HIGH AFFINITY AND AGGREGATIVELY STABLE ANTIBODIES ON THE BASIS OF VARIABLE DOMAINS VL AND A DERIVATIVE VHH

20170066843 ยท 2017-03-09

    Inventors

    Cpc classification

    International classification

    Abstract

    The monoclonal IgG-type antibodies were suggested comprising variable domains represented by a combination of VHH-derivative with a variable domain of the light chain V.sub.L. Said antibodies can comprise amino acid substitutions at positions 44 and 45 (Kabat numbering) or combinations thereof. Antibodies of the invention possess increased affinity and improved aggregation stability.

    Claims

    1. A humanized monoclonal IgG antibody or a fragment thereof wherein the variable domains are represented by a combination of a V.sub.HH-derivative with a variable domain of the light chain V.sub.L.

    2. The antibody or the fragment thereof according to claim 1, wherein the V.sub.HH-derivative comprises the following amino acid substitutions at positions 44X.sub.245 X.sub.3: a) wherein 44X2=G, A, V, S, T; b) wherein 45X3=A, V, T, H; or combinations thereof.

    3. The antibody or the fragment thereof according to claim 1, characterized by increased aggregation stability of V.sub.HH-derivative compared to the native VHH antibody isolated from an immunized animal from Camelidae family.

    4. The antibody or the fragment thereof according to claim 1, wherein the V.sub.HH-derivative is represented by: a variable domain of the heavy chain isolated from an immunized animal from Camelidae family; or a variable domain of the heavy chain isolated from a non-immunized animal from Camelidae family; and comprises additional amino acid substitutions typical for humans and located at any positions, except for the following substitutions at positions 44X.sub.245 X.sub.3: c) wherein 44X2=G, A, V, S, T; d) wherein 45X3=A, V, T, H; or combinations thereof.

    5. The antibody or the fragment thereof according to claim 1, wherein the variable domain of the light chain V.sub.L is a human antibody derivative or a humanized fragment of a mammalian antibody.

    6. The antibody according to claim 1, wherein said antibody is IgG1, IgG2, IgG3 or IgG4.

    7. The antibody according to claim 6, comprising a non-native modified Fc as a part of IgG.

    8. The antibody or the fragment thereof according to claim 1, wherein said antibody has at least one of the following properties: a) an aggregation stability such that when used in concentrations over 10 mg/ml and stored for >6 months at a temperature of 4 C., the content of aggregates increases by not more than 5% of their initial content in the solution; b) an aggregation stability such that when used in concentrations over 10 mg/ml and stored for >2 weeks at a temperature of 37 C., the content of aggregates increases by not more than 5% of their initial content in the solution; c) an aggregation stability such that when used in concentrations over 10 mg/ml and stored for >48h at a temperature of 42 C., the content of aggregates increases by not more than 5% of their initial content in the solution; d) an aggregation stability such that when used in concentrations over 10 mg/ml and stored for >6 h at a temperature of 50 C., the content of aggregates increases by not more than 5% of their initial content in the solution; e) a dissociation constant K.sub.D of 10.sup.9 M or lower; f) an antibody-antigen interaction kinetic association constant k.sub.on(l/Ms) of at least 10.sup.5 l/Msec or more; or g) an antibody-antigen interaction kinetic dissociation constant dis(Vs) of 10.sup.4 l/sec or lower.

    9. The antibody or the fragment thereof according to claim 1 that specifically binds to human IL-17A, comprising a) a derivative of Camelidae heavy chain variable domain (V.sub.HH) that comprises 3 hypervariable regions HCDR1, HCDR2 and HCDR3, wherein: HCDR1 comprises the amino acid sequence of SEQ ID NO: 1: G-T-F-A-T-X32-X33-X34-X35, wherein X32 is an amino acid selected from the group consisting of S, N, K, R, E, W, Q, D, A, V and F; X33 is an amino acid selected from the group consisting of P and S; X34 is an amino acid selected from the group consisting of M and I; and X35 is an amino acid selected from the group consisting of G, N, S, A, L, I, R, V and Q; HCDR2 comprises the amino acid sequence of SEQ ID NO: 2: X50-I-X52-X52a-S-G-X55-D-R-I-Y-A-D-S-V-K-G, wherein X50 is an amino acid selected from the group consisting of A, G and L; X52 is an amino acid selected from the group consisting of S, D and E; X52a is an amino acid selected from the group consisting of P and A; and X55 is an amino acid selected from the group consisting of G, S, T, L, R, D, E, K, A and W; HCDR3 comprises the amino acid sequence of SEQ ID NO: 3: C-A-X94-X95-X96-X97-F-X99-X100-X100a-X100b-X100c-X100d-X100e-X100f-D-Y-D-S, wherein X94 is an amino acid selected from the group consisting of K, S, T, V, D and G; X95 is an amino acid selected from the group consisting of R and K; X96 is an amino acid selected from the group consisting of G, R, Y, H, D, W and K; X97 is an amino acid selected from the group consisting of R, A, V, S, L and H; X99 is an amino acid selected from the group consisting of D, E, G, A, R, V, K and Q; X100 is an amino acid selected from the group consisting of G, S and N; X100a is an amino acid selected from the group consisting of G, T, P, V, R, N and K; X100b is an amino acid selected from the group consisting of V, S, T, L, Y, A, H, G and I; X100c is an amino acid selected from the group consisting of Y, W and S; X100d is an amino acid selected from the group consisting of R, V, L, Y, A, W, K, G, Q and I; X100e is an amino acid selected from the group consisting of T, L, A and S; and X100f is an amino acid selected from the group consisting of T, L, G, P, N, A, Q, F, I and D; and b) a variable domain of the light chain (V.sub.L) of a human antibody or a variable domain of the light chain of a humanized antibody.

    10. The antibody or the fragment thereof according to claim 1 that specifically binds to human IL-17A, comprising: a) a derivative of the heavy chain variable domain (V.sub.HH) comprising 3 hypervariable regions HCDR1, HCDR2 and HCDR3, wherein: HCDR1 comprises the amino acid sequence of G-T-F-A-T-S-P-M-G (SEQ ID NO: 4); HCDR2 comprises the amino acid sequence of A-I-S-P-S-G-G-D-R-I-Y-A-D-S-V-K-G (SEQ ID NO: 5); and HCDR3 comprises the amino acid sequence of C-A-V-R-R-R-F-D-G-T-S-Y-Y-T-G-D-Y-D-S(SEQ ID NO: 6); and b) a variable domain of the light chain (V.sub.L) of a human antibody or a variable domain of the light chain of a humanized antibody.

    11. The antibody or the fragment thereof according to claim 10 that specifically binds to human IL-17A, comprising: a) a derivative of the heavy chain variable domain (V.sub.HH) comprising the amino acid sequence QVQLVQSGGGLVQAGGSLRLSCAASGGTFATSPMGWLRQAPGKGTEFVAAI SPSGGDRIYADSVKGRFTISRDNAGYFIYLQMNSLKPEDTAVYYCAVRRRFDGTSYY TGDYDSWGQGTLVTVSS (SEQ ID NO: 7); and b) a variable domain of the light chain (V.sub.L) of a human antibody or a variable domain of the light chain of a humanized antibody.

    12. The antibody or the fragment thereof according to claim 11 that specifically binds to human IL-17A, wherein said derivative of said V.sub.HH comprises an amino acid sequence at least 90% identical to SEQ ID NO: 7.

    13. The antibody or the fragment thereof according to claim 12 that specifically binds to human IL-17A, wherein said variable domain of said light chain (V.sub.L) comprises the amino acid sequence EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYDASS RATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYSYSPVTFGQGTKVEIKR (SEQ ID NO: 8).

    14. The antibody or the fragment thereof according to claim 13 that specifically binds human IL-17A, wherein said variable domain comprises an amino acid sequence at least 90% identical to SEQ ID NO: 8.

    15. The antibody or the fragment thereof according to claim 1 wherein the antibody or the fragment thereof specifically binds human IL-17A and wherein: a) the heavy chain comprises the following amino acid sequence: QVQLVQSGGGLVQAGGSLRLSCAASGGTFATSPMGWLRQAPGKGTEFVAAI SPSGGDRIYADSVKGRFTISRDNAGYFIYLQMNSLKPEDTAVYYCAVRRRFDGTSYY TGDYDSWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVS WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKR VEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLYITREPEVTCVVVDVSHEDPE VKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNK ALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKS LSLSPGK (SEQ ID NO: 9); and b) the variable domain of the light chain (V.sub.L) comprises the following amino acid sequence: TABLE-US-00007 (SEQIDNO:10) EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIY DASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYSYSPVTFG QGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWK VDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQ GLSSPVTKSFNRGEC.

    16. The antibody or the fragment thereof according to claim 15 that specifically binds human IL-17A, wherein said heavy chain comprises an amino acid sequence at least 90% identical to SEQ ID NO: 9 and/or said variable domain of said V.sub.L comprises an amino acid sequence at least 90% identical to SEQ ID NO:10.

    17. An antibody or the fragment thereof according to claim 9, wherein said antibody has at least one of the following properties: a) a binding affinity to human IL-17A characterized by K.sub.D of 10.sup.10 M or lower; b) a kinetic association constant k.sub.on(l/Mc) for human IL-17A of not less than 10.sup.5 l/Msec; or c) a kinetic dissociation constant dis(Vs) for human IL-17A of not more than 10.sup.5 l/sec. d) inhibits the activity of human IL-17A by no less than 50%.

    18. The antibody or the fragment thereof according to claim 9 comprising one or more additional amino acid substitutions in the Fc-region compared to the native Fc, wherein said substitutions improve physical-chemical and pharmacokinetic properties of the antibody, as compared to an antibody with the native Fc, and do not reduce the antibody's ability to bind IL-17A.

    19. A DNA construct encoding the antibody or the fragment thereof according to claim 1.

    20. An expression vector comprising the DNA construct according to claim 19.

    21. A host cell comprising the expression vector according to claim 20.

    22. A method for producing the antibody or the fragment thereof according to claim 1, which involves incubation of a host cell according to claim 21 in a culture medium under the conditions sufficient to obtain said antibody or fragment thereof, followed by isolation and purification of obtained antibody or its active fragment.

    23. A pharmaceutical composition comprising the antibody or the fragment thereof according to claim 1, and one or more pharmaceutically suitable excipient, diluent or carrier.

    24. The pharmaceutical composition according to claim 23, further comprising an active pharmaceutical ingredient which is a TNF- inhibitor.

    25. A method for treatment of an IL-17A-mediated disease or disorder, comprising administration of a therapeutically effective amount of the antibody or the fragment thereof according to claim 1 to a patient in need thereof.

