGSGY PYTFGGGTKLEIK CAN30G1 K,CDR1 Murine gccagctcaagtgtaacttac 99 sequence CAN30G1 K,CDR2 Murine gacacatcc 100 sequence CAN30G1 K,CDR3 Murine tttcaggggagtgggtacccgtacacg 101 sequence CAN30G1 K,CDR1 Murine ASSSVTY 102 sequence CAN30G1 K,CDR2 Murine DTS 103 sequence CAN30G1 K,CDR3 Murine FQGSGYPYT 104 sequence CAN30G1 K,FR1 Murine gaaaatgttctcacccagtctccagcaatcatgtctgcatctccag 105 sequence gggaaaaggtcaccatgacctgcagt CAN30G1 K,FR2 Murine atgcactggtaccagcagaagtcaagcacctcccccaaactct 106 sequence ggatttat CAN30G1 K,FR3 Murine aaactggcttctggagtccaggtcgcttcagtggcagtgggtct 107 sequence ggaaactcttactctctcacgatcagcagcatggaggctgaaga tgttgccacttattactgt CAN30G1 K,FR4 Murine ttcggaggggggaccaagctggaaataaaac 108 sequence CAN30G1 H, Murine cagatccagttggtgcagtctggacctgagctgaagaagcctgg 109 Variable sequence agagacagtcaagatctcctgcaaggcttctgggtataccttcac region aaactatggaatgaactgggtgaagcaggctccaggaaaggg tttaaagtggatgggctggataaacacctacactggaaagcca acatatgttgatgacttcaagggacggtttgccttctctttggaaac ctctgccaacactgcctatttgcagatcaacaacctcaaaaatg aggacacggctacatatttctgtgaaagtggaggttacgacgag gactactggggccaaggcaccactctcacagtctcctcag CAN30G1 H, Murine QIQLVQSGPELKKPGETVKISCKASGYTFTNY 110 variable sequence GMNWVKQAPGKGLKWMGWINTYTGKPTYVD region DFKGRFAFSLETSANTAYLQINNLKNEDTATY FCESGGYDEDYWGQGTTLTVSS CAN30G1 H,CDR1 Murine gggtataccttcacaaactatgga 111 sequence CAN30G1 H,CDR2 Murine ataaacacctacactggaaagcca 112 sequence CAN30G1 H,CDR3 Murine gaaagtggaggttacgacgaggactac 113 sequence CAN30G1 H,CDR1 Murine GYTFTNYG 114 sequence CAN30G1 H,CDR2 Murine INTYTGKP 115 sequence CAN30G1 H,CDR3 Murine ESGGYDEDY 116 sequence CAN30G1 H,FR1 Murine cagatccagttggtgcagtctggacctgagctgaagaagcctgg 117 sequence agagacagtcaagatctcctgcaaggcttct CAN30G1 H,FR2 Murine atgaactgggtgaagcaggctccaggaaagggtttaaagtgga 118 sequence tgggctgg CAN30G1 H,FR3 Murine acatatgttgatgacttcaagggacggtttgccttctctttggaaac 119 sequence ctctgccaacactgcctatttgcagatcaacaacctcaaaaatg aggacacggctacatatttctgt CAN30G1 H,FR4 Murine tggggccaaggcaccactctcacagtctcctcag 120 sequence CAN30G3 K, Murine gatgttttgatgacccaaactccactctccctgcctgtcagtcttgg 121 Variable sequence agatcaagcctccatctcttgcagatctagtcagaacattgtacat region agtaatggaaacacctatttagaatggtacctgcagaaatcagg ccagtctccaaagctcctgatctacaaagtttccaaccgattttctg gggtcccagacaggttcagtggcagtggatcagggacagattt cacactcaagatcagcagagtggaggctgaggatctgggagtt tattactgctttcaaggttcacattttccgtggacgttcggtggaggc accaagctggaaatcaaac CAN30G3 K, Murine DVLMTQTPLSLPVSLGDQASISCRSSQNIVHS 122 variable sequence NGNTYLEWYLQKSGQSPKLLIYKVSNRFSGV region PDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQ GSHFPWTFGGGTKLEIK CAN30G3 K,CDR1 Murine cagaacattgtacatagtaatggaaacacctat 123 sequence CAN30G3 K,CDR2 Murine aaagtttcc 124 sequence CAN30G3 K,CDR3 Murine tttcaaggttcacattttccgtggacg 125 sequence CAN30G3 K,CDR1 Murine QNIVHSNGNTY 126 sequence CAN30G3 K,CDR2 Murine KVS 127 sequence CAN30G3 K,CDR3 Murine FQGSHFPWT 128 sequence CAN30G3 K,FR1 Murine gatgttttgatgacccaaactccactctccctgcctgtcagtcttgg 129 sequence agatcaagcctccatctcttgcagatctagt CAN30G3 K,FR2 Murine ttagaatggtacctgcagaaatcaggccagtctccaaagctcct 130 sequence gatctac CAN30G3 K,FR3 Murine aaccgattttctggggtcccagacaggttcagtggcagtggatca 131 sequence gggacagatttcacactcaagatcagcagagtggaggctgag gatctgggagtttattactgc CAN30G3 K,FR4 Murine ttcggtggaggcaccaagctggaaatcaaac 132 sequence CAN30G3 H, Murine caggtgcagctgaaggagtcaggacctggcctggtggcgccct 133 Variable sequence cacagagcctgtccatcacatgcactgtctcagggttctccttaac region cgactatggtataacctggattcgccagcctccaggaaagggtc tggagtggctgggagtaatatggggtggtggaagcgcatactat