    26. The method according to claim 25, wherein the IL-17A-mediated disease or disorder is selected from: rheumatoid arthritis, osteoarthritis, juvenile chronic arthritis, septic arthritis, Lyme arthritis, psoriatic arthritis, reactive arthritis, spondyloarthropathy, systemic lupus erythematosus, Crohn's disease, ulcerative colitis, inflammatory bowel disease, insulin dependent diabetes mellitus, thyroadenitis, asthma, allergic disorders, psoriasis, dermatitis, systemic sclerosis, graft-versus-host disease, graft rejection, acute or chronic immune disease associated with organ grafting, sarcoidosis, atherosclerosis, disseminated intravascular coagulation, Kawasaki disease, Graves' disease, nephrotic syndrome, chronic fatigue syndrome, Wegener's disease, Henoch-Schonlein purpura, microscopic polyangiitis with renal involvement, chronic active hepatitis, uveitis, septic shock, toxic shock syndrome, sepsis syndrome, cachexia, infections, invasions, acquired immune deficiency syndrome, acute transverse myelitis, Huntington chorea, Parkinson disease, Alzheimer disease, stroke, primary biliary cirrhosis, hemolytic anemia, malignancies, heart failure, myocardial infarction, Addison disease, polyglandular autoimmune syndrome type I and type II, Schmidt's syndrome, acute respiratory distress syndrome, alopecia, alopecia areata, seronegative arthropathy, arthropathy, Reiter's syndrome, psoriatic arthropathy, arthropathy associated with ulcerative colitis, enteropathic synovitis, arthropathy associated with Chlamydia, Yersinia and Salmonella, spondyloarthropathy, atheromatosis disease/coronary sclerosis, atopic allergy, autoimmune bullous disease, pemphigus, pemphigus foliaceus, pemphigoid, linear IgA diseases, autoimmune hemolytic anemia, Coombs positive hemolytic anemia, acquired pernicious anemia, juvenile pernicious anemia, Myalgic encephalomyelitis/chronic fatigue syndrome, chronic active hepatic inflammation, cranial giant arteritis, primary sclerosing hepatitis, cryptogenic autoimmune hepatitis, acquired immune deficiency syndrome (AIDS), AIDS-associated diseases, hepatitis B, hepatitis C, common variable immunodeficiency (common variable hypogammaglobulinemia), dilated cardiomyopathy, female sterility, ovarian insufficiency, Premature ovarian failure, pulmonary fibrosis, cryptogenic fibrosing alveolitis, post inflammatory interstitial lung pathologies, interstitial pneumonitis, connective tissue disease associated with interstitial lung disease, mixed connective tissue disease associated with interstitial lung disease, systemic scleroderma associated with interstitial lung disease, rheumatoid arthrisit associated with interstitial lung disease, systemic lupus erythematosus associated with lung disease, dermatomyositis/polymyositis associated with lung disease, Sjogren disease associated with lung disease, ankylosing spondylitis associated with lung disease, diffuse pulmonary vasculitis, hemosiderosis associated with lung disease, drug-induced interstitial lung disease, fibrosis, radiation-induced fibrosis, obliterating bronchiolitis, chronic eosinophilic pneumonia, lung disease with lymphocyte infiltration, post infectious interstitial lung pathologies, gouty arthritis, autoimmune hepatitis, autoimmune hepatitis type I (classic autoimmune or lupoid hepatitis), autoimmune hepatitis type II (associated with anti-LKM antibody), autoimmune hypoglycemia, type B insulin resistance with acanthokeratodermia, hypoparathyroidism, acute graft-associated immune disease, chronic graft-associated immune disease, osteoarthrosis, primary sclerosing cholangitis, type I psoriasis, type II psoriasis, idiopathic leukopenia, autoimmune neutropenia, NOS-kidney diseases, glomerulonephritis, microscopic renal polyangiitis, Lyme disease, discoid lupus erythematosus, idiopathic of NOS-male sterility, antisperm immunity, multiple sclerosis (all types), sympathetic ophthalmia, pulmonary hypertension secondary to connective tissue disease, Goodpasture syndrome, pulmonary manifestations of polyarteritis nodosa, acute rheumatic fever, rheumatoid spondylitis, Still's disease, systemic scleroderma, Sjogren's Syndrome, Takayasu disease/arthritis, autoimmune thrombocytopenia, idiopathic thrombocytopenia, autoimmune thyroid disorders, hyperthyroid, autoimmune hypothyroidism (Hashimoto disease), atrophic autoimmune hypothyroidism, primary myxedema, phacogenic uveitis, primary vasculitis, vitiligo, acute hepatic disease, chronic hepatic disease, alcoholic cirrhosis, alcohol-induced liver damage, cholestasis, idiosyncratic hepatic disease, drug-induced hepatitis, nonalcoholic steatohepatitis, allergies and asthma, group B streptococcal infection (GBS), mental disorders (including depressions and schizophrenia), Th1- and Th2-mediated disease, acute and chronic pain (various forms), malignancies such as lung cancer, breast cancer, stomach cancer, bladder cancer, colorectal cancer, pancreatic cancer, ovarian cancer, prostate cancer and hematopoietic malignancies (leukemia and lymphomas), abetalipoproteinaemia, acrocyanosis, acute and chronic infections and infestations, acute leukemia, acute lymphoblastic leukemia, acute myeloid leukemia, acute or chronic bacterial infection, acute pancreatitis, acute renal failure, adenocarcinoma, atrial ectopics, AIDS dementia complex, alcohol-induced hepatitis, allergic conjunctivitis, allergic contact dermatitis, allergic rhinitis, allograft rejection, alpha-I antitrypsin deficiency, lateral amyotrophic sclerosis, anemia, angina, anterior horn cell degeneration, anti-CD3 therapy, antiphospholipid syndrome, hypersensitivity reactions against receptors, aortic and peripheral aneurysms, aortic dissection, arterial hypertension, coronary sclerosis, arteriovenous fistula, ataxia, atrial fibrillation (constant or paroxysmal), atrial flutter, atrioventricular block, B-cell lymphoma, bone graft rejection, bone marrow transplant (BMT) rejection, bundle branch block, Burkitt lymphoma, burns, cardiac arrythmia, myocardial stunning syndrome, cardiac tumor, cardiomyopathy, inflammatory response to bypass, cartilage graft rejection, brain cortex degeneration, cerebellar disorder, chaotic or multifocal atrial tachycardia, chemotherapy-induced disorders, chronic myelocytic leukemia (CML), chronic alcohol addiction, chronic inflammatory pathologies, chronic lymphatic leukemia (CLL), chronic obstructive pulmonary disease, chronic salicylate intoxication, rectocolic carcinoma, congestive cardiac failure, conjunctivitis, contact dermatitis, pulmonary heart, coronary artery disease, Creutzfeldt-Jakob Disease, culture-negative sepsis, cystic fibrosis, cytokine therapy-induced disorders, boxer's encephalopathy, demyelinating disease, dengue hemorrhagic fever, dermatitis, dermatological conditions, diabetes, diabetes mellitus, diabetes-related atherosclerotic vascular disease, diffuse Lewy body disease, congestive dilated cardiomyopathy, basal ganglia disease, Down's syndrome in middle age, motor disorders induced by CNS dopamine blockers, drug sensitivity, eczema, encephalomyelitis, endocarditis, endocrinopathy, epiglottiditis, Epstein-Barr viral infection, erythralgia, extrapyramidal and cerebellar symptoms, familial hemophagocytic lymphohistiocytosis, fetal thymus graft rejection, Friedreich's ataxia, peripheral artery disease, fungal sepsis, gas phlegmon, gastric ulcer, glomerulonephritis, any organ or tissue graft rejection, gram negative sepsis, gram positive sepsis, granulomas due to intracellular organisms, hairy-cell leukemia, Hallervorden-Spatz disease, Hashimoto's thyroiditis, hay fever, heart transplant rejection, hemochromatosis, hemodialysis, hemolytic uremic syndrome/thrombotic thrombocytopenic purpura, bleeding, hepatitis (A), bundle branch arrhythmia, HIV-infections/HIV-neuropathies, Hodgkin disease, hyperkinetic motor disorders, hypersensitivity reactions, hypersensitivity-associated pneumonitis, hypertension, hypokinetic motor disorders, examination of hypothalamo-pituitary-adrenal axis, idiopathic Addison's disease, idiopathic pulmonary fibrosis, antibody-mediated cytotoxicity, asthenia, infantile muscular atrophy, aortal inflammation, influenza virus A, exposure to ionizing radiation, iridocyclitis/uveitis/optic neuritis, ischaemia/reperfusion-induced disorders, ischaemic stroke, juvenile rheumatoid arthritis, juvenile spinal muscular atrophy, Kaposi's sarcoma, renal transplant rejection, legionellosis, leishmaniasis, leprosy, corticospinal damage, lipoedema, liver transplant rejection, lymphoedema, malaria, malignant lymphoma, malignant histiocytosis, malignant melanoma, meningitis, meningococcemia, metabolic/idiopathic diseases, migraine, multiple system mitochondrial disorders, mixed connective-tissue disease, monoclonal gammapathy, multiple myeloma, multiple system degeneration (Mencel Dejerine-Thomas Shi-Drager and Machado-Joseph), myasthenia gravis, intracellular Mycobacterium avium, Mycobacterium tuberculosis, myelodysplastic syndrome, myocardial infarction, myocardial ischemic disease, nasopharyngeal cancer, neonatal chronic lung disease, nephritis, nephrotic, neurodegenerative disorders, neurogenic muscular atrophy I, neutropenic fever, non-Hodgkin's lymphomas, abdominal aortic branch occlusion, arterial occlusive disease, OKT3 treatment, orchitis/epididymitis, orchitis/vasectomy reversal operations, organomegaly, osteoporosis, pancreatic graft rejection, pancreatic carcinoma, paraneoplastic disease/tumor-related hypercalcemia, parathyroid graft rejection, pelvic inflammatory disease, perennial rhinitis, pericardial disease, peripheral atherosclerosis (atherlosclerotic) disease, peripheral vascular disease, peritonitis, pernicious anemia, Pneumocystis carinii pneumonia, POEMS syndrome (polyneuropathy, organomegaly, endocrinopathy, monoclonal plasma-proliferative disorder and skin changes), postperfusion syndrome, pump head syndrome, post-cardiotomy post-infarction syndrome, preeclampsia, progressive supranuclear paralysis, primary pulmonary hypertension, radiation therapy, Raynaud's phenomenon and disease, Raynoud's disease, Refsum's disease, regular narrow QRS tachycardia, renal vascular hypertension, reperfusion injury, restrictive cardiomyopathy, sarcoma, scleroderma disease, senile chorea, Dementia with Lewy bodies, seronegative arthritis, shock, sickle cell disease, skin allograft rejection, skin changes, small intestinal graft rejection, solid tumors, specific arrhythmias, spinal ataxia, spinocerebellar degradations, streptococcal myositis, cerebellar structural damage, subacute sclerosing panencephalitis, syncope, cardiovascular syphilis, systemic anaphylaxis, a comprehensive systemic inflammatory response syndrome, systemic-onset juvenile rheumatoid arthritis, T cells or FAB ALL, telangiectasia, thrombosis obliterans, thrombocytopenia, toxicity, grafting, trauma/bleeding, hypersensitivity reactions type III, hypersensitivity reactions type IV, unstable angina, uremia, urinary sepsis, urticaria, valvular heart disease, varicose veins, vasculitis, venous diseases, venous thrombosis, ventricular fibrillation, viral and fungal infections, vital encephalitis/aseptic meningitis, vital hemophagocytic syndrome, Wernicke-Korsakoff syndrome, Wilson's disease, heterograft rejection for any organ or tissue, acute coronary syndrome, acute idiopathic polyneuritis, acute inflammatory demyelinating radicular neuropathy, acute ischemia, adult-onset Stills disease, alopecia areata, anaphylaxis, antiphospholipid antibody syndrome, aplastic anemia, coronary sclerosis, atopic eczema, atopic dermatitis, autoimmune dermatitis, autoimmune disorder associated with streptococcus infection, autoimmune enteropathy, autoimmune hearing loss, autoimmune lymphoproliferative syndrome (ALPS), autoimmune myocarditis, autoimmune premature ovarian failure, blepharitis, bronchiectasis, bullous pemphigoid, cardiovascular disease, catastrophic antiphospholipid syndrome, celiac disease, cervical spondylosis, chronic ischemia, cicatrical pemphigoid, clinically isolated syndrome (cis) with the risk for multiple sclerosis, conjunctivitis, childhood-onset mental disorders, chronic obstructive pulmonary disease (COPD), dacryocystitis, dermatomyositis, diabetic retinopathy, diabetes mellitus, herniated disk, prolapse of intervertebral disc, drug-induced immune haemolytic anaemia, endocarditis, endometreosis, entophthalmia, episcleritis, erythema multiform, severe erythema multiform, gestational pemphigoid, Guillain-Barre syndrome (GBS), hay fever, Hughes syndrome, idiopathic Parkinson's disease, idiopathic interstitial pneumonia, IgE-mediated allergy, autoimmune hemolytic anemia, inclusion body myositis, infectious ocular inflammatory disease, inflammatory demyelinating disease, inflammatory heart disease, inflammatory kidney disease, idiopathic pulmonary fibrosis/usual interstitial pneumonia, iritis, keratitis, keratoconjunctivitis sicca, Kussmaul disease or Kussmaul-Meier Disease, Landry palsy, Langerhans' cell histiocytosis, marbled skin, macular degeneration, microscopic polyangiitis, Bechterew disease, motor neuron disease, mucosal pemphigoid, multiple organ failure, myasthenia gravis, spinal cord dysplasia syndrome, myocarditis, nerve root disorders, neuropathy, non-A, non-B hepatitis, optic neuritis, osteolysis, ovarian cancer, oligoarticular JIA, peripheral arterial occlusive disease, peripheral vascular disease, peripheral artery disease (PAD), phlebitis, polyarteritis nodosa, polychondritis, polymyalgia rheumatica, poliosis, polyarticular juvenile idiopathic arthritis, multiple endocrine deficience, polymyositis, polymyalgia rheumatica (PMR), post pump syndrome, primary parkinsonism, prostate and rectal cancer and hematopoietic malignancies (leukemia and lymphoma), prostatitis, pure red-cell aplasia, primary adrenal insufficiency, relapsing neuromyelitis optica, restenosis, rheumatic heart disease, SAPHO (synovitis, acne, pustulosis, hyperostosis and osteitis), scleroderma, secondary amyloidosis, shock lung, scleritis, ischias, secondary adrenal insufficiency, silicon-associated connective tissue disease, Sneddon-Wilkinson disease, ankylosing spondylitis, Stevens-Johnson syndrome, systemic inflammation response syndrome, cranial arteritis, Toxoplasma rhinitis, toxic epidermal necrolysis, transverse myelitis, TRAPS (tumor necrosis factor receptor-associated periodic syndrome), allergic reactions type I, diabetes type II, urticaria, usual interstitial pneumonia, vasculitis, vernal conjunctivitis, viral retinitis, Vogt-Koyanagi-Harada syndrome (VKH syndrome), wet macular degeneration, wound healing, and Yersinia- or Salmonella-associated arthropathy.

    27. The method according to 26, further comprising the administration of a TNF- inhibitor.

    Description

    FIGURES

    [0024] FIG. 1. Flow-chart for development and optimization of an aggregation-resistant VHH-based antibody.

    [0025] FIG. 2, 3, 4. SDS-PAGE with VHHIgG1 antibodies comprising various amino acid substitutions.

    [0026] FIG. 5. Flow-chart of the synthesis of llama combinatorial Fab library.

    [0027] FIG. 6. Phagemid for cloning of phage display Fab libraries.

    [0028] FIG. 5A-C. Sensograms obtained for testing the comparative kinetic parameters of VHH Fab clones with regard to binding with IL-17A:

    [0029] FIG. 7. A.) Sequences of llama variable VHH domains within Fab specific against human IL-17A. B). Sequences of llama light chain variable domains within 3VHHFab specific against human IL-17A.

    [0030] FIG. 8. Sensograms obtained for testing the comparative kinetic parameters of VHH Fab clones with regard to binding with IL-17A.