aatttagttctcaaatccagactgagcatcagcaaggacaactc caagagtcaagttttcttaaaaatgaacagtctgcaaactgatga cacagccatgtactactgtgccaaacatcggactttgattacgac tgctatggactactggggtcaaggaatttcagtcaccgtctcctca g CAN30G3 H, Murine QVQLKESGPGLVAPSQSLSITCTVSGFSLTDY 134 variable sequence GITWIRQPPGKGLEWLGVIWGGGSAYYNLVL region KSRLSISKDNSKSQVFLKMNSLQTDDTAMYYC AKHRTLITTAMDYWGQGISVTVSS CAN30G3 H,CDR1 Murine gggttctccttaaccgactatggt 135 sequence CAN30G3 H,CDR2 Murine atatggggtggtggaagcgca 136 sequence CAN30G3 H,CDR3 Murine gccaaacatcggactttgattacgactgctatggactac 137 sequence CAN30G3 H,CDR1 Murine GFSLTDYG 138 sequence CAN30G3 H,CDR2 Murine IWGGGSA 139 sequence CAN30G3 H,CDR3 Murine AKHRTLITTAMDY 140 sequence CAN30G3 H,FR1 Murine caggtgcagctgaaggagtcaggacctggcctggtggcgccct 141 sequence cacagagcctgtccatcacatgcactgtctca CAN30G3 H,FR2 Murine ataacctggattcgccagcctccaggaaagggtctggagtggct 142 sequence gggagta CAN30G3 H,FR3 Murine tactataatttagttctcaaatccagactgagcatcagcaaggac 143 sequence aactccaagagtcaagttttcttaaaaatgaacagtctgcaaact gatgacacagccatgtactactgt CAN30G3 H,FR4 Murine tggggtcaaggaatttcagtcaccgtctcctcag 144 sequence CAN30G4 K, Murine gatgttttgatgacccaaactccactctccctgcctgtcagtcttgg 145 Variable sequence agatcaagcctccatctcttgcagatctagtcagaacattgtacat region agtgatggaaacacctatttagaatggtacctgcagaaaccag gccagtctccaaagctcctgatctacaaattttccaaccgattttct ggggtcccagacaggttcagtggcagtggatcagggacagatt tcacactcaagatcagcagagtggaggctgaggatctgggagt ttattactgctttcaaggttcacatgttcctcccacgttcggtgctgg gaccaagctggagctgaaac CAN30G4 K, Murine DVLMTQTPLSLPVSLGDQASISCRSSQNIVHS 146 variable sequence DGNTYLEWYLQKPGQSPKLLIYKFSNRFSGVP region DRFSGSGSGTDFTLKISRVEAEDLGVYYCFQ GSHVPPTFGAGTKLELK CAN30G4 K,CDR1 Murine cagaacattgtacatagtgatggaaacacctat 147 sequence CAN30G4 K,CDR2 Murine aaattttcc 148 sequence CAN30G4 K,CDR3 Murine tttcaaggttcacatgttcctcccacg 149 sequence CAN30G4 K,CDR1 Murine QNIVHSDGNTY 150 sequence CAN30G4 K,CDR2 Murine KFS 151 sequence CAN30G4 K,CDR3 Murine FQGSHVPPT 152 sequence CAN30G4 K,FR1 Murine gatgttttgatgacccaaactccactctccctgcctgtcagtcttgg 153 sequence agatcaagcctccatctcttgcagatctagt CAN30G4 K,FR2 Murine ttagaatggtacctgcagaaaccaggccagtctccaaagctcct 154 sequence gatctac CAN30G4 K,FR3 Murine aaccgattttctggggtcccagacaggttcagtggcagtggatca 155 sequence gggacagatttcacactcaagatcagcagagtggaggctgag gatctgggagtttattactgc CAN30G4 K,FR4 Murine ttcggtgctgggaccaagctggagctgaaac 156 sequence CAN30G4 H, Murine gaagtgaagctggtggagtctgggggaggcttagtgaagtctg 157 Variable sequence gagggtccctgaaactctcctgtgcagtctctggattcactttcagt region acctatgccatgtcttgggttcgccagattccggagaagaggctg gagtgggtcgcaaccattagtaatggtggtagttatatctactattc agacagtgtgaagggtcgattcaccatctccagagacaatgcc aagaacaccctgtacctgcaaatgagcagtctgaggtctgagg acacggccatgtattactgtgcacgacatagggagtcctataggt acgactggtttgcttactggggccaagggactctggtcactgtctc tgcag CAN30G4 H, Murine EVKLVESGGGLVKSGGSLKLSCAVSGFTFSTY 158 variable sequence AMSWVRQIPEKRLEWVATISNGGSYIYYSDSV region KGRFTISRDNAKNTLYLQMSSLRSEDTAMYYC ARHRESYRYDWFAYWGQGTLVTVSA CAN30G4 H,CDR1 Murine ggattcactttcagtacctatgcc 159 sequence CAN30G4 H,CDR2 Murine attagtaatggtggtagttatatc 160 sequence CAN30G4 H,CDR3 Murine gcacgacatagggagtcctataggtacgactggtttgcttac 161 sequence CAN30G4 HCDR1 Murine GFTFSTYA 162 sequence CAN30G4 HCDR2 Murine ISNGGSYI 163 sequence CAN30G4 H,CDR3 Murine ARHRESYRYDWFAY 164 sequence CAN30G4 H,FR1 Murine gaagtgaagctggtggagtctgggggaggcttagtgaagtctg 165 sequence gagggtccctgaaactctcctgtgcagtctct CAN30G4 H,FR2 Murine atgtcttgggttcgccagattccggagaagaggctggagtgggt 166 sequence cgcaacc CAN30G4 H,FR3 Murine tactattcagacagtgtgaagggtcgattcaccatctccagagac 167 sequence