    [0031] FIG. 9. Amino acid sequences for 3 different VHH mutants.

    [0032] FIG. 10, 11. Aggregation stability of three VHH mutants.

    [0033] FIG. 12, 13. Affinity of three VHH mutants.

    [0034] FIG. 14. Cell test for suppression of IL-6 production by inhibiting IL-17A with VHHIgG1VK4B11, mut1VHHIgG1 and mut4VHHIgG1 antagonists.

    [0035] FIG. 15, 16. Isolation of chimeric variants of mut4 VHHFab comprising human light chains.

    [0036] FIG. 17. Cell test for suppression of IL-6 production by inhibiting IL-17A with mut4 VHHIgG1VK3c8, mut4 VHHIgG1VK1A7 and mut4 VHHIgG1VK4E12 antagonists.

    [0037] FIG. 18, 19. Protein electrophoresis under denaturant conditions performed for products comprising the antibodies with mutations in positions 44 and 45 of m4 VHHc8.

    [0038] FIG. 20. Comparative cell test for suppression of IL-6 production by inhibiting IL-17A with m4VHHc8 antagonists comprising mutations in FR2 at positions 44 and 45.

    [0039] FIG. 21. Diagram showing the stability and functional properties of different mutations at positions 44 and 45 in FR2 of m4VHHc8 that determine the interaction of the light and heavy chain variable domains.

    [0040] FIG. 22. Determination of kinetic parameters of BCD109 interaction with IL-17A of various origins (test performed using Octet RED 96 equipment).

    [0041] FIG. 23. Results obtained for kinetic parameters of BCD109 interaction with IL17A of various origins (test performed using Octet RED 96 equipment).

    [0042] FIG. 24. Chromatogram obtained with BCD109 antibodies before and after the thermal stress.

    DEFINITIONS

    [0043] Monoclonal antibody as used herein relates to an antibody obtained from llama, chimeric antibody, humanized antibody or fully human antibody, unless otherwise stated in the present application. Monoclonal antibodies according to the invention can be produced using, for example, recombinant technology, phage display technology, synthetic technology or the combinations of these or other technologies well known from the prior art.

    [0044] Monoclonal antibody refers to an antibody obtained from a single copy or a clone including, for example, any eukaryotic, prokaryotic or phage clone, rather than to production method thereof. Monoclonal antibody can be an intact antibody (with full or full-length Fc-region), actually intact antibody, an antibody part or fragment comprising an antigen-binding region, for example, Fab-fragment, Fab-fragment or F(ab)2-fragment from llama or chimeric, humanized or human antibody. Fab-fragment comprises a variable light chain domain and a constant light chain domain as well as a variable heavy chain domain and first constant heavy chain domain (CH1). F(ab)2 antibody fragment contains a pair of Fab-fragments which are mostly covalently bound by hinged cysteine residues at C-terminal regions. Other chemical bonds between antibody fragments are also well known from the state of art.

    [0045] In addition, monoclonal antibody as used herein can be a single-chain Fv that can be obtained by binding DNA encoding VHH and VL with a linker sequence. As long as the protein keeps its ability of specific or preferable binding to the target (for example, epitope or antigen), it is covered by the term antibody. Antibodies can be either glycosylated or not and are within the frames of the invention.

    [0046] The term derivative or antibody variant, as used herein, refers to a molecule the amino acid sequence of which differs from the parental sequence by adding, deletion and/or, substitution of one or more amino acid residues in the sequence of parental antibody. In the preferred embodiment, an antibody contains at least one (for example, from one to about ten preferably 2, 3, 4, 5, 6, 7 or 8) amino acid substitutions in FR- or CDR-regions of the parental antibody. This application defines the identity or homology regarding the sequence of a variant antibody as the percentage of amino acid residues in a variant antibody sequence that are identical to residues in parental antibody after aligning the sequences and, if needed, cutting in order to achieve the maximum percentage identical sequence.

    [0047] An antibody derivative (from parental one) keeps its ability to bind the same antigen or, preferably, epitope as that with which the parental antibody binds, or, preferably, exhibits at least one property or biological activity exceeding that of the parental antibody. For example, the antibody preferably has a better aggregation stability, more strong affinity, improved pharmacokinetics or increased ability to inhibit the antigen biological activity, compared to parental antibody.

    [0048] The term VHH-derivative, as used herein, refers to the derivatives of VHH antibodies the amino acid sequence of which differs from the sequence of parental VHH antibody by substitution of one or more amino acid residues in the sequence of parental antibody. In the preferred embodiment, VHH antibody contains at least one (for example, from one to about ten preferably 2, 3, 4, 5, 6, 7 or 8) amino acid substitutions in FR- or CDR-regions of the parental antibody.

    [0049] An antibody derivative keeps its ability to bind the same antigen or, preferably, epitope as that with which the parental antibody binds, or, preferably, exhibits at least one property or biological activity exceeding that of the parental antibody. For example, the antibody preferably has a better aggregation stability, more strong affinity, improved pharmacokinetics or increased ability to inhibit the antigen biological activity, compared to parental antibody.

    [0050] Parental VHH antibody or initial VHH antibody, or wild VHH antibody as used herein refers to VHH antibody isolated from an immunized or non-immunized Camelidae animal encoded with amino acid sequence that is used to produce a VHH variant. Parental antibody can have a framework sequence originating from Camelidae (with respect to VHH variable domain), but preferably the frame sequence of the light chain variable domain is of completely or substantially human origin.

    [0051] Parental, initial, or wild antibody as used herein refers to an antibody encoded with amino acid sequence that is used to produce a variant. Parental antibody can have a framework sequence originating from Camelidae (with respect to VHH variable domain), but preferably the frame sequence of the light chain variable domain is of completely or substantially human origin.

    [0052] As used herein, the term specifically binds refers to such a situation in that one party involved in the process of specific binding does not significantly bind molecules other than its specific binding partner (partners). This term also applies if, for example, an antigen-binding site of the antibody according to the invention is specific for particular epitope that is carried by a number of antigens; in this case, the specific antibody with an antigen-binding site will be able to bind specifically with various epitope-carrying antigens. Thus, the monoclonal antibody according to the invention specifically binds to human IL-17 (IL-17A), while it does not specifically bind human IL-17B, IL-17C, IL-17D or IL-17E. Moreover, a monoclonal antibody of the invention specifically binds human IL-17 and IL-17 from cynomolgus monkey, but does not specifically bind neither rat IL-17 nor murine IL-17.

    [0053] As used herein, the term preferably binds refers to such a situation in that an antibody binds a specific antigen at least by 20% more, preferably by about 50%, or 2-fold, 20-fold, 50-fold or 100-fold more than it binds any other antigen, as measured according to the procedures known from the prior art (for example, competitive ELISA or K.sub.D measurements obtained using Octet apparatus). Antibody can preferably bind one epitope within an antigen but not bind another epitope of the same antigen. Thus, an antibody of the invention preferably binds human IL-17 but not rabbit IL-17.

    [0054] As used herein, the term epitope refers to the molecule part that can be recognized by and bind an antibody via one or several antigen-binding sites of an antibody. Epitopes often comprise the chemically surface-active groups of molecules such as amino acids or sugar side chains, and have specific 3-D structural characteristics Inhibiting epitope and/or neutralizing epitope means an epitope that, as in the context of an intact antigen molecule and binding an antibody specific to said epitope, causes in vivo or in vitro loss or reduction of activity of the molecule or organism that contains the molecule.

    [0055] As used herein, the term epitope also refers to a polypeptide fragment, having antigenic and/or immunogenic activity in animals, preferably in mammals such as mice and humans. The term antigenic epitope as used herein is a polypeptide fragment which can specifically bind the antibody and can be detected by any technique well known from the prior art (for example, by means of the standard immunoassay). Antigen epitopes are not necessary immunogenic, but they can possess immunogenicity. Immunogenic epitope as used herein is defined as a polypeptide fragment that evokes an antibody response in animals, as determined by any method of the prior art. Nonlinear epitope or conformational epitope contains nonadjacent polypeptides (amino acids) within the antigen protein, which binds with epitope-specific antibody.

    [0056] Expressed functional activity or functional characteristics or the terms biological activity or activity referring to an antibody according to the invention are interchangeable as used herein, and include but not limited to: epitope/antigen affinity and specificity; ability to neutralize or be an antagonist to IL-17 in vivo or in vitro; IC.sub.50; antibody stability and in vivo immunogenicity of the antibody. Other biological properties or antibody characteristics identified from the prior art include, for example, the cross-reactivity (i.e. reaction with non-human homologs of the target peptide or with other proteins or targets) and ability to retain high levels of protein expression in mammal cells. Aforementioned properties or characteristics may be observed, measured or evaluated using the procedures recognized in the prior art, including but not limited to ELISA, competitive ELISA, Octet analysis, neutralization assay in vitro or in vivo without limitation, receptor binding, production and/or release of cytokine or growth factor, signal transduction and immune histochemical study of tissue sections obtained from various sources including humans, primates or any other source.

    [0057] The population of monoclonal antibodies as used herein refers to a homogenous or essentially homogeneous antibody population (i.e. at least or 96%, but more preferably no less than about 97 or 98%, or further preferably at least 99% of antibodies in the population will compete for the same antigen/epitope in ELISA, or further preferably antibodies are identical regarding their amino acid sequences).

    [0058] A native full-size antibody is represented by immunoglobulin molecule comprising four polypeptide chains (two heavy H chains of about 50-70 KDa for the full length, and two light L chains of about 25 KDa for the full length) linked via disulfide bonds. Amino-terminal part of each chain comprises a variable domain of about 100-110 or more amino acids that are responsible for binding an antigen. Carboxyl-terminal domain of each chain determines the constant region that is mostly responsible for the effector function. Light chains are classified as kappa and lambda and have specific constant regions. Each light chain is characterized in comprising a variable N-terminal light chain region (hereafter referred to as VL or VK) and a constant light chain region that consists of a single domain (CL or CK). Heavy chains are classified as , , , , and and define classes of immunoglobulins: IgG, IgM, IgA, IgD and IgE, respectively; some of them can be additionally divided into sub-classes (isotypes) such as IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2. Each heavy chain type is characterized by a specific constant region Fc. Each heavy chain comprises a variable N-terminal region (hereafter referred to as VH) and constant region CH. Constant heavy chain region consists of three domains (CH1, CH2 and CH3) for IgG, IgD and IgA, and of 4 domains (CH1, CH2, CH3 and CH4) for IgM and IgE. VH, VHH and VL can also be divided into so-called hypervariable regions (complementarity determining regions, CDR) interspersing with more conservative framework regions (FR). Each variable domain comprises three CDRs and FRs located in the following order from N-terminus to C-terminus: FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4.

    [0059] In the present application, 3 heavy chain CDRs are referred to as HCDR1, HCDR2 and HCDR3, while 3 light chain CDR are referred to as LCDR1, LCDR2 custom-character LCDR3. CDRs contain the majority of amino acid residues specifically interacting with an antigen. CDR-residues are numbered and positioned in compliance with Kabat Numbering Scheme.

    [0060] The term antigen refers to an antigen target against which an antibody can be reactive; it is used herein in the same way as specialists use it in the this technical field, and includes but is not limited to, polypeptides, peptides, polysaccharides, glycoproteins, polynucleotides (for example, DNA), or chemical antigens, receptors or interleukins. Interleukins can include interleukins of various groups, such as interleukin 1 (alfa and beta), interleukin 2, interleukin 3, interleukin 4, interleukin 5, interleukin 6, interleukin 7, interleukin 8, interleukin 9, interleukin 10, interleukin 11, interleukin 17, interleukin 18 and interleukin 33.

    [0061] The term antigen can also be used to describe the material that is used for immunization of animals (for example, llama) with the purpose of production of antibodies of the invention. In that context, antigen can have a broader meaning and may cover purified forms of an antigen as well as non-purified or not fully isolated, or purified antigen products such as cells, cell lysates, or supernatants, cell fractions, for example, cell membranes etc. with added haptens conjugated with a protein-carrier. Antigen used for immunization does not necessary mean an antigen structurally identical to an antigen target to which, finally, an antibody of the invention is able to bind. Usually, antigen used for immunization is a downsized version of an antigen target, for example, a fragment comprising an immunogenic epitope. More details about antigens used for immunization are described in the literature and may be familiar to the specialist in this technical field.

    [0062] Variable regions of each light/heavy chain pair form antigen-binding sites of an antibody. Thus, an intact IgG antibody has two binding sites. Except for bi-functional or bi-specific antibodies, two binding sites are identical. According to the present application, antigen-binding region or antigen-binding site, or antigen-binding domain, are interchangeable, as used herein, with refer to an antibody region comprising amino acid residues interacting with an antigen and giving the antibody its specificity and affinity to an antigen. This antibody fragment includes the frame amino acid residues necessary for maintaining the proper conformation of antigen-binding residues.

    [0063] Preferably, CDR of VHH antigen-binding region or the entire antigen-binding region of an antibody of the invention fully originates from Camelidae family or is substantially of Camelidae origin, and comprises specific amino acid residues changed, for example, substituted with various amino acid residues (for example, refer to Table 6) in order to improve the particular properties of an antibody (for example, K.sub.D, k.sub.off or IC.sub.50). Preferably, the antibody framework regions in accordance with the invention are of Camelidae origin or of human origin, or substantially of a human origin (at least by 80, 85, 90, 95, 96, 97, 98 or 99% of human origin), and comply with Kabat numbering.

    [0064] Antibody fragment may be represented by an antibody fragment or antibody fragment that has the activity of a full-size antibody. Said antibody fragment may be represented by F(ab)2, F(ab)2, Fab, Fab Fv and scFv.

    [0065] Interleukin 17, also referred to as IL-17 or IL-17A, is a 20-30 kD homo-dimeric glycoprotein. The gene of human IL-17 encodes the protein consisting of 155 amino acids and having a 19 amino acid signal sequence and 136 amino acid mature segment. Amino acid sequence of human IL-17A is by 80%, 63% and 58% similar to amino acid sequences of rabbit, mouse and rat, respectively Amino acid sequence of human IL-17A is by 97% identical to IL-17A of cynomolgus monkey.

    [0066] The term antibody when applied in relation to anti-IL-17 monoclonal antibody of the invention (hereafter referred to as an antibody of the invention), as used herein, means a monoclonal antibody.

    [0067] As used herein, the terms inhibit or neutralize regarding to the activity of an antibody of the invention shall mean the ability to block, prevent, restrict, slow down, stop, reduce or reverse significantly, for example, the development or severity of inhibition subject, including but not limited to biological activity (such as activity of IL-17) or property, disease or condition. Binding of an antibody according to the invention with IL-17 results in the inhibition or neutralization of IL-17 activity preferably of at least 20, 30, 40, 50, 60, 70, 80, 90, 95% or higher.

    [0068] The term separated or isolated with regard to nucleic acids or protein products (such as an antibody) refers to the nucleic acid molecule or protein molecule that is identified and separated from at least one of contaminating substances to which it is usually combined in the natural source. Preferably, an isolated antibody is an antibody that substantially contains no other antibodies that have particular antigenic specificity (for example, pharmaceutical compositions of the invention contain an isolated antibody that specifically binds IL-17A and substantially contain no antibodies that specifically bind antigens other than IL-17A).

    [0069] The term Kabat numbering scheme or numbering according to Kabat as used herein refers to the system for numbering of amino acid residues that are more variable (i.e. hypervariable) than other amino acid residues in variable regions of heavy and light chains of an antibody (Kabat et al. Ann. N.Y. Acad. Sci., 190:382-93 (1971); Kabat et al. Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242 (1991)).

    [0070] Polynucleotide is functionally bound if it has functional linkages to other polynucleotide. For example, promoter or enhancer is functionally bound to the coding sequence if it affects the sequence transcription. Polypeptide is functionally bound to another polypeptide if polynucleotides coding thereof are functionally bound, preferably if they are located in the same open reading frame.

    [0071] The term DNA construct, as used herein, refers to DNA or its fragment coding an antibody of the invention. Generally, DNA or its fragment that codes an antibody (for example, an antibody of the invention) is functionally (operably) bound, within an open reading frame, to at least one other DNA fragment that codes an additional polypeptide (for example, domain or region of a receptor for another cytokine, such as IL-2-receptor), and then is inserted into an appropriate expressing vector. Normally, DNA constructs are formed in such a way that several DNA fragments coding certain antibody sites are functionally associated within a reading frame to obtain a solid construct that codes either an entire antibody or its functional fragment. For example, DNA construct would encode an antibody from N-terminus to C-terminus. Such antibodies can be expressed, isolated and evaluated regarding their activity.

    [0072] The term vector refers to nucleic acids that were obtained synthetically and via biotechnology and contain a certain and known in the present field set of sequence functional elements. Certain vectors can autonomously replicate in host cells to which they were introduced, while other vectors can integrate into host cell genome and replicate together with the host genome. Moreover, some vectors can mediate the expression of genes to which they are functionally bound. In this application such vectors are called recombinant expression vectors (or expression vectors); exemplary vectors are well known from the prior art.

    [0073] As used herein, the terms cell, host cell, cell line and cell culture are interchangeable and refer to an individual cell or cell culture that is a recipient of any isolated polynucleotide according to the invention or any recombinant vector (recombinant vectors) that contains the sequence of an antibody of the invention. Host cells involve generations obtained from an individual host cell; generations may not necessary be completely identical (regarding the morphology or full DNA complement) to original host cell due to natural, accidental or intended mutations and/or variations. A host cell includes cells that were transformed, transduced or infected with recombinant vector, or a monoclonal antibody that expresses a polynucleotide according to the invention or its heavy or light chain. Host cell that contains a recombinant vector according to the invention (either incorporated into host chromosomes or not) can also be called recombinant host cell. Preferable host cells to be used in the invention are CHO cells (for example, ATCC CRL-9096), NS0 cells, SP2/0 cells, COS cells (ATCC, for example, CRL-1650, CRL-1651) and HeLa (ATCC CCL-2). Additional host cells to be used in the invention include plant cells, yeast cells, other mammalian cells and prokaryotic cells.

    [0074] The term Specific binding between an antibody and an antigen target (antigen) refers to immunological specificity. Antibody can specifically bind an antigen target if it binds an antigen epitope stronger than other antigen epitopes. Specific binding does not exclude the cross-reactivity with other antigens that carry similar antigen epitopes.

    [0075] VL domains in antibodies of the invention can be either VL lambda type or VL kappa type. The term VL domain covers both VL lambda and VL kappa isotypes that contain one or more amino acid substitutions, insertions or deletions.

    [0076] The term pharmaceutical composition covers the formulation and/or composition containing a therapeutically effective amount of an antibody of the invention plus excipients (carriers, diluents, vehicles, solvents and other excipients such as).

    [0077] The term use or treatment applies to the ability of using an antibody of the invention or a pharmaceutical composition containing thereof to treat, relief the course of the disease, expedite the remission or reduce the recurrence rate for the disease or disorders mediated by receptors with which an antibody of the invention can bind.

    DESCRIPTION OF THE INVENTION

    [0078] The present invention proposes humanized monoclonal antibodies, preferably IgG type, which have an increased affinity and improved aggregation stability, wherein variable domains are represented by a combination of VHH-derivative with a variable domain of the light chain V.sub.L.

    [0079] In one embodiment, VHH-derivative of an antibody of the invention may comprise amino acid substitutions at positions 44X.sub.245 X.sub.3, where X.sub.2=G, A, V, S, T; a X.sub.3=A, V, T, H; or combinations thereof (44 and 45 designate the positions for amino acid substitutions). Hereinafter the position of amino acid substitution is indicated using Kabat numbering scheme (http://www.bioinf.org.uk/abs/).

    [0080] Another embodiment involves an antibody of the invention that has improved aggregation stability of VHH-derivative compared to initial IgG antibody comprising VHH isolated from an immunized animal, wherein an immunized animal can be from Camelidae.

    [0081] Another embodiment of the invention involves an antibody that comprises V.sub.HH-derivative that is a variable domain of the heavy chain of an antibody isolated from an immunized animal from Camelidae family. Herein V.sub.HH-derivative can have additional amino acid substitutions typical for humans at any positions, except for the following substitutions at positions 44 and 45: [0082] a) 44X.sub.2, wherein X2=G, A, V, S, T; [0083] b) 45X.sub.3, wherein X3=A, V, T, H; [0084] or combinations thereof.

    [0085] Another embodiment involves an antibody of the invention that comprises V.sub.HH-derivative that can be represented by a heavy chain variable domain isolated from non-immunized animal from Camelidae family. Herein V.sub.HH-derivative can have additional amino acid substitutions typical for humans at any positions, except for the following substitutions at positions 44 and 45: [0086] a) 44X.sub.2, wherein X2=G, A, V, S, T; [0087] b) 45X.sub.3, wherein X3=A, V, T, H; [0088] or combinations thereof.

    [0089] Another embodiment involves an antibody of the invention that comprises a light chain variable domain V.sub.L that is a derivative of a human antibody. In additional embodiment of the invention, the light chain variable domain V.sub.L is a humanized fragment of an animal antibody.

    [0090] Another embodiment involves an antibody of the invention that comprises a V.sub.HH-derivative that contains cysteine-44 (Kabat numbering scheme), and a light chain variable domain V.sub.L that contains cysteine-100 (Kabat numbering scheme).

    [0091] Another embodiment of the invention involves an antibody of any of the following isotypes: IgG1, IgG2, IgG3 or IgG4.

    [0092] Another embodiment involves an antibody of the invention that comprises a non-native modified Fc as a part of IgG.

    [0093] Another embodiment involves an antibody of the invention that has such aggregation stability that when used in concentrations over 10 mg/ml and stored for >6 months at a temperature of 4 C. the content of aggregates increases by not more than 5% of their initial content in the solution. In additional embodiment of the invention, an antibody has such aggregation stability that when used in concentrations over 10 mg/ml and stored for >2 weeks at a temperature of 37 C. the content of aggregates increases by not more than 5% of their initial content in the solution. Another additional embodiment of the invention involves an antibody that has such aggregation stability that when used in concentrations over 10 mg/ml and stored for >48 h at a temperature of 42 C. the content of aggregates increases by not more than 5% of their initial content in the solution. One more additional embodiment of the invention involves an antibody that has such aggregation stability that when used in concentrations over 10 mg/ml and stored for >6 h at a temperature of 50 C. the content of aggregates increases by not more than 5% of their initial content in the solution.

    [0094] One embodiment involves an antibody with dissociation constant K.sub.D10.sup.9 M. Another embodiment involves an antibody of the invention that has an antibody-antigen interaction association constant kon(l/Ms)10.sup.5 l/Ms. One more embodiment of the invention involves an antibody that has a antigen-antibody dissociation constant dis(l/s)10.sup.4 l/s.

    [0095] In addition, the invention suggests an antibody fragment. This antibody fragment can be represented by a light chain, heavy chain, variable domains of the light and/or heavy chain that are a part of an antibody sequence, which includes a bio-specific antibody variant. Another embodiment of the invention involves an antibody fragment that is represented by a light chain, heavy chain, variable domains of the light and/or heavy chain that are parts of Fab. The antibody fragment of the invention may be represented by a light chain, heavy chain, variable domains of the light and/or heavy chain that are parts of scFv.

    [0096] In addition, the invention suggests the methods of production of antibodies of the invention. Said method of antibody production can involve phases selected from the following: directed mutagenesis, display methods, genetic engineering, biochemistry and high-performance biotechnology methods well known for the art, which can include the methods for directed mutagenesis in different positions of VHH domain of Camelidae antibodies.

    [0097] In addition, the invention provides a DNA construct encoding the antibodies claimed or fragments thereof, and an expression vector comprising one or several DNA constructs of the invention.

    [0098] Moreover, the invention suggests a cell line comprising said expression vector or DNA construct.

    [0099] In addition, the invention suggests the method of production of a humanized monoclonal antibody of fragment thereof, which involves the cell line culture in a culture medium under the conditions sufficient to obtain said antibody or fragment thereof, followed by the isolation and purification of obtained antibody or its active fragment.

    [0100] Moreover, the invention suggests the pharmaceutical composition that contains an antibody or fragment thereof in combination with one or several pharmaceutically suitable excipients, diluents or carriers. Details of the techniques for composition obtainment are described in special biotechnology guidelines, for example in [25].

    [0101] Another embodiment of the invention involves an antibody or fragment thereof within an active molecule that specifically binds to human IL-17A, wherein said antibody of fragment thereof comprises a derivative of Camelidae heavy chain variable domain (V.sub.HH) that comprises 3 hypervariable regions HCDR1, HCDR2 and HCDR3, wherein:

    [0102] HCDR1 comprising the amino acid sequence of SEQ ID NO: 1:

    [0103] G-T-F-A-T-X32-X33-X34-X35 (numbering according to Kabat index), wherein

    [0104] X32 is an amino acid selected from the group comprising S, N, K, R, E, W, Q, D, A, V and F;

    [0105] X33 is an amino acid selected from the group comprising P and S;

    [0106] X34 is an amino acid selected from the group comprising M and I;

    [0107] X35 is an amino acid selected from the group comprising G, N, S, A, L, I, R, V and Q;

    [0108] HCDR2 comprising the amino acid sequence of SEQ ID NO: 2:

    [0109] X50-I-X52-X52a-S-G-X55-D-R-I-Y-A-D-S-V-K-G, wherein

    [0110] X50 is an amino acid selected from the group comprising A, G and L;

    [0111] X52 is an amino acid selected from the group comprising S, D and E;

    [0112] X52a is an amino acid selected from the group comprising P and A;

    [0113] X55 is an amino acid selected from the group comprising G, S, T, L, R, D, E, K, A and W;

    [0114] HCDR3 comprising the amino acid sequence of SEQ ID NO: 3:

    [0115] C-A-X94-X95-X96-X97-F-X99-X100-X100a-X100b-X100c-X100d-X100e-X100f-D-Y-D-S, wherein

    [0116] X94 is an amino acid selected from the group comprising K, S, T, V, D and G;

    [0117] X95 is an amino acid selected from the group comprising R and K;

    [0118] X96 is an amino acid selected from the group comprising G, R, Y, H, D, W and K;

    [0119] X97 is an amino acid selected from the group comprising R, A, V, S, L and H;

    [0120] X99 is an amino acid selected from the group comprising D, E, G, A, R, V, K and Q;

    [0121] X100 is an amino acid selected from the group comprising G, S and N;

    [0122] X100a is an amino acid selected from the group comprising is an amino acid selected from the group comprising G, T, P, V, R, N and K;

    [0123] X100b is an amino acid selected from the group comprising V, S, T, L, Y, A, H, G and I;

    [0124] X100c is an amino acid selected from the group comprising Y, W and S; X100d is an amino acid selected from the group comprising R, V, L, Y, A, W, K, G, Q and I;

    [0125] X100e is an amino acid selected from the group comprising T, L, A and S;

    [0126] X100f is an amino acid selected from the group comprising T, L, G, P, N, A, Q, F, I and D;

    [0127] b) A variable domain of the light chain (V.sub.L) of a human antibody or a variable domain of the light chain of a humanized antibody.