aatgccaagaacaccctgtacctgcaaatgagcagtctgaggt ctgaggacacggccatgtattactgt CAN30G4 H,FR4 Murine tggggccaagggactctggtcactgtctctgcag 168 sequence Ravn GPemu Synthetic MKTIYFLISLILIQSIKTLPVLEIASNSQPQDVDS 169 GPemuc cTM Marburg VCSGTLQKTEDVHLMGFTLSGQKVADSPLEA virus SKRWAFRTGVPPKNVEYTEGEEAKTCYNISV TDPSGKSLLLDPPSNIRDYPKCKTVHHIQGQN PHAQGIALHLWGAFFLYDRVASTTMYRGKVF TEGNIAAMIVNKTVHRMIFSRQGQGYRHMNLT STNKYWTSSNETQRNDTGCFGILQEYNSTNN QTCPPSLKPPSLPTVTPSIHSTNTQINTAKSGT MRPPIYFRKKRSIFWKEGDIFPFLDGLINTEIDF DPIPNTETIFDESPSFNTSTNEEQHTPPNISLTF SYFPDKNGDTAYSGENENDCDAELRIWSVQE DDLAAGLSWIPFFGPGIEGLYTAGLIKNQNNLV CRLRRLANQTAKSLELLLRVTTEERTFSLINRH AIDFLLTRWGGTCKVLGPDCCIGIEDLSKNISE QIDKIRKDEQKEET Angola GPemu Synthetic MKTTCLLISLILIQGVKTLPILEIASNIQPQNVDS 170 GPemuc cTM Marburg VCSGTLQKTEDVHLMGFTLSGQKVADSPLEA virus SKRWAFRAGVPPKNVEYTEGEEAKTCYNISV TDPSGKSLLLDPPTNIRDYPKCKTIHHIQGQNP HAQGIALHLWGAFFLYDRIASTTMYRGKVFTE GNIAAMIVNKTVHKMIFSRQGQGYRHMNLTST NKYWTSSNGTQTNDTGCFGTLQEYNSTKNQ TCAPSKKPLPLPTAHPEVKLTSTSTDATKLNTT QHLVYFRRKRNILWREGDMFPFLDGLINAPID FDPVPNTKTIFDESSSSGASAEEDQHASPNIS LTLSYFPKVNENTAHSGENENDCDAELRIWSV QEDDLAAGLSWIPFFGPGIEGLYTAGLIKNQN NLVCRLRRLANQTAKSLELLLRVTTEERTFSLI NRHAIDFLLARWGGTCKVLGPDCCIGIEDLSR NISEQIDQIKKDEQKEGT Musoke GPemu Synthetic MKTTCFLISLILIQGTKNLPILEIASNNQPQNVD 171 GPemuc cTM Marburg SCSGTLQKTEDVHLMGFTLSGQKVADSPLE virus ASKRWAFRTGVPPKNVEYTEGEEAKTCYNIS VTDPSGKSLLLDPPTNIRDYPKCKTIHHIQGQN PHAQGIALHLWGAFFLYDRIASTTMYRGKVFT EGNIAAMIVNKTVHKMIFSRQGQGYRHMNLTS INKYWTSSNGTQINDTGCFGALQEYNSTKN QTCAPSKIPPPLPTARPEIKLTSTPTDATKLNT TQHLVYFRRKRSILWREGDMFPFLDGLINAPI DFDPVPNTKTIFDESSSSGASAEEDQHASPNI SLTLSYFPNINENTAYSGENENDCDAELRIWS VQEDDLAAGLSWIPFFGPGIEGLYTAVLIKNQN NLVCRLRRLANQTAKSLELLLRVTTEERTFSLI NRHAIDFLLTRWGGTCKVLGPDCCIGIEDLSK NISEQIDQIKKDEQKEGT Ci67 GPemu Synthetic MKTTCLFISLILIQGIKTLPILEIASNNQPQNVDS 172 GPemuc cTM Marburg VCSGTLQKTEDVHLMGFTLSGQKVADSPLEA virus SKRWAFRTGVPPKNVEYTEGEEAKTCYNISV TDPSGKSLLLDPPTNIRDYPKCKTIHHIQGQNP HAQGIALHLWGAFFLYDRIASTTMYRGRVFTE GNIAAMIVNKTVHKMIFSRQGQGYRHMNLTST NKYWTSNNGTQTNDTGCFGALQEYNSTKNQ TCAPSKIPSPLPTARPEIKPTSTPTDATTLNTT QHLVYFRKKRSILWREGDMFPFLDGLINAPIDF DPVPNTKTIFDESSSSGASAEEDQHASPNISL TLSYFPNINENTAYSGENENDCDAELRIWSVQ EDDLAAGLSWIPFFGPGIEGLYTAGLIKNQNNL VCRLRRLANQTAKSLELLLRVTTEERTFSLINR HAIDFLLTRWGGTCKVLGPDCCIGIEDLSRNIS EQIDQIKKDEQKEGT Ravn GP Marburg MKTIYFLISLILIQSIKTLPVLEIASNSQPQDVDS 173 (GenBank virus, VCSGTLQKTEDVHLMGFTLSGQKVADSPLEA Accession Kenya SKRWAFRTGVPPKNVEYTEGEEAKTCYNISV No. 1987 TDPSGKSLLLDPPSNIRDYPKCKTVHHIQGQN ACD13005.1) PHAQGIALHLWGAFFLYDRVASTTMYRGKVF TEGNIAAMIVNKTVHRMIFSRQGQGYRHMNLT STNKYWTSSNETQRNDTGCFGILQEYNSTNN QTCPPSLKPPSLPTVTPSIHSTNTQINTAKSGT MNPSSDDEDLMISGSGSGEQGPHTTLNVVTE QKQSSTILSTPSLHPSTSQHEQNSTNPSRHAV TEHNGTDPTTQPATLLNNTNTTPTYNTLKYN LSTPSPPTRNITNNDTQRELAESEQTNAQLNT TLDPTENPTTAQDTNSTTNIIMTTSDITSKHPT NSSPDSSPTTRPPIYFRKKRSIFWKEGDIFPFL DGLINTEIDFDPIPNTETIFDESPSFNTSTNEEQ HTPPNISLTFSYFPDKNGDTAYSGENENDCDA ELRIWSVQEDDLAAGLSWIPFFGPGIEGLYTA GLIKNQNNLVCRLRRLANQTAKSLELLLRVTTE ERTFSLINRHAIDFLLTRWGGTCKVLGPDCCIG IEDLSKNISEQIDKIRKDEQKEETGWGLGGKW WTSDWGVLTNLGILLLLSIAVLIALSCICRIFTKY IG Angola GP Marburg MKTTCLLISLILIQGVKTLPILEIASNIQPQNVDS 174 (GenBank virus, VCSGTLQKTEDVHLMGFTLSGQKVADSPLEA Accessoion Angola, SKRWAFRAGVPPKNVEYTEGEEAKTCYNISV No. Lake TDPSGKSLLLDPPTNIRDYPKCKTIHHIQGQNP ABE27064.1) Victoria, HAQGIALHLWGAFFLYDRIASTTMYRGKVFTE 2005 GNIAAMIVNKTVHKMIFSRQGQGYRHMNLTST NKYWTSSNGTQTNDTGCFGTLQEYNSTKNQ TCAPSKKPLPLPTAHPEVKLTSTSTDATKLNTT DPNSDDEDLTTSGSGSGEQEPYTTSDAATKQ GLSSTMPPTPSPQPSTPQQGGNNTNHSQGV VTEPGKTNTTAQPSMPPHNTTTISTNNTSKHN LSTPSVPIQNATNYNTQSTAPENEQTSAPSKT ILLPTENPTTAKSTNSTKSPITTVPNTINKYST