    [0128] An alternative embodiment involves an antibody or fragment thereof that specifically binds human IL-17A and comprises a derivative of the heavy chain variable domain (V.sub.HH) comprising 3 hypervariable regions, wherein: HCDR1 comprising the amino acid sequence of G-T-F-A-T-S-P-M-G (SEQIDNO: 4);

    [0129] HCDR2, comprising the amino acid sequence of A-I-S-P-S-G-G-D-R-I-Y-A-D-S-V-K-G (SEQ ID NO: 5);

    [0130] HCDR3 comprising the amino acid sequence of C-A-V-R-R-R-F-D-G-T-S-Y-Y-T-G-D-Y-D-S(SEQIDNO: 6);

    [0131] b) A variable domain of the light chain (V.sub.L) of a human antibody or a variable domain of the light chain of a humanized antibody.

    [0132] An alternative embodiment involves an antibody that specifically binds human IL-17A and comprises a derivative of the heavy chain variable domain (V.sub.HH) comprising an amino acid sequence of SEQIDNO: 7 and

    [0133] A variable domain of the light chain (V.sub.L) of a human antibody or a variable domain of the light chain of a humanized antibody.

    [0134] An alternative embodiment involves an antibody or fragment thereof that specifically binds human IL-17A and comprises V.sub.HH-derivative, wherein said variable domain comprises an amino acid sequence at least 90% identical to SEQ ID NO: 7.

    [0135] An alternative embodiment involves an antibody that specifically binds human IL-17A and contains a V.sub.HH-derivative comprising the amino acid sequence of SEQ ID NO: 7; and a variable domain of the light chain (V.sub.L) of a human antibody comprising the amino acid sequence of SEQ ID NO: 8.

    [0136] An alternative embodiment involves an antibody or fragment thereof that specifically binds human IL-17A and comprises V.sub.HH-derivative and a variable region of the light chain (V.sub.L) of a human antibody wherein said variable domains comprise an amino acid sequence at least 90% identical to SEQ ID NO: 8.

    [0137] An alternative embodiment involves an antibody that specifically binds human IL-17A and contains the heavy chain comprising SEQ ID NO: 9 amino acid sequence, and the variable domain of a human antibody light chain (V.sub.L) comprising SEQ ID NO: 10 sequence. Another embodiment involves an antibody that specifically binds human IL-17A and contains the heavy chain and the light chain, wherein said chains comprise amino acid sequences at least 90% identical to SEQ ID NO: 9 and/or SEQ ID NO:10.

    [0138] An alternative embodiment involves an antibody of the invention that specifically binds human IL-17A, wherein said antibody has the binding affinity to human IL-17A characterized with KD of 10-10 M. Another embodiment involves an antibody that specifically binds human IL-17A, wherein the kinetic association constant kon(l/Ms) for human IL-17A is at least 105 l/Msec. Another embodiment involves an antibody that specifically binds human IL-17A, wherein the kinetic dissociation constant dis(l/c) for human IL-17A is not more than 10-5 l/sec. An alternative embodiment involves an antibody that specifically binds human IL-17A and inhibits the activity of human IL-17A by no less than 50% with respect to any parameter examined by any specific activity testing.

    [0139] An alternative embodiment involves an antibody that specifically binds human IL-17A, wherein said antibody is produced by mammalian, yeast or bacterial cells.

    [0140] An alternative embodiment involves an antibody that specifically binds human IL-17A and contains one or more additional amino acid substitutions in Fc-region compared to the native Fc, wherein said substitutions improve physical-chemical and pharmacokinetic properties of an antibody, as compared to an antibody with the native Fc, and do not result in the loss of antibody's ability to bind IL-17A.

    [0141] An alternative embodiment suggests a DNA construct encoding an antibody that specifically binds human IL-17A. Moreover, the invention suggests an expression vector comprising one or more DNA constructs encoding an antibody that specifically binds human IL-17A. In addition, a host cell was suggested comprising a vector for obtainment of an antibody that specifically binds human IL-17A.

    [0142] In addition, the invention suggests a method for the production of an antibody that specifically binds human IL-17A, characterized by culturing host cells comprising a DNA construct in a culture medium under conditions suitable to obtain said antibody or fragment thereof, and further isolation and purification of said antibody or active fragment thereof.

    [0143] Moreover, a pharmaceutical composition was suggested comprising an antibody that specifically binds human IL-17A, and one or more pharmaceutically suitable excipients, diluents or carriers. Said composition can comprise further active pharmaceutical ingredients selected from TNF- inhibitors. Said composition can be used in the treatment of an IL-17A-mediated disease or disorder. An IL-17A-mediated disease or disorder is selected from: rheumatoid arthritis, osteoarthritis, juvenile chronic arthritis, septic arthritis, Lyme arthritis, psoriatic arthritis, reactive arthritis, spondyloarthropathy, systemic lupus erythematosus, Crohn's disease, ulcerative colitis, inflammatory bowel disease, insulin dependent diabetes mellitus, thyroadenitis, asthma, allergic disorders, psoriasis, dermatitis, systemic sclerosis, graft-versus-host disease, graft rejection, acute or chronic immune disease associated with organ grafting, sarcoidosis, atherosclerosis, disseminated intravascular coagulation, Kawasaki disease, Graves' disease, nephrotic syndrome, chronic fatigue syndrome, Wegener's disease, Henoch-Schonlein purpura, microscopic polyangiitis with renal involvement, chronic active hepatitis, uveitis, septic shock, toxic shock syndrome, sepsis syndrome, cachexia, infections, invasions, acquired immune deficiency syndrome, acute transverse myelitis, Huntington chorea, Parkinson disease, Alzheimer disease, stroke, primary biliary cirrhosis, hemolytic anemia, malignancies, heart failure, myocardial infarction, Addison disease, polyglandular autoimmune syndrome type I and type II, Schmidt's syndrome, acute respiratory distress syndrome, alopecia, alopecia areata, seronegative arthropathy, arthropathy, Reiter's syndrome, psoriatic arthropathy, arthropathy associated with ulcerative colitis, enteropathic synovitis, arthropathy associated with Chlamydia, Yersinia and Salmonella, spondyloarthropathy, atheromatosis disease/coronary sclerosis, atopic allergy, autoimmune bullous disease, pemphigus, pemphigus foliaceus, pemphigoid, linear IgA diseases, autoimmune hemolytic anemia, Coombs positive hemolytic anemia, acquired pernicious anemia, juvenile pernicious anemia, Myalgic encephalomyelitis/chronic fatigue syndrome, chronic active hepatic inflammation, cranial giant arteritis, primary sclerosing hepatitis, cryptogenic autoimmune hepatitis, acquired immune deficiency syndrome (AIDS), AIDS-associated diseases, hepatitis B, hepatitis C, common variable immunodeficiency (common variable hypogammaglobulinemia), dilated cardiomyopathy, female sterility, ovarian insufficiency, Premature ovarian failure, pulmonary fibrosis, cryptogenic fibrosing alveolitis, post inflammatory interstitial lung pathologies, interstitial pneumonitis, connective tissue disease associated with interstitial lung disease, mixed connective tissue disease associated with interstitial lung disease, systemic scleroderma associated with interstitial lung disease, rheumatoid arthrisit associated with interstitial lung disease, systemic lupus erythematosus associated with lung disease, dermatomyositis/polymuositis associated with lung disease, Sjogren disease associated with lung disease, ankylosing spondylitis associated with lung disease, diffuse pulmonary vasculitis, hemosiderosis associated with lung disease, drug-induced interstitial lung disease, fibrosis, radiation-induced fibrosis, obliterating bronchiolitis, chronic eosinophilic pneumonia, lung disease with lymphocyte infiltration, post infectious interstitial lung pathologies, gouty arthritis, autoimmune hepatitis, autoimmune hepatitis type I (classic autoimmune or lupoid hepatitis), autoimmune hepatitis type II (associated with anti-LKM antibody), autoimmune hypoglycemia, type B insulin resistance with acanthokeratodermia, hypoparathyroidism, acute graft-associated immune disease, chronic graft-associated immune disease, osteoarthrosis, primary sclerosing cholangitis, type I psoriasis, type II psoriasis, idiopathic leukopenia, autoimmune neutropenia, NOS-kidney diseases, glomerulonephritis, microscopic renal polyangiitis, Lyme disease, discoid lupus erythematosus, idiopathic of NOS-male sterility, antisperm immunity, multiple sclerosis (all types), sympathetic ophthalmia, pulmonary hypertension secondary to connective tissue disease, Goodpasture syndrome, pulmonary manifestations of polyarteritis nodosa, acute rheumatic fever, rheumatoid spondylitis, Still's disease, systemic scleroderma, Sjogren's Syndrome, Takayasu disease/arthritis, autoimmune thrombocytopenia, idiopathic thrombocytopenia, autoimmune thyroid disorders, hyperthyroid, autoimmune hypothyroidism (Hashimoto disease), atrophic autoimmune hypothyroidism, primary myxedema, phacogenic uveitis, primary vasculitis, vitiligo, acute hepatic disease, chronic hepatic disease, alcoholic cirrhosis, alcohol-induced liver damage, cholestasis, idiosyncratic hepatic disease, drug-induced hepatitis, nonalcoholic steatohepatitis, allergies and asthma, group B streptococcal infection (GBS), mental disorders (including depressions and schizophrenia), Th1- and Th2-mediated disease, acute and chronic pain (various forms), malignancies such as lung cancer, breast cancer, stomach cancer, bladder cancer, colorectal cancer, pancreatic cancer, ovarian cancer, prostate cancer and hematopoietic malignancies (leukemia and lymphomas), abetalipoproteinaemia, acrocyanosis, acute and chronic infections and infestations, acute leukemia, acute lymphoblastic leukemia, acute myeloid leukemia, acute or chronic bacterial infection, acute pancreatitis, acute renal failure, adenocarcinoma, atrial ectopics, AIDS dementia complex, alcohol-induced hepatitis, allergic conjunctivitis, allergic contact dermatitis, allergic rhinitis, allograft rejection, alpha-I antitrypsin deficiency, lateral amyotrophic sclerosis, anemia, angina, anterior horn cell degeneration, anti-CD3 therapy, antiphospholipid syndrome, hypersensitivity reactions against receptors, aortic and peripheral aneurysms, aortic dissection, arterial hypertension, coronary sclerosis, arteriovenous fistula, ataxia, atrial fibrillation (constant or paroxysmal), atrial flutter, atrioventricular block, B-cell lymphoma, bone graft rejection, bone marrow transplant (BMT) rejection, bundle branch block, Burkitt lymphoma, burns, cardiac arrythmia, myocardial stunning syndrome, cardiac tumor, cardiomyopathy, inflammatory response to bypass, cartilage graft rejection, brain cortex degeneration, cerebellar disorder, chaotic or multifocal atrial tachycardia, chemotherapy-induced disorders, chronic myelocytic leukemia (CML), chronic alcohol addiction, chronic inflammatory pathologies, chronic lymphatic leukemia (CLL), chronic obstructive pulmonary disease, chronic salicylate intoxication, rectocolic carcinoma, congestive cardiac failure, conjunctivitis, contact dermatitis, pulmonary heart, coronary artery disease, Creutzfeldt-Jakob Disease, culture-negative sepsis, cystic fibrosis, cytokine therapy-induced disorders, boxer's encephalopathy, demyelinating disease, dengue hemorrhagic fever, dermatitis, dermatological conditions, diabetes, diabetes mellitus, diabetes-related atherosclerotic vascular disease, diffuse Lewy body disease, congestive dilated cardiomyopathy, basal ganglia disease, Down's syndrome in middle age, motor disorders induced by CNS dopamine blockers, drug sensitivity, eczema, encephalomyelitis, endocarditis, endocrinopathy, epiglottiditis, Epstein-Barr viral infection, erythralgia, extrapyramidal and cerebellar symptoms, familial hemophagocytic lymphohistiocytosis, fetal thymus graft rejection, Friedreich's ataxia, peripheral artery disease, fungal sepsis, gas phlegmon, gastric ulcer, glomerulonephritis, any organ or tissue graft rejection, gram negative sepsis, gram positive sepsis, granulomas due to intracellular organisms, hairy-cell leukemia, Hallervorden-Spatz disease, Hashimoto's thyroiditis, hay fever, heart transplant rejection, hemochromatosis, hemodialysis, hemolytic uremic syndrome/thrombotic thrombocytopenic purpura, bleeding, hepatitis (A), bundle branch arrhythmia, HIV-infections/HIV-neuropathies, Hodgkin disease, hyperkinetic motor disorders, hypersensitivity reactions, hypersensitivity-associated pneumonitis, hypertension, hypokinetic motor disorders, examination of hypothalamo-pituitary-adrenal axis, idiopathic Addison's disease, idiopathic pulmonary fibrosis, antibody-mediated cytotoxicity, asthenia, infantile muscular atrophy, aortal inflammation, influenza virus A, exposure to ionizing radiation, iridocyclitis/uveitis/optic neuritis, ischaemia/reperfusion-induced disorders, ischaemic stroke, juvenile rheumatoid arthritis, juvenile spinal muscular atrophy, Kaposi's sarcoma, renal transplant rejection, legionellosis, leishmaniasis, leprosy, corticospinal damage, lipoedema, liver transplant rejection, lymphoedema, malaria, malignant lymphoma, malignant histiocytosis, malignant melanoma, meningitis, meningococcemia, metabolic/idiopathic diseases, migraine, multiple system mitochondrial disorders, mixed connective-tissue disease, monoclonal gammapathy, multiple myeloma, multiple system degeneration (Mencel Dejerine-Thomas Shi-Drager and Machado-Joseph), myasthenia gravis, intracellular Mycobacterium avium, Mycobacterium tuberculosis, myelodysplastic syndrome, myocardial infarction, myocardial ischemic disease, nasopharyngeal cancer, neonatal chronic lung disease, nephritis, nephrotic, neurodegenerative disorders, neurogenic muscular atrophy I, neutropenic fever, non-Hodgkin's lymphomas, abdominal aortic branch occlusion, arterial occlusive disease, OKT3 treatment, orchitis/epididymitis, orchitis/vasectomy reversal operations, organomegaly, osteoporosis, pancreatic graft rejection, pancreatic carcinoma, paraneoplastic disease/tumor-related hypercalcemia, parathyroid graft rejection, pelvic inflammatory disease, perennial rhinitis, pericardial disease, peripheral atherosclerosis (atherlosclerotic) disease, peripheral vascular disease, peritonitis, pernicious anemia, Pneumocystis carinii pneumonia, POEMS syndrome (polyneuropathy, organomegaly, endocrinopathy, monoclonal plasma-proliferative disorder and skin changes), postperfusion syndrome, pump head syndrome, post-cardiotomy post-infarction syndrome, preeclampsia, progressive supranuclear paralysis, primary pulmonary hypertension, radiation therapy, Raynaud's phenomenon and disease, Raynoud's disease, Refsum's disease, regular narrow QRS tachycardia, renal vascular hypertension, reperfusion injury, restrictive cardiomyopathy, sarcoma, scleroderma disease, senile chorea, Dementia with Lewy bodies, seronegative arthritis, shock, sickle cell disease, skin allograft rejection, skin changes, small intestinal graft rejection, solid tumors, specific arrhythmias, spinal ataxia, spinocerebellar degradations, streptococcal myositis, cerebellar structural damage, subacute sclerosing panencephalitis, syncope, cardiovascular syphilis, systemic anaphylaxis, a comprehensive systemic inflammatory response syndrome, systemic-onset juvenile rheumatoid arthritis, T cells or FAB ALL, telangiectasia, thrombosis obliterans, thrombocytopenia, toxicity, grafting, trauma/bleeding, hypersensitivity reactions type III, hypersensitivity reactions type IV, unstable angina, uremia, urinary sepsis, urticaria, valvular heart disease, varicose veins, vasculitis, venous diseases, venous thrombosis, ventricular fibrillation, viral and fungal infections, vital encephalitis/aseptic meningitis, vital hemophagocytic syndrome, Wernicke-Korsakoff syndrome, Wilson's disease, heterograft rejection for any organ or tissue, acute coronary syndrome, acute idiopathic polyneuritis, acute inflammatory demyelinating radicular neuropathy, acute ischemia, adult-onset Stills disease, alopecia areata, anaphylaxis, antiphospholipid antibody syndrome, aplastic anemia, coronary sclerosis, atopic eczema, atopic dermatitis, autoimmune dermatitis, autoimmune disorder associated with streptococcus infection, autoimmune enteropathy, autoimmune hearing loss, autoimmune lymphoproliferative syndrome (ALPS), autoimmune myocarditis, autoimmune premature ovarian failure, blepharitis, bronchiectasis, bullous pemphigoid, cardiovascular disease, catastrophic antiphospholipid syndrome, celiac disease, cervical spondylosis, chronic ischemia, cicatrical pemphigoid, clinically isolated syndrome (cis) with the risk for multiple sclerosis, conjunctivitis, childhood-onset mental disorders, chronic obstructive pulmonary disease (COPD), dacryocystitis, dermatomyositis, diabetic retinopathy, diabetes mellitus, herniated disk, prolapse of intervertebral disc, drug-induced immune haemolytic anaemia, endocarditis, endometreosis, entophthalmia, episcleritis, erythema multiform, severe erythema multiform, gestational pemphigoid, Guillain-Barre syndrome (GBS), hay fever, Hughes syndrome, idiopathic Parkinson's disease, idiopathic interstitial pneumonia, IgE-mediated allergy, autoimmune hemolytic anemia, inclusion body myositis, infectious ocular inflammatory disease, inflammatory demyelinating disease, inflammatory heart disease, inflammatory kidney disease, idiopathic pulmonary fibrosis/usual interstitial pneumonia, iritis, epaTcustom-characterTa, keratitis, keratoconjunctivitis sicca, Kussmaul disease or Kussmaul-Meier Disease, Landry palsy, Langerhans' cell histiocytosis, marbled skin, macular degeneration, microscopic polyangiitis, Bechterew disease, motor neuron disease, mucosal pemphigoid, multiple organ failure, myasthenia gravis, spinal cord dysplasia syndrome, myocarditis, nerve root disorders, neuropathy, non-A, non-B hepatitis, optic neuritis, osteolysis, ovarian cancer, oligoarticular JIA, peripheral arterial occlusive disease, peripheral vascular disease, peripheral artery disease (PAD), phlebitis, polyarteritis nodosa, polychondritis, polymyalgia rheumatica, poliosis, polyarticular juvenile idiopathic arthritis, multiple endocrine deficience, polymyositis, polymyalgia rheumatica (PMR), post pump syndrome, primary parkinsonism, prostate and rectal cancer and hematopoietic malignancies (leukemia and lymphoma), prostatitis, pure red-cell aplasia, primary adrenal insufficiency, relapsing neuromyelitis optica, restenosis, rheumatic heart disease, SAPHO (synovitis, acne, pustulosis, hyperstosis and osteitis), sclerodermia, secondary amyloidosis, shock lung, scleritis, ischias, secondary adrenal insufficiency, silicon-associated connective tissue disease, Sneddon-Wilkinson disease, ankylosing spondylitis, Stevens-Johnson syndrome, systemic inflammation response syndrome, cranial arteritis, Toxoplasma rhinitis, toxic epidermal necrolysis, transverse myelitis, TRAPS (tumor necrosis factor receptor-associated periodic syndrome), allergic reactions type I, diabetes type II, urticaria, usual interstitial pneumonia, vasculitis, vernal conjunctivitis, viral retinitis, Vogt-Koyanagi-Harada syndrome (VKH syndrome), wet macular degeneration, wound healing, and Yersinia- or Salmonella-associated arthropathy.