SPSPTPNSTAQHLVYFRRKRNILWREGDMFP FLDGLINAPIDFDPVPNTKTIFDESSSSGASAE EDQHASPNISLTLSYFPKVNENTAHSGENEND CDAELRIWSVQEDDLAAGLSWIPFFGPGIEGL YTAGLIKNQNNLVCRLRRLANQTAKSLELLLR VTTEERTFSLINRHAIDFLLARWGGTCKVLGP DCCIGIEDLSRNISEQIDQIKKDEQKEGTGWGL GGKWWTSDWGVLTNLGILLLLSIAVLIALSCIC RIFTKYIG Musoke GP Marburg MKTTCFLISLILIQGTKNLPILEIASNNQPQNVD 175 (GenBank virus. SVCSGTLQKTEDVHLMGFTLSGQKVADSPLE Accession Kenya ASKRWAFRTGVPPKNVEYTEGEEAKTCYNIS No. 1980 VTDPSGKSLLLDPPTNIRDYPKCKTIHHIQGQN CAA78117.1) PHAQGIALHLWGAFFLYDRIASTTMYRGKVFT EGNIAAMIVNKTVHKMIFSRQGQGYRHMNLTS INKYWTSSNGTQINDTGCFGALQEYNSTKN QTCAPSKIPPPLPTARPEIKLTSTPTDATKLNT TDPSSDDEDLATSGSGSGEREPHTTSDAVTK QGLSSTMPPTPSPQPSTPQQGGNNTNHSQD AVTELDKNNTTAQPSMPPHNTTTISTNNTSKH NFSTLSAPLQNTTNDNTQSTITENEQTSAPSIT TLPFIGNPTTAKSTSSKKGPATTAPNTTNEHF TSPPPTPSSTAQHLVYFRRKRSILWREGDMF PFLDGLINAPIDFDPVPNTKTIFDESSSSGASA EEDQHASPNISLTLSYFPNINENTAYSGENEN DCDAELRIWSVQEDDLAAGLSWIPFFGPGIEG LYTAVLIKNQNNLVCRLRRLANQTAKSLELLLR VTTEERTFSLINRHAIDFLLTRWGGTCKVLGP DCCIGIEDLSKNISEQIDQIKKDEQKEGTGWGL GGKWWTSDWGVLTNLGILLLLSIAVLIALSCIC RIFTKYIG Ci67 GP Marburg MKTTCLFISLILIQGIKTLPILEIASNNQPQNVDS 176 (GenBank virus, VCSGTLQKTEDVHLMGFTLSGQKVADSPLEA Accession Lake SKRWAFRTGVPPKNVEYTEGEEAKTCYNISV No. Victoria TDPSGKSLLLDPPTNIRDYPKCKTIHHIQGQNP ABS17558.1) HAQGIALHLWGAFFLYDRIASTTMYRGRVFTE GNIAAMIVNKTVHKMIFSRQGQGYRHMNLTST NKYWTSNNGTQTNDTGCFGALQEYNSTKNQ TCAPSKIPSPLPTARPEIKPTSTPTDATTLNTT DPNNDDEDLITSGSGSGEQEPYTTSDAVTKQ GLSSTMPPTPSPQPSTPQQEGNNTDHSQGT VTEPNKTNTTAQPSMPPHNTTAISTNNTSKNN FSTLSVSLQNTTNYDTQSTATENEQTSAPSKT TLPPTGNLTTAKSTNNTKGPTTTAPNMTNGHL TSPSPTPNPTTQHLVYFRKKRSILWREGDMFP FLDGLINAPIDFDPVPNTKTIFDESSSSGASAE EDQHASPNISLTLSYFPNINENTAYSGENEND CDAELRIWSVQEDDLAAGLSWIPFFGPGIEGL YTAGLIKNQNNLVCRLRRLANQTAKSLELLLR VTTEERTFSLINRHAIDFLLTRWGGTCKVLGP DCCIGIEDLSRNISEQIDQIKKDEQKEGTGWGL GGKWWTSDWGVLTNLGILLLLSIAVLIALSCIC RIFTKYIG ZaireEbola GP Ebola MGVTGILQLPRDRFKRTSFFLWVIILFQRTFSIP 177 virus virus, LGVIHNSTLQVSDVDKLVCRDKLSSTNQLRSV Mayinga 1976 GLNLEGNGVATDVPSATKRWGFRSGVPPKVV strain NYEAGEWAENCYNLEIKKPDGSECLPAAPDGI (GenBank RGFPRCRYVHKVSGTGPCAGDFAFHKEGAFF Accession LYDRLASTVIYRGTTFAEGVVAFLILPQAKKDF No. FSSHPLREPVNATEDPSSGYYSTTIRYQATGF U23187.1) GTNETEYLFEVDNLTYVQLESRFTPQFLLQLN ETIYTSGKRSNTTGKLIWKVNPEIDTTIGEWAF WETKKNLTRKIRSEELSFTVVSNGAKNISGQS PARTSSDPGTNTTTEDHKIMASENSSAMVQV HSQGREAAVSHLTTLATISTSPQSLTTKPGPD NSTHNTPVYKLDISEATQVEQHHRRTDNDSTA SDTPSATTAAGPPKAENTNTSKSTDFLDPATT TSPQNHSETAGNNNTHHQDTGEESASSGKL GLITNTIAGVAGLITGGRRTRREAIVNAQPKCN PNLHYWTTQDEGAAIGLAWIPYFGPAAEGIYIE GLMHNQDGLICGLRQLANETTQALQLFLRATT ELRTFSILNRKAIDFLLQRWGGTCHILGPDCCI EPHWTKNITDKIDQIIHDFVDKTLPDQGDND NWWTGWRQWIPAGIGVTGVIIAVIALFCICKFV F EbolaZaire GP Ebola MGVTGILQLPRDRFKRTSFFLWVIILFQRTFSIP 178 1995, virus, LGVIHNSTLQVSDVDKLVCRDKLSSTNQLRSV P87666 1995 GLNLEGNGVATDVPSATKRWGFRSGVPPKVV NYEAGEWAENCYNLEIKKPDGSECLPAAPDGI RGFPRCRYVHKVSGTGPCAGDFAFHKEGAFF LYDRLASTVIYRGTTFAEGVVAFLILPQAKKDF FSSHPLREPVNATEDPSSGYYSTTIRYQATGF GTNETEYLFEVDNLTYVQLESRFTPQFLLQLN ETIYTSGKRSNTTGKLIWKVNPEIDTTIGEWAF WETKKNLTRKIRSEELSFTAVSNRAKNISGQS PARTSSDPGTNTTTEDHKIMASENSSAMVQV HSQGREAAVSHLTTLATISTSPQPPTTKPGPD NSTHNTPVYKLDISEATQVEQHHRRTDNDSTA SDTPPATTAAGPLKAENTNTSKGTDLLDPATT TSPQNHSETAGNNNTHHQDTGEESASSGKL GLITNTIAGVAGLITGGRRARREAIVNAQPKCN PNLHYWTTQDEGAAIGLAWIPYFGPAAEGIYT EGLMHNQDGLICGLRQLANETTQALQLFLRAT TELRTFSILNRKAIDFLLQRWGGTCHILGPDCC IEPHDWTKNITDKIDQIIHDFVDKTLPDQGDND NWWTGWRQWIPAGIGVTGVIIAVIALFCICKFV F Ebola GP Sudan MEGLSLLQLPRDKFRKSSFFVWVIILFQKAFS 179 SudanMaleo ebolavirus, MPLGVVTNSTLEVTEIDQLVCKDHLASTDQLK 1979 1979 SVGLNLEGSGVSTDIPSATKRWGFRSGVPPQ VVSYEAGEWAENCYNLEIKKPDGSECLPPPP