    [0144] A pharmaceutical composition comprising an antibody that specifically binds human IL-17A can be administered in a therapeutically effective amount to treat an IL-17A-mediated disease or disorder.

    [0145] An invention suggests a method for the treatment of an IL-17A-mediated disease or disorder using an antibody that specifically binds human IL-17A. The treatment method can involve further administration of TNF- inhibitors.

    [0146] Further examples demonstrate the present invention, yet are not intended to limit the present invention to those examples per se.

    [0147] Description of the present application includes the references to all information sources.

    EXAMPLES

    Example 1

    The Flowchart for Obtainment of VHH-Based Antibodies

    [0148] FIG. 1 demonstrates the flowchart for obtainment and optimization of VHH-based antibody.

    Example 2

    Producing Recombinant Antigens and Antibodies in Suspension Mammal Cell Culture

    [0149] Antibodies and antigens were generated in established cell line obtained from Chinese hamster ovary cells (CHO-K1) according to published protocols [26; 27]. Cells constitutively expressing the gene of EBNA1 protein (Epstein-Barr virus nuclear antigen 1) were used. Suspension culture was conducted in flasks on orbital shaker using serum-free media from Life Technologies Corporation and in accordance with manufacturer's guidelines. For transient expression, cells in a concentration of 2*10.sup.6/m1 were transfected by means of linear polyethyleneimine (PEI MAX, Polysciences). DNA/PEI ratio was 1:3-1:10. In 5-7 days after transfection, cell culture was centrifuged under 2000 g for 20 min and filtered through 0.22 m filter. Target proteins from culture liquid were isolated by affine HPLC.

    [0150] Recombinant IL-17A protein containing 6 His amino acids in C-terminal region was isolated and purified from culture liquid on Profinity IMAC Ni-charged resin (Bio-Rad). Prior to purification procedures, NiCl.sub.2 was added to culture liquid to a concentration of 1 mM. Then 5 ml of Profinity IMAC Ni-charged was added to culture liquid and mixed on a shaker for 1 h at room temperature. Sorbent was transferred to 5 ml Thermo scientific Polypropylene columns and washed with 5 column volumes of PBS to remove non-specifically bound components. Bound antigen was eluted with 0.3 M imidazole (pH 8) and 150 mM NaCl. Then the protein was dialyzed into PBS (pH 7.4) by means of SnakeSkin Dialysis Tubing technique, filtered (0.22 m), transferred into tubes and stored at 70 C. Purity of the protein obtained was evaluated by SDS-PAGE (FIG. 2).

    [0151] Test and control IgG1 antibodies were purified on 1 ml Hi Trap rProteinA FF column (GE Healthcare) in accordance with the procedure aforementioned for IL-17A-Fc. Purity of the protein obtained was evaluated by SDS-PAGE (FIG. 2).

    Example 3

    Llama Immunization with Human IL-17a and Generation of Fab-Library of Phage-Displayed Llama Antibodies

    [0152] Lama Glama was immunized 5 times in succession by means of subcutaneous administration of antigen material mixed with an equal volume of complete (first injection) or incomplete Freund's adjuvant (all injections except for the first one). A mixture of recombinant proteins (0.2 mg of each protein per injection) one of which was human IL-17A (Kit from R&D Systems) was used as an antigen. Second injection (immunization stage) was performed 3 weeks after the first one; three more immunizations were performed with a 2-week interval. Blood samples (50 ml) were collected 5 after each injection starting from the third one.

    [0153] Drawn blood was 2-fold diluted with PBS containing 1 mM EDTA. Then 35 ml of diluted blood were layered over 15 ml of Histopaque-1077 medium (Sigma, density of 1.077 g/ml) and centrifuged for 20 min under 800 g. Mononuclear cells (lymphocytes and monocytes) were selected from plasma/Histopaque medium interphase zone and washed with PBS containing 1 mM EDTA.

    [0154] Total RNA from mononuclear llama cells was isolated using RNeasy Mini Kit in accordance with the protocol (QIAGEN). RNA concentration assay was performed using Nanovue (GE Healthcare); the quality of isolated RNA was tested by means of 1.5% agarose gel electrophoresis.

    [0155] Reverse transcription reaction was conducted using MMLV RT kit (Evrogen) according to the recommended protocol with MMuLV reverse transcriptase and random hexamer primers.

    [0156] Reverse transcription products were used as a matrix in a two-stage polymerase chain reaction to obtain the genes of variant domains flanked with restriction sites; reaction was performed using oligonucleotide kit and protocols by [27; 28; 29]. Further, genes encoding variable domains of the light and heavy chains were put together in one fragment by means of sequential reactions of restriction, ligation and amplification as shown in FIG. 3. Heavy chain genes were attached separately to kappa and lambda light chain genes. In this case, the estimated count of matrix molecules in all reactions was no less than 10.sup.11. The DNA product obtained (VL-CK-VH) was treated with NheI/Eco91I restriction enzymes and ligated into original phagemid pH 5. Phagemid structure is presented in FIG. 4. Ligation products were transformed into SS320 electrocompetent cells prepared in accordance with protocols [30]. The repertoire of constructed kappa and lambda Fab libraries was 5.1*10.sup.8 and 3.7*10.sup.8, respectively. The product of nave phage-display library was prepared in accordance with the earlier described procedure [31].

    Example 4

    Selection of Fab-Libraries of Phage-Display Antibodies

    [0157] Specific anti-IL17A phage-display Fab-antibodies were selected from a phage Fab-display library using a recombinant human IL-17A (a kit from R&D Systems); a series of selection cycles was performed as was described above [27; 31; 32]. To perform the selection process by panning method, human IL-17A in 50 mM carbonate buffer (pH 9.5) was adsorbed overnight at 4 C. on the surface of HighSorb tubes (Nunc). Further, tubes were washed with PBS (pH 7.4) and then blocked with solution containing PBS (pH 7.4)fat-free milk (0.5% weight/volume) for 1 hour. Then, 2-4 ml of phage solution (10.sup.12 phage particles per ml) in PBS (pH 7.4)fat free milk (0.5% w/vol) were transferred to the tube with the antigen, and the system was incubated for 1 h under stirring. Unbound phages were removed by a series of washing cycles with PBS (pH 7.4)Tween 20 (0.1% vol./vol.). The number of washing cycles was increased from the first round to the third one20-30-40 times, respectively. Phage particles that remained bound were eluted with 100 mM Gly-HCl solution (pH 2.5) during 15 min under stirring, and then neutralized with 1 M TRIS-HCl (pH 7.6). E. coli TG1 bacteria were infected with phages obtained; further, phages were isolated and used in the next cycle.