DGVRGFPRCRYVHKAQGTGPCPGDYAFHKD GAFFLYDRLASTVIYRGVNFAEGVIAFLILAKPK ETFLQSPPIREAANYTENTSSYYATSYLEYEIE NFGAQHSTTLFKINNNTFVLLDRPHTPQFLFQ LNDTIQLHQQLSNTTGKLIVVTLDANINADIGEW AFWENKKNLSEQLRGEELSFETLSLNETEDD DATSSRTTKGRISDRATRKYSDLVPKDSPGM VSLHVPEGETTLPSQNSTEGRRVDVNTQETIT ETTATIIGINGNNMQ1STIGTGLSSSQILSSSPT MAPSPETQTSTTYTPKLPVMTTEEPTTPPRNS PGSTTEAPTLTTPENITTAVKTVWAQESTSNG LITSTVTGILGSLGLRKRSRRQVNTRATGKCN PNLHYWTAQEQHNAAGIAWIPYFGPGAEGIYT EGLMHNQNALVCGLRQLANETTQALQLFLRA TTELRTYTILNRKAIDFLLRRWGGTCRILGPDC CIEPHDWWTKNITDKINQIIHDFIDNPLPNQDNDD NWWTGWRQWIPAGIGITGIIIAIIALLCVCKLLC Makona Virion Zaire MGVTGILQLPRDRFKRTSFFLWVIILFQRTFSIP 180 Ebolavirus spikeGP ebolavirus LGVIHNSTLQVSDVDKLVCRDKLSSTNQLRSV (GenBank precursor GLNLEGNGVATDVPSVTKRWGFRSGVPPKVV Accession NYEAGEWAENCYNLEIKKPDGSECLPAAPDGI No. RGFPRCRYVHKVSGTGPCAGDFAFHKEGAFF AJF38895.1 LYDRLASTVIYRGTTFAEGVVAFLILPQAKKDF FSSHPLREPVNATEDPSSGYYSTTIRYQATGF GTNETEYLFEVDNLTYVQLESRFTPQFLLQLN ETIYASGKRSNTTGKLIWKVNPEIDTTIGEWAF WETKKNLTRKIRSEELSFTAVSNGPKNISGQS PARTSSDPETNTTNEDHKIMASENSSAMVQV HSQGRKAAVSHLTTLATISTSPQPPTTKTGPD NSTHNTPVYKLDISEATQVGQHHRRADNDST ASDTPPATTAAGPLKAENTNTSKSADSLDLAT TTSPQNYSETAGNNNTHHQDTGEESASSGKL GLITNTIAGVAGLITGGRRTRREVIVNAQPKCN PNLHYWTTQDEGAAIGLAWIPYFGPAAEGIYT EGLMHNQDGLICGLRQLANETTQALQLFLRAT TELRTFSILNRKAIDFLLQRWGGTCHILGPDCC IEPHDVVTKNITDKIDQIIHDFVDKTLPDQGDND NWWTGWRQWIPAGIGVTGVIIAVIALFCICKFV F ZaireEbola Surface Zaire MGVTGILQLPRDRFKRTSFFLWVIILFQRTFSIP 181 virus GP ebolavirus, LGVIHNSTLQVSDVDKLVCRDKLSSTNQLRPV (GenBank precurso 1976 GLNLEGNGVATDVPSATKRWGFRSGVPPKVV Accession NYEAGEWAENCYNLEIKKPDGSECLPAAPDGI No. RGFPRCRYVHKVSGTGPCAGDFAFHKEGAFF AAM76034) LYDRLASTVIYRGTTFAEGVVAFLILPQAKKDF FSSHPLREPVNATEDPSSGYYSTTIRYQATGF GTNETEYLFEVDNLTYVQLEPRFTPQFLLQLN ETIYTSGKRSNTTGKLIWKVNPEIDTTIGEWAF WETKKNLTRKIRSEELSFTVVSNTHHQDTGEE SASSGKLGLITNTIAGVAGLITGGRRTRREAIV NAQPKCNPNLHYVVTTQDEGAAIGLAWIPYFG PAAEGIYTEGLMHNQDGLICGLRQLANETTQA LQLFLRATTELRTFSILNRKAIDFLLQRWGGTC HILGPDCCIEPHDVVTKNITDKIDQIIHDFVDKTL PD Makona Virion Zaire MGVTGILQLPRDRFKRTSFFLWVIILFQRTFSIP 182 Ebolavirus spikeGP ebolavirus LGVIHNSTLQVSEVDKLVCRDKLSSTNQLRSV (GenBank precursor GLNLEGNGVATDVPSATKRWGFRSGVPPKVV Accession NYEAGEWAENCYNLEIKKPDGSECLPAAPDGI No. RGFPRCRYVHKVSGTGPCAGDFAFHKEGAFF AAQ55048.1) LYDRLASTVIYRGTTFAEGVVAFLILPQAKKDF FSSHPLREPVNATEDPSSGYYSTTIRYQATGF GTNETEYLFEVDNLTYVQLESRFTPQFLLQLN ETIYTSGKRSNTTGKLIWKVNPEIDTTIGEWAF WETKKNLTRKIRSEELSFTAVSNTHHQDTGEE SASSGKLGLITNTIAGVAGLITGGRRARREAIV NAQPKCNPNLHYVVTTQDEGAAIGLAWIPYFG PAAEGIYTEGLMHNQDGLICGLRQLANETTQA LQLFLRATTELRTFSILNRKAIDFLLQRWGGTC HILGPDCCIEPHDVVTKNITDKIDQIIHDFVDKTL PD Sudan GP Sudan MGGLSLLQLPRDKFRKSSFFVWVIILFQKAFS 183 ebolavirus ebolavirus MPLGVVTNSTLEVTEIDQLVCKDHLASTDQLK (GenBank SVGLNLEGSGVSTDIPSATKRWGFRSGVPPK Accession VVSYEAGEWAENCYNLEIKKPDGSECLPPPP No. DGVRGFPRCRYVHKAQGTGPCPGDYAFHKD AGL73446) GAFFLYDRLASTVIYRGVNFAEGVIAFLILAKPK ETFLQSPPIREAVNYTENTSSYYATSYLEYEIE NFGAQHSTTLFKIDNNTFVRLDRPHTPQFLFQ LNDTIHLHQQLSNTTGRLIVVTLDANINADIGEW AFWENKKNLSEQLRGEELSFEALSNITTAVKT VLPQESTSNGLITSTVTGILGSLGLRKRSRRQT NTKATGKCNPNLHYVVTAQEQHNAAGIAWIPY FGPGAEGIYTEGLMHNQNALVCGLRQLANET TQALQLFLRATTELRTYTILNRKAIDFLLRRWG GTCRILGPDCCIEPHDVVTKNITDKINQIIHDFID NPLPN In Table 1, the CDRs are IMGT numbering. H: heavy chain; K: kappa chain.
Example 3
Derivation and Screening of Monoclonal Antibodies Binding to Marburg Virus
[0113] Monoclonal antibodies (mAbs) to Marburg virus (MARV) were generated by immunizing mice to produce an antibody directed to an epitope in the glycoprotein (GP) of MARV. Immunization of mice was performed according to standard operating procedures.