    [0158] After the second and third round of selection, ELISA performed for the polyclonal phage product has shown the significant enrichment. Pooled clones enriched with human Fab were re-cloned to expression plasmid LL comprising myctag and His6 tag on C-terminus of CH1gene of the heavy chain.

    Example 5

    Analysis of Fab Specific Binding with Human IL-17A

    [0159] ELISA was used to measure the binding of studied Fab-fragments with human IL-17A. Fab with published AIN457 sequence (Novartis) was used as a positive control. ELISA plate wells (Nunc ImmunoMaxisorp) were coated with 50 l (0.5 g/ml in 1 coating carbonate buffer) IL-17A-Fc, hermetically closed and incubated overnight at 4 C. All further stages were conducted in accordance with the standard ELISA protocol with high-performance systems such as GenetixQ-pix2xt (Molecular Devices) and Tecan Freedom EVO 200 (Tecan). Non-specific binding was blocked by adding the blocking buffer BB (200 l 0.5% fat-free milk in PBS). Plates were incubated on a shaker for 1 h at room temperature. After washing with PBS-Tween, each cell was coated with 50 l of test Fab-containing cell supernatant mixed with the equal volume of BB. Plates were incubated on a shaker for 1 hour at room temperature; further, each plate well was 5 times washed with PBS-Tween buffer. After washing, each well was coated (50 l/well) with anti-human Fab HRP-conjugated secondary antibody (Pierce-ThermoScientific) in PBS-Tween (1:5000). Plates were transferred to rotation shaker (50 min at room temperature) and then 5 times washed with PBS-Tween buffer as described above. Colorimetric signal was obtained by adding TMB (100 l/well) until saturated (average of 3-5 min); further color development was blocked by adding the stop solution (100 l/well, 10% sulfuric acid). Absorbance was measured at 450 nm using an appropriate Tecan-Sunrise plate reader (Tecan). Antibody binding was proportional to the signal produced. Those clones for which the color signal exceeded the baseline signal by more than 5 times were tested in competitive ELISA in order to reveal antagonistic Fab blocking the interaction between IL-17A ligand and receptor.

    Example 6

    Competitive ELISA of Blocking the Interaction of IL17A Ligand and IL17R Receptor

    [0160] Competitive ELISA technique was used to test the antagonistic capacity of previously selected Fab specific against human IL-17A. Fab with published AIN457 sequence (Novartis) was used as a positive antagonist control. Wells ELISA plate (Nunc Immuno Maxisorp) were covered with 50 l/well IL-17RA-Fc receptor (R&D Systems; 1 g/ml solution in 1 coating carbonate buffer) and incubated overnight at 4 C. All further stages were performed in accordance with standard ELISA protocols with high-performance systems such as GenetixQ-pix2xt (Molecular Devices) and Tecan Freedom EVO 200 (Tecan). Non-specific binding was blocked by adding the blocking buffer BB (200 l 0.5% fat-free milk in PBS). Plates were incubated for 1 hour on a shaker at room temperature.

    [0161] In parallel, 50 l of test Fab-containing cell supernatant in non-binding 96-well plate were mixed with 50 l of IL-17A-His6-Flag (0.4 g/ml in 1% milk diluted with PBS-Tween). The plate was incubated for 1 hour at 37 C. on a shaker under 500 rpm.

    [0162] After the plate containing IL-17RA-Fc receptor was washed of BB solution, it was coated with the reaction mixture of Fab and IL-17A-His6-Flag in the amount of 90 l per well. Plates were incubated under shaking for 45 min at room temperature, and each well was 5 times washed with PBS-Tween buffer. Further, 50 l/well of 1 g/ml anti-FLAG murine M2 antibody (Sigma) were added, and plates were incubated for 45 min at room temperature. After incubation, each plate well was 5 times washed with PBS-Tween then was coated with 50 l/well of antimurine-IgG HRP-conjugated secondary antibody (Pierce-ThermoScientific) 1:5000 diluted with PBS-Tween. Plates were incubated on rotation shaker for 45 min at room temperature and 5 times washed with PBS-Tween, as mentioned above. Colorimetric signal was obtained by adding TMB (100 l/well) until saturated (average of 3-5 min); further color development was blocked by adding the stop solution (100 l/well, 10% sulfuric acid). Absorbance was measured at 450 nm using an appropriate Tecan-Sunrise plate reader (Tecan). Antibody binding was proportional to the signal produced.

    [0163] Those clones that demonstrated blocking at the level corresponding to that of control Fab antibody AIN457 were marked as positive and used in further tests. Genes of the variable domains of positive clones were subject to sequencing in accordance with standard protocols on Applied Biosystems 3130 Genetic Analyzer (Applied Biosystems) followed by appropriate analysis. Clones comprising 3 VHHFab variable domain were selected for further studies (FIG. 5B). In addition, it was found that 3VHHFab clone is represented in combination with 23 light chain domains of various sequences, three of which are shown in FIG. 5B. This indicates its relative structural resistance and the fact that VHH domain particularly, rather than the light chain, contributes to IL-17A binding.

    Example 7

    Comparative k.SUB.off.(k.SUB.diss.)-Screening of Anti-IL-17A VHHFab Candidates

    [0164] Comparative k.sub.off screening for anti-IL-17A Fab-candidates was performed using Pall Forte Bio Octet Red 96 system. Anti-FABCH1 biosensors were rehydrated for 30 min in a working buffer comprising 10 mM PBS (pH 7.2-7.4), 0.1% Tween-20 and 0.1% BSA. 10 working buffer was added to test samples of E.coli supernatants up to 1 final concentration. Then anti-FABCH1 biosensors were steeped into E.coli supernatants containing Fab-fragments of candidate antibodies and incubated for 12 hours at a temperature of 4 C. Sensors coated with Fab-fragments were transferred to wells with working buffer, and a baseline was registered (60 sec). Then sensors were transferred to wells with analyte solution (IL-17A, 30 g/ml) to achieve the antigen-antibody association (300 sec). After that, sensors were returned into wells with working buffer for further dissociation (300 sec). Used sensors were subject to regeneration after each test: they were three times placed into regenerating buffer (Gly-HCl, pH 1.7) and then were applicable for use in further experiments. The curves obtained were analyzed using Octet Data Analysis (version 7.0) according to the standard procedure with 1:1 interaction model.

    [0165] Results obtained for k.sub.off-screening of anti-IL-17A Fab candidates are presented in FIG. 5C and Table 1. Specific and high-affine binding of all unique VHHFab with human IL-17A was demonstrated, wherein 3VHHFab showed very fast k.sub.on and very slow k.sub.dis(l/c) that was beyond the detection limit of the apparatus.

    TABLE-US-00001 TABLE 1 VHHFab affinity to human IL-17A K.sub.D (M) k.sub.on(1/Mc) k.sub.dis(1/c) 1VHH 2.485E08 2.498E04 6.206E04 2VHH 1.352E08 1.628E05 2.201E03 3VHHVK4B11 <2.272E06

    [0166] Thus, based on the analytical results obtained, 3VHHVK4B11 candidate was selected for further investigation.

    Example 8

    Generation of VHHIgG1 Antibodies with Mutations in FR1 and FR2 of VHH Variable Domain

    [0167] Genes of the variable domain of the light and heavy VHH chains of 3VHHVK4B11 candidate were cloned in pEE-Hccustom-characterpEE-Lc plasmid for joint transient expression in CHO-EBNA cells as described in Example 3. Further, substitutions at positions 44 and 45 (Kabat numbering scheme) were introduced by means of oligonucleotide-directed mutagenesis using PfuUltraHS polymerase (Stratagene) in accordance with Protocol [Q5 Site-Directed Mutagenesis Kit (NEB)] and procedure described in [34]. Plasmid pEE-3VHH was used as a matrix. PCR products were fractioned on low-melting agarose and purified on appropriate columns. After ligation, DNA was transformed to E.coli. Upon selection of mutant clones with correct sequences, plasmids with mutations in 3VHH were co-transfected with pEE-LcVK4B11 (refer to FIG. 6Aa and Table 2).

    TABLE-US-00002 TABLE 2 Samples of 3VHHFabVK4B11 mutant clones Name Mutations compared to initial 3VHHFabVK4B11 mut1 E44G, R45L mut2 S11L, E44G, R45L mut3 R45L mut4 S11L, E44G

    Example 9

    Comparative Analysis of Kinetic Parameters of VHHFab Antibodies Comprising Mutations in FR1 and FR2 of VHH Variable Domain

    [0168] Comparative k.sub.off(screening for anti-IL-17A VHHFab candidates was performed according to the standard protocol using Pall Forte Bio Octet Red 96 system (refer to Example 8). The significant reduction of k.sub.off was found for mut1, mut2 and mut4, and less significant reductionfor mut3, as compared to the native 3VHHFab (FIG. 6B).

    Example 10

    Comparative Analysis of Thermal-Aggregation Characteristics of Full-Size 3VHHIgG1VK4B11 Antibodies Comprising Mutations in FR1 and FR2 of VHH Variable Domain

    [0169] Comparative analysis of aggregation characteristics for anti-IL-17A VHHIgG1 candidates was performed using the following procedure. The preparation of VHHIgG1 antibody (10 mg/ml) in PBS buffer was heated for 6 hours at 50 C. Aggregation induced by thermal stress was evaluated by means of size-exclusion HPLC. The test was performed on 1100 HPLC System (Agilent) using Tosoh TSK-Gel G3000SWXL column, 7.8 mm30 cm, Cat. No. 08541 with Tosoh TSKgel Guard SWXL pre-column, 6.0 mm4.0 cm, cm (particles of 7 m, Cat. No. 08543). Isocratic elution with mobile phase containing 50 mM sodium phosphate buffer and 0.3 M NaCl (pH 7.0) was performed under 0.5 ml/min flow rate with the detection at 214 nm and 280 nm wavelengths. Antibody samples were diluted with PBS (pH 7.5) to a concentration of 1 mg/ml. Injection volume was 10 l. Gel filtration standard mixture (Bio-Rad, Cat. No. 151-1901) was used to calibrate the column prior to the test.

    [0170] Chromatograms presented in FIG. 6C and the summary Table 3 demonstrate that all mutants aggregate to various extents under the thermal stress, wherein the minimum stability was observed for the native variant and the maximum stability was revealed for mut1 comprising E44G+R45L substitutions typical for the classical VH structure.

    [0171] In addition, comparative study of thermal stability of obtained preparations was performed using Thermofluor procedure (also referred to as Thermal shift assay) that determines the protein melting point measuring the changes in the fluorescence of a specific dye SYPROOrange that binds to hydrophobic surfaces of unfolded protein [35]. StepOneReal-TimePCRSystem (Applied Biosystems) apparatus and recommended protocol were used to study the mutant products. The study results are shown in Table 3. They rather correlate to the results obtained in the thermal stress test, which confirms the stability of mut1 and mut4 in comparison to the wild 3VHHIgG1VK4B11.

    TABLE-US-00003 TABLE Thermal stability study of mutants Monomer Monomer percentage percentage (%) before (%) after Melting point thermal thermal Difference (Thermofluor), Product stress stress ~% C. Wild 60 13 47 46 1 3VHHIgG1 VK4B11 mut1 95 95 0 64 1 mut2 65 13 52 42 1 mut3 40 32 8 ND mut4 89 80 9 53 1

    Example 11

    Cell Test of Anti-IL17A 3VHHIgG1VK4B11 Mutants Blocking the Ability of IL-17A to Induce IL-6 Production

    [0172] The ability of IL-17 to induce the production of IL-6 by human HT1080 cells (ATCC:CCL-121) was used to analyze the neutralizing activity of VHHIgG1 candidates mut1 and mut4 regarding human recombinant IL-17A. Cells were grown on DMEM culture medium with added 10% inactivated fetal serum, gentamycin and glutamine Aliquots of 5*10.sup.4 cells/well were seeded in 96-well culture plates. Cells were allowed to adhere for 5 hours. The mixture of 40 ng/ml recombinant IL-17 and 20 ng/ml TNF- was incubated with VHHIgG1 dilutions for 1 hour at 37 C. Then cytokine/antibody mixture was added to the cells and left overnight. The production of IL-6 by HT1080 cell culture was proportional to the amount of IL-17 added. The amount of released IL-6 in cell supernatant samples was evaluated by ELISA technique using DuoSet ELISA Development System Human IL6 (RD System, Cat. No. DY206). Results obtained from evaluation of antagonistic properties of VHHIgG1 candidates are presented in FIG. 7 in comparison with AIN457 (anti-IL-17A antibody by Novartis). The IC.sub.50 value for mut1 was almost 30 times higher than that for the native variant, while mut4 variant almost completely maintained its inhibiting capacity. The value of IC.sub.50 for mut4 candidate was 3010 pM. Based on the results obtained in the present study and the overall physical-chemical and biological characteristics, said candidate was selected for further development and optimization.

    Example 12

    Engineering of mut4VHHFab Antibodies Comprising Human Light Chains

    [0173] Total RNA of B-lymphocytes collected from 55 human donors was isolated using RNeasy Mini Kit in accordance with appropriate protocol (QIAGEN). RNA concentration was measured using Nanovue kit (GE Healthcare), and the quality of isolated RNA was tested by 1.5% agarose gel electrophoresis.

    [0174] Reverse transcription reaction conducted using MMLV RT kit (Evrogen) according to the recommended protocol with MMuLV reverse transcriptase and random hexamer primers.