[0114] Six week-old female BALB/c mice (University of Manitoba, using Animal Use Protocols approved by the Protocol Management and Review Committee) were injected subcutaneously (SC) with 20 g of inert MARV Ravn GPemuc (SEQ ID NO:169) or MARV Angola GPemuc (SEQ ID NO:170) in Freund's Complete Adjuvant (CFA) (Brenntag Biosector) on day 1. On day 32 the mice received 20 g of the same MARV GP injected intraperitoneally (I.P.) in Incomplete Freund's Adjuvant (IFA) (Brenntag Biosector) in a total volume of 100 l. On day 56, the mice received 20 g of the same antigen in a total volume of 100 l I.P. with IFA. Serum analysis from test bleeds at this point showed specific serum IgG titers to MARV GP (data not shown). Mice received 1-2 boosters of recombinant MARV GP protein (10 g in IFA I.P.) prior to a final push of 5 g purified GP (in PBS by IP) before conducting fusions. Standard protocols were used to produce hybridoma cell lines, and monoclonal antibodies were purified on Protein G resin. Mouse sera were screened on Ravn GPemuc, and spleen fusion and hybridoma screening was performed on those mice with specific and strong interaction with Ravn GP. Spleens were harvested three days after the final push and mice were euthanized by anesthesia overdose and exsanguinated by cardiac puncture. The spleens were subsequently excised under aseptic conditions and cell fusions performed essentially according to standard techniques. Positive selected IgG-secreting clones were subjected to large-scale production and subsequent characterization by immunological methods. Isotyping was performed using a commercial murine isotyping dipstick test (Roche) according to the manufacturer's instructions. Hybridoma culture supernatants were concentrated 5-10 fold using Amicon stirred cell nitrogen concentrators with 30 kDa cutoff Millipore (YM-30) membranes (both from Millipore, Billerica, Mass.). Mice immunized with Angola GPemuc purified from S2 cells yielded antibody 40G1. Mice immunized with Ravn GPemuc purified from Gnt/ HEK293 cells raised antibodies 30G1, 30G3, 30G4 and 30G5. Mice immunized with Ravn GPemuc, and then boosted with a complex of Ravn GPemuc bound to 30G4 Fab (CAN30G4 Fab-Ravn GPemuc), raised antibodies 54G1, 54G2 and 54G3 as presented in Table 2.
TABLE-US-00002 TABLE 2 Summary of the MARV and EBOV GP constructs Construct Description* Deleted Regions* MARV GP Full length GP (1-681) MARV GPe Deleted transmembrane 638-681 (TM) (TM) domain MARV GPemuc Deleted TM & mucin-like 257-425 (TM) domain (muc) 638-681 (muc) MARV GPemucw Deleted TM, muc & GP2 257-425 (TM) wing (w) 638-681 (muc) 436-483 (w) MARV GPcl Cleaved GP with deleted 257-425 (TM) TM & muc 638-681 (muc) EBOV GP Full length (1-676) EBOV GPe Deleted TM domain 638-676 EBOV GPemuc-EBOV, Deleted TM & mucin-like 314-463 SUDV, BDBV domain (muc) EBOV GPemuc- Deleted TM & mucin-like 316-470 RESTV domain (muc) * Numbering of the amino acids begins at the first amino acid of the MARV or EBOV GP signal sequence, as indicated on FIG. 1.
[0115] Antibodies were screened via ELISA method against either Ravn GP or Angola GP. Briefly, 96-well MaxiSorp plates (NUNC) were coated with 200 ng/well of antigen, covered and incubated overnight at 4 C. Plates were washed 5 in Milli-Q water to remove any unbound antigen and then blocked with Blocking Buffer (5% Skim Milk Powder (SMP) in Phosphate Buffered Saline (PBS)). Plates were incubated for 1 hour at 37 C. and then washed 5 in Milli-Q water. Plates were then coated with hybridoma supernatant and serially diluted 2-fold in Dilution Buffer (2.5% SMP in PBS) starting at 1 g/mL. After a 1 hour incubation period at 37 C., plates were then washed 5 in Milli-Q water. Goat anti-Mouse IgG-HRP was then added to the plate at a 1:2000 dilution in Dilution Buffer and incubated again for 1 hour at 37 C. Plates were then washed and substrate added to the plates. Plates were read using 405 nm wavelength after 15 minutes, 30 minutes or 1 hour (incubation at room temperature).
[0116] A list of immunogens and boosting immunogens used for selected anti-Marburg GP mAbs is provided in Table 3.
TABLE-US-00003 TABLE 3 List of selected anti-Marburg GP antibodies generated mAb ID Immunogen Boosting Immunogen Isotype CAN30G1 Ravn GPemuc Ravn GPemuc IgG1/kappa CAN30G2 Ravn GPemuc Ravn GPemuc IgG1/kappa CAN30G3 Ravn GPemuc Ravn GPemuc IgG1/kappa CAN30G4 Ravn GPemuc Ravn GPemuc IgG1/kappa CAN30G5 Ravn GPemuc Ravn GPemuc IgG1/kappa CAN54G1 Ravn GPemuc Ravn GPemuc-CAN30G4 IgG1/kappa Fab complex CAN54G2 Ravn GPemuc Ravn GPemuc-CAN30G4 IgG1/kappa Fab complex CAN54G3 Ravn GPemuc Ravn GPemuc-CAN30G4 IgG1/kappa Fab complex CAN40G1 Angola GPemuc Angola GPemuc IgG1/kappa
Example 4
ELISA Testing of Mouse Anti-Marburg GP Monoclonal Antibodies
[0117] An ELISA was performed to test the binding of the mAbs against multiple strains of Marburg GP, GPe, GPemuc, and to determine if the mAbs are cross-reactive to various strains of Ebola virus (EBOV) GP, GPe and Gpemuc. The ELISA plate was coated with 200 ng/well of antigen. The wells were blocked with 5% skim milk then probed with serially diluted generated mAbs starting (0.1 g/mL to 1 g/mL). Binding was detected with commercial goat anti-Mouse IgG-HRP. The plate was read at 405 nm after a minimum of 15 minutes incubation with substrate.
[0118] The CAN30, CAN54 and CAN40 series mAbs were all tested for binding to different strains of MARV (Musoke, Ci67, Angola, and Ravn) and EBOV engineered GPs (GPe, GPemuc and GPcl).
[0119]
[0120] CAN40G1 (anti-MARV Angola mAb) was tested for cross-reactivity to various MARV strains and ebolaviruses. To determine cross-reactivity, ELISAs were performed using the GPemuc of the Ravn, Angola, Popp, and Musoke strains of MARV, the GPemuc of the ebolaviruses EBOV, SUDV, and BDBV, or the cleaved MARV and EBOV GPs (GPcl) as coating antigens. CAN40G1 was further evaluated for binding to the complete, mucin-containing ectodomain of MARV Angola, EBOV, SUDV, and BDBV and to the secreted sGP of EBOV and RESTV. As shown in
[0121] For animals boosted with CAN30G4 Fab-RavnGPemuc and the CAN54 mAbs that were generated from hybridoma fusions, cross reactivity was directed towards GP1 and GP2 eptitopes that were unique in comparison to CAN40G1 immunized with the Angola strain GPmuc. The CAN54 mAbs were also directed away from the immunodominant GP2 wing elicited by immunizations with RavnGPemuc (e.g. CAN30 fusions), however, one mAb clone did result in immunorecognition towards the GP2 wing elicted by several CAN30 mAbs, but specificity against the GPs across the Marburg strains was unique in relation to GPe and GPemuc.
Example 5
Western Blots Performed with Mouse Anti-Marburg GP Monoclonal Antibodies
[0122] A 4-12% gradient SDS-PAGE is run for 1.5 hours at 200 volts with a combination of MARV and EBOV proteins. The gel is then transferred to a nitrocellulose membrane for a minimum of 1 hour at 45 volts. The membrane is blocked overnight at 4 C. with 5% skim milk in 1TBST. The next day the mAbs (1 Ab) are diluted in 2.5% skim milk in 1TBST at concentrations ranging from 2 g/mL to 5 g/mL depending on the antibody and used to probe the membrane containing the transferred proteins for 2 hours at room temperature (RT). The membranes are then washed with 1TBST to remove unbound 1 Ab and probed with anti-mouse IgG-HRP (2 Ab) at a dilution of 1:4000 to 1:5000 for 1.5 hours at RT.
Example 6
Pseudovirus Neutralization Assay Performed with Mouse Anti-Marburg GP Monoclonal Antibodies
[0123] Antibodies were tested for neutralization of recombinant Vesicular Stomatitis Virus (VSV) pseudotyped with MARV GP. VSV pseudovirions containing a GFP gene in place of the VSV G gene (VSVG) and bearing the glycoprotein of MARV Ravn were generated as previously described (Takeda et al. Proc Natl Acad Sci USA, 1997. 94(26): 14764-14769). Experiments were performed in triplicate with VSVG bearing either full-length MARV Ravn GP (VSVG-GP) or mucin-deleted 257-425 GP (VSVG-GPmuc). Pseudovirions were incubated with anti-VSV G mAb for 1 hour at RT, then incubated with 2.5, 10 or 50 g/mL of each anti-MARV GP mAb in DMEM-10% FBS for an additional hour. Pseudovirion/mAb complexes were added to Vero cells at a multiplicity of infection (MOI) of 0.01. After 48 hours, infection was evaluated by counting GFP-expressing cells.
[0124] As shown in
[0125] The best neutralizing mAbs in this panel neutralized mucin-containing Marburg virus GP-pseudotypes approximately 50%, while polyclonal sera neutralized the same viruses to approximately 40% infectivity (
Example 7
Epitope Mapping with Pin Peptides
[0126] Pin peptides were designed to cover the GP1 and GP2 subunits of Marburg Musoke GP (NCBI Accession number NC_001608) and Marburg Ravn GP (NCBI Accession number AB_04Y1906) by designing 15mers overlapping by 10 amino acids and removing the mucin domain and transmembrane domain along with the signal peptide sequence and cytoplasmic tail (Feldmann et al., 2001, J Gen Virol. 82(Pt 12):2839-2848; Will et al., 1993, J Virol. 67(3):1203-1210). MARV-Angola and MARV-Musoke are approximately 93% identical in GP protein sequence, and MARV and RAVV are approximately 78% identical in GP protein sequence. Because of the similarity between Angola and Musoke, Musoke and Ravn pins were designed. Internal cysteines were replaced by methionine to prevent dimerization of peptide with conserved substitution.
[0127] For the assay, pins were activated by rinsing in methanol for a few seconds and allowed to air-dry. Pins were then blocked with 200 L of Blocking Buffer (1% SMP+1% Tween-20 in PBS) in 96-well round bottom plates and incubated for 2 hours at RT. Pins were then washed with Wash Solution (0.9% w/v NaCl+0.05% Tween-20 in PBS) 3 for 1 min/wash. Pins were then immediately coated with 100 L of a 1/5 dilution of supernatant in Dilution Buffer (0.1% SMP+0.1% Tween-20 in PBS) in new 96-well round bottom plates and left covered overnight at 4 C. The next day, pins were washed 3 in wash solution and then incubated at room temperature for 1 hour in a 1:5000 dilution of Goat anti-mouse IgG-HRP in dilution buffer with 100 L/well. After incubation, pins were washed 3 in wash solution. ABTS substrate was then applied at 200 L/well to 96-well flat-bottom MaxiSorp plates and readings taken at 15 minutes, 30 minutes and 1 hour.
[0128] Table 4 shows the results of epitope mapping.
TABLE-US-00004 TABLE4 PinpeptidemappingofmAbstoMarburgRavnGPandMarburgAngolaGP Marburg GP Absorbance mAbID pins subunit Pins (1hour) PeptideSequence CAN30G1 Ravn N/A N/A N/A unreactivetopins (tested2),likely recognizes conformationalepitope CAN30G2 Ravn GP2 D4 0.848 LINTEIDFDPIPNTE D5 0.373 (SEQIDNO:184) IDFDPIPNTETIFDE (SEQIDNO:185) CAN30G3 Ravn GP2 D5 1.840 IDFDPIPNTETIFDE D6 1.116 (SEQIDNO:186) IPNTETIFDESPSFN (SEQIDNO:187) CAN30G4 Ravn GP2 D3 0.836 PNLDGLINTEIDFDP D4 Overflow* (SEQIDNO:188) D5 1.966 LINTEIDFDPIPNTE (SEQIDNO:189) IDFDPIPNTETIFDE (SEQIDNO:190) CAN30G5 Ravn GP2 D4 0.631 LINTEIDFDPIPNTE D5 Overflow (SEQIDNO:191) D6 Overflow IDFDPIPNTETIFDE (SEQIDNO:192) IPNTETIFDESPSEN (SEQIDNO:193) CAN30G6 Ravn GP1/GP2 Multiple N/A Likelybinds conformationalepitope, orrepeatsequence CAN54G1 Ravn GP1/GP2 N/A Multiple Likelybinds conformationalepitope, orrepeatsequence CAN54G2 Ravn GP2 D5 2.757 LINTEIDFDPIPNTE D6 1.849 (SEQIDNO:194) IDFDPIPNTETIFDE (SEQIDNO:195) CAN54G3 Ravn GP2 D5 2.220 LINTEIDFDPIPNTE D6 1.444 (SEQIDNO:196) IDFDPIPNTETIFDE (SEQIDNO:197) CAN40G1 Ravn N/A N/A N/A unreactivetopins (tested2),likely recognizes conformationalepitope CAN40G1 Musoke GP1/GP2 Multiple N/A Mayrecognizearepeat sequenceor conformationalepitope *Note: Overflow value is greater than 3.9
Example 8
Mouse In Vivo Protection Experiments
[0129] All procedures with infectious marburgviruses were performed in biosafety level 4 facilities (BSL-4). BALB/c mice were challenged intraperitoneally (IP) with 1000 plaque-forming units (p.f.u.) mouse-adapted MARV. One hour post-exposure, the mice were treated IP with 500 g (0.5 ml of 1.0 mg/ml mAb in PBS solution) of purified monoclonal antibody or PBS alone. One study also included a negative control group treated with 500 g of anti-HA IgG at 1.0 mg/mL. Clinical signs for infection were monitored for 28 days post-exposure at which point the study ended, and mice were euthanized.