    [0175] Reverse transcription products were used as a matrix in a two-stage polymerase chain reaction to obtain the genes of variant domains flanked with restriction sites; reaction was performed using oligonucleotide kit and protocols described in [27]. Chimeric Fab specific against IL-17A were generated according to the procedure described in WO93/06213 based on phagemid pHS, as specified above. Genes encoding variable domains of the human light chains and genes encoding the variable domain of mut4VHH were put together in one fragment by means of sequential reactions of restriction, ligation and amplification as shown in FIG. 8. In this case, the estimated count of matrix molecules in all reactions was no less than 10.sup.12. The DNA product obtained (VL-CK-VH) was treated with NheI/Eco91I restriction enzymes and ligated into original phagemid pH 5. Ligation products were transformed into SS320 electrocompetent cells prepared in accordance with protocols described in [30]. The repertoire of chimeric mut4 VHH Fab-library based on mixed kappa and lambda human chains was 2.8*10.sup.9 transformants. Chimeric phage-displayed Fab-libraries were prepared in accordance with the procedure described above [27].

    [0176] Selection of phage-displayed chimeric Fab-libraries was performed under the conditions described above (refer to Example 5), except for additional incubation of IL17A-bound phage antibodies in the presence of 20 g/ml dissolved IL-17A at a temperature of 37 C. for 12 hours.

    [0177] After the second round of selection on IL-17A, significant enrichment of the library was observed. Obtained pooled clones of enriched chimeric mut4 VHH Fab-libraries were used in the screening for IL-17A according to the standard protocol (refer to Example 6). Final positive clones were subject to sequencing. FIG. 8B shows four sequences of the variable domains of human light chains VK1A7, VK3c18, VK3c118 and VK4c1E12 from high-affinity mut4 VHHFab. These sequences belong to different kappa human germ lines VK1, VK3 and VK4 comprising the minimum number of somatic mutations. It should be noted that human sequence VK4clE12 shows high homology to the previously selected llama light chain VK4B1, yet has characteristic distinctions.

    Example 13

    [0178] Comparative analysis of thermal-aggregation characteristics of full-size mut4VHHIgG1 antibodies comprising various light chain variants

    [0179] Genes of the variable domain of the heavy VHH chains of mut4 VHH candidate were cloned in pEE-Hc plasmid, and genes of variable domains of human light chains VK1A7, VK3c18, VK3c118, VK3A4 and VK4E12 were cloned in pEE-Lc plasmid for the joint transient expression in CHO-EBNA cells, as described in Example 3. Further, the obtained antibodies were exposed to the thermal stress and their aggregation profile was investigated as shown in Example 9. Results obtained are presented in a summary tabulation (Table 4).

    TABLE-US-00004 TABLE 4 Thermal stability of mut4 VHHIgG1 full-size antibodies % Formation Structural Monomer % Monomer of visible family of before the after the aggregates Melting the light thermal thermal Difference during the point Sample name chain stress stress ~% purification (Thermofluor) mut4VHHIgG1 VK3 96 82 14 + 58 C. VK3c8 mut4VHHIgG1 VK3 91 81 10 ++ 61 C. VK3c18 mut4VHHIgG1 VK3 71 69 2 + 61 C. VK3A4 mut4VHHIgG1 VK1 95 88 7 63 C. VK1A7 mut4VHHIgG1 VK4 90 49 41 ++ 59 C. VK4E12

    [0180] In addition, the comparative thermal stability study of products obtained was conducted using Thermofluor procedure similar to that described in Example 11. Based on the data obtained, the conclusion can be made that the selected mut4VHH pairs comprising human light chains were more stable than the native variant comprising VVK4B11 llama light chain. Thus, in the comparative study the best aggregation stability parameters were demonstrated for mut4 VHHIgG1VK1A7 and mut4 VHHIgG1VK3c18 combinations.

    Example 14

    Cell Test of Blocking the Ability of IL-17A to Induce IL-6 Production Using Mut4 VHHIgG1VK3c8 and Mut4 VHHIgG1VK1A7

    [0181] The ability of IL-17 to induce the production of IL-6 by human HT1080 cells (ATCC:CCL-121) was used to analyze the neutralizing capacity of VHHIgG1 candidates mut4 VHHIgG1VK3c8 and mut4 VHHIgG1VK1A7 regarding human recombinant IL-17 (refer to Example 12). FIG. 9 shows the results obtained for the blocking test. It should be noted that mut4 VHHIgG1VK1A7 variant (characterized by maximum stability) demonstrated the significant drop of IC.sub.50 value, while mut4 VHHIgG1VK3c8 variant (medium stability) has demonstrated the inhibition several times exceeding that observed for more stable mut4 VHHIgG1VK1A7 variant.

    Example 15

    Engineering of Mut4 VHHIgG1 Full-Size Antibodies Comprising Various Mutations at Positions 44 and 45 in FR2 of VHH Variable Domain, and Comparative Analysis of Aggregation and Functional Characteristics Thereof

    [0182] For the purpose of further improvement of the aggregation stability, the method of oligonucleotide-directed mutagenesis was used to introduce substitutions at positions 44 and 45 in the FR2 region of VHH for mut4 VHHIgG1VK3c8 candidate (hereafter referred to as m4VHHc8). The study did not include the variants with aromatic, aliphatic or positive amino acids at position 44, as they are potentially immunogenic and structurally forbidden. Mutants were transiently expressed as described in Example 3 (FIG. 8). Yet the amount of the product for different mutants varied from one experiment to another, it should be noted that yields within the same experiment were of comparable size for all substitutions. Obtained mutant variants were exposed to the thermal stress. Table 5 demonstrates the results obtained for different mutants. It can be seen that the less stable mutants are 44G45G and 44G45D the stability of which is lower than that for the initial 44G45R combination within m4VHHc8. Such variants as 44G45N, 44V45T, 44D45T, 44T45T and 44D45V significantly remained their stability. All other combinations demonstrated the adding effect that resulted in the increased aggregation stability of m4VHHc8, and the most stable were the variants comprising aromatic or aliphatic groups at position 45. However, the variants comprising small hydrophilic and hydrophobic amino acids at both positions, such as 44G45V, 44G45T, 44V45V, 44A45V, 44T45V, 44A45T and 44S45T, has also demonstrated the significant stability.

    TABLE-US-00005 TABLE 5 Results obtained for the transient expression and thermal stress study of mutants comprising substitutions at positions 44 and 45 of FR2 region of m4VHHc8. Mutant at Production yield position for the product** IC50, 44 + 45 of FR2 (HOMep picomole*** as region of Monomer. %, Monomer. %, custom-character ) defined by the No. m4VHHc8 initial* heated* ~% , mg/L cell IL6 test 1 44G 45R 96 81 15 41 (1) 50 2 44G 45F 98 98 0 22 (3) 1100 3 44G 45W 97 97 0 57 (2) 1200 4 44G 45Y 97 97 0 33 (2) 650 5 44G 45P 98 98 0 41 (1) 800 6 44G 45I 97 97 0 20 (3) 950 7 44G 45 L 97 97 0 25 (3) 1000 8 44G 45G 96 50 46 21 (3) ND 9 44G 45N 90 77 13 26 (2) ND 10 44G 45S 93 85 8 45 (2) 100 11 44G 45D 90 40 50 23 (3) ND 12 44G 45A 93 89 4 27 (3) 100 13 44G 45H 93 93 2 25 (3) 150 14 44G 45V 93 93 0 35 (1) 250 15 44G 45Q 91 84 7 36 (1) ND 16 44G 45T 93 93 0 46 (1) 100 17 44V 45T 95 84 11 64 (4) ND 18 44D 45T 95 83 12 72 (4) ND 19 44T 45T 96 86 10 75 (4) 150 20 44A 45T 95 93 2 74 (4) 150 21 44S 45T 96 94 2 63 (4) 150 22 44V 45V 95 95 0 71 (4) 150 23 44D 45V 96 88 12 28 (4) 150 24 44A 45V 95 95 0 72 (4) 100 25 44T 45V 96 95 1 73 (4) 150 26 AIN457 95 95 0 0 1100 *Error in different batches is up to 5% **Varies significantly depending on the experiment; more correct comparison is provided for products within the same batch ***Error in different batches is up to 50%

    [0183] To evaluate the neutralizing activity in the cell test as described in Example 12, experiments were performed with various mutants (FIG. 11). Test results are shown in Table 5. It was shown that the small amino acids at VHH FR2 positions 44 and 45 demonstrated high antagonistic activity, while the large ones (aliphatic and aromatic) introduced at position 45 resulted in 10-fold reduction of IC.sub.50. FIG. 12 presents the diagram of stability and functional properties for mutants comprising various amino acid substitutions that determine the interaction of the variable domain of the heavy and light chains.

    Example 16

    Scanning Mutagenesis of CDRs antiIL17A 3VHH Domain

    [0184] Mutations to individual positions of candidate's CDRs were inserted by means of NNK randomization technique [26] using Q5 Site-Directed Mutagenesis Kit (NEB) in accordance with the protocol. Plasmid pLL-Fab was used as a matrix. PCR products were fractioned on low-melting agarose and purified on appropriate columns After ligation, DNA was transformed to E.coli expression strain BL21gold (Stratagene). The individual clones obtained were then gained by Fab expression in 96-well plates, as described above. Supernatants containing mutant Fab arms were analyzed by ELISA under the conditions described above and using the high-performance Genetix Q-pix2xt and Tecan Freedom EVO200 systems. The concentration of immobilized IL-17A was 0.2 g/ml. Bound Fab arms were stained with 1:5000 diluted Goat anti-Human IgG (Fab)2 (HRP) conjugate (Pierce) and TMB+H2O2/H2SO4 dye; absorption was measured at 450 nm wavelength.

    [0185] Results obtained by scanning mutagenesis are presented in Table 6. The Table shows within-CDR substitutions that correspond to 30% reduction of mutant Fab/human II-17A binding signal when compared to the wild type sequence. Thus, such individual mutants or any combinations thereof are the field of the invention.

    TABLE-US-00006 TABLE 6 Scanning mutagenesis Mutation position Positive amino acids in mutants HCDR3 V94 S, T, A, K, D, G R95 K R96 Y, H, W, K, D, G R97 A, L, M, S, H, V F98 D99 E, G, A, R, V, K, Q G100 N, S T100a G, P, V, R, S, N, K S100b V, M, T, L, T, A, H, G, I, C Y100c W, S Y100d R, L, W, K, A, G, Q, I, V T100e A, L, S G100f A, L, T, P, N, Q, F, I, D D107 HCDR2 A50 G, L S52 P52a A S53 G54 G55 S, R, P, D, I, T, E, K, A, L D56 R57 I58 HCDR1 S32 N, K, R, E, W, M, Q, D, F, V, L, A P33 S M34 I G35 L, A, I, S, R, V, N, Q, M

    [0186] Thus, the screening was performed for BCD109 antibody CDR amino acid positions that are tolerant to amino acid substitutions. It was demonstrated that the present panel of amino acid substitutions does not significantly change the antibody affinity to human IL-17A. Said substitution panel can be used to improve various properties of the candidate.

    Example 17

    Engineering of BCD109 Candidate and Evaluation of its Affinity to IL-17A of Various Origins

    [0187] BCD109 antibody was obtained from m4VHHc8 variant comprising 44G45T substitutions (described in Example 16) by introducing humanizing mutations Q5V and R89V to VHH that do not change either the stability or IC.sub.50 (no data provided), and three additive mutations in CH2 domain FcIgG1, 232Y/234T/236E, intended to improve the antibody pharmacokinetics. The antibody has been transiently expressed.

    [0188] The affinity of BCD109 binding to human, monkey and rat IL-17A was investigated on OctetRed 96 system (ForteBio). BCD109 was non-specifically immobilized on the surface of amine reactive second-generation sensors (AR2G) according to the standard protocol described in the manufacturer's manual. The test was conducted at a temperature of 30 C. and using PBS with 0.1% Tween-20 and 0.1% BSA as a working buffer.

    [0189] Human, monkey and rat IL-17A was titrated with the working buffer from a concentration of 126 nM to 2 nM with an increment of 2.

    [0190] Binding curves (after subtracting a reference signal) were analyzed using Octet Data Analysis software (Version 7.0) in accordance with the standard procedure and using 1:1 interaction model. The results are presented in FIG. 13A.

    [0191] It can be seen that BCD109 binds to human and monkey IL-17A with picomolar affinity (FIG. 13B). Moreover, the candidate does not interact with rat IL-17A (no curves are presented).

    Example 18

    Determination of the Aggregation Stability of BCD109 Under Thermal Stress

    [0192] BCD109 preparation of 10 mg/ml in PBS was heated for 6 hours at a temperature of 50 C. in accordance with the protocol described in Example 9.

    [0193] Results represented in FIG. 14 show that BCD109 antibody remains stable under thermal stress: aggregate content was less than 5%.

    Example 19

    Obtainment of a Pharmaceutical Composition Comprising the Antibody of the Invention

    [0194] BCD109 antibody in a concentration of 50 mg/ml was dissolved in q.s. water for injection and pH was brought to 5.5 with citric acid. Solution was filtered (filtration sterilization) and sealed into ampoules.

    [0195] The product obtained was stable for 6 months with no sedimentation.

    [0196] Alternatively, BCD109 was dissolved in water containing mannitol as a lyoprotectant, filtered (filtration sterilization) and then