[0130] Two separate studies were performed. Table 5 shows the characteristics of the mAbs as well as the results from the in vivo protection studies.
TABLE-US-00005 TABLE 5 Summary of antibodies generated to Marburg Ravn GP, Marburg Angola GP and Marburg Musoke GP and their protective properties in vivo. Protection in Cross Reactivity VSVdG/GP BALB/c mice mAb with GPemuc Epitope Neutralization Study 1 Study 2 30G1 R, A, M, P GP1 5% 30G3 R, A, M, P N-term 40% 8/10 6/10 GP2 30G4 R, A, M, P 451-475 50% 6/10 30G5 R, A, M, P 456-475 50% 10/10 10/10 40G1 R, A, M, P, Ebov GP1 0% 4/10 54G1 R, M, P C-term 50% 0/10 GP2 54G2 R, A, M, P N-term 40% 9/10 9/10 GP2 54G3 R, A, M, P GP1 0% 10/10 1/10 61G2 R, A, M, P GP1 20% 1/10 61G5 R, A, M, P unknown 30%
Example 9
V-Gene Sequencing
[0131] RNA was isolated from the parental hybridoma clonal cell line using RNeasy Mini Kit. The amplification of V genes from the RNA was performed using the Qiagen OneStep RT-PCR Kit. Several combinations of primer sets were used. The results of the PCR amplification reactions were determined by examining the PCR products on an analytical agarose gel, and the visualized bands at approximately 300-500 bp were gel isolated for cloning. The extracted DNA was directly TA cloned into the pCR2.1-TOPO vector using the low melt agarose method in TOPO TA Cloning manual. The clone reactions were sequenced in both directions using the M13 Forward and M13 Reverse primers. Sequence data was analyzed using DNAStar Lasergene Software.
[0132]
Example 10
Fab Masking Against Immunodominant Epitope to Modulate Immune Response for Immunotherapy
[0133] C. difficile full length or subdomains of Toxins A (TcdA) and B (TcdB) are amplified from Clostridium difficile strain ATCC43255 genomic DNA and ligated into pHis1522 shuttle expression vector with a C terminal poly-His tag (6His) to facilitate purification. The vectors are then transformed into Bacillus megaterium protoplasts (Mo Bi Tec system, Goettingen, Germany) which are designed for protein expression (Yang G et al, 2008, BMC Microbiology, 8(1):192; Burger S et al, 2003, BBRC, 307(3):584-588). The toxins A and B are expressed in the cells with D-xylose induction and harvested by lysing the cells using a dry ice/ethanol bath. The supernatant is purified on a Ni.sup.2+ column, eluted by chelation and buffer-exchanged into PBS. Protein concentrations of purified antigen(s) were determined using Pierce BCA assay (Fisher Scientific, Ottawa, Canada).
[0134] Purified mAbs for blocking immunodominant epitopes on C. difficile Toxin A Fragment 4, Toxin B Fragment 1 or Toxin B Fragment 4 are derived from hybridoma cell culture (murine variant) or mammalian cell culture (human variant) as described in WO 2013/028810 and WO 2014/085749. Purified mAbs are treated with papain to generate Fab or pepsin to creae F(ab).sub.2 and incubated in a molar excess with recombinant TcdA, TcdB or subdomains as described in Example 1. The immunogenic composition (complexed mAb Fab or F(ab).sub.2: Toxin) can then be used as an immunogen and/or booster during immunization of mice as described in Example 2 and antisera screened for high titres against the non-immunodominant epitopes. The immunosera of mice immunized and boosted with TcdA:CAN20G2Fab immunogenic complex, is screened for high titers against recombinant TcdAF4 to identify mAbs against fragments 1, 2 or 3 of TcdA. Likewise mice immunized and boosted with TcdB:CAN46G4Fab:CAN46G13aFab immunogenic complex, undergoing screening of immunosera for high titers against recombinant TcdBF1F4 for the creation of mAbs against fragments 2 and 3 of TcdB. Employing different combinations of immunogenic complexes and screening for the desired immune response allows the identification of immunized mice for the creation of hybridoma cell lines with mAbs directed against non-immunodominant epitopes.
Example 11
Modulating Hyperimmune for Passive Immunization
[0135] Antibodies play a major role in protective immunity by neutralizing toxins from numerous pathogens and plants. While the exact mechanism of protection is not always fully understood, many vaccines and passive antibody therapies are based on this fact. For ricin, toxin neutralization is believed to involve multiple mechanisms and efforts are often directed towards the A-chain outside the cell or prevention of attachment by raising anti-B chain mAbs. In addition, treatment options for ricin and other toxins often employ xenogeneic antibodies (e.g. IgGs recovered from horses immunized with antigen) for use as a passive immunotherapy often called hyperimmune. In these instances in order to avoid serum sickness, the antibodies are prepared in the form of Fab/F(ab).sub.2, and therefore rely on the antibody actions related to the variable region (neutralization) at the loss of the Fc region (effector functionality). For a hyperimmune, the potency is related to the concentration of effective mAbs in the immunoglobulin fraction.
[0136] In the current example one would block immunodominant epitopes that are known to be non-neutralizing or non-protective against an antigen used for the production of hyperimmunes to direct the immune response against the known effective epitopes. In this manner the dilution of neutralizing/protective antibodies by high titres against ineffective epitopes can be directed those known to be neutralizing or protective.
[0137] The scope of the present inventions is not limited by what has been specifically shown and described herein above. Those skilled in the art will recognize that there are suitable alternatives to the depicted examples of materials, configurations, constructions and dimensions. Variations, modifications and other implementations of what is described herein will occur to those of ordinary skill in the art without departing from the spirit and scope of the invention. While certain embodiments of the present invention have been shown and described, it will be obvious to those skilled in the art that changes and modifications may be made without departing from the spirit and scope of the invention. The matter set forth in the foregoing description and accompanying drawings is offered by way of illustration only and not as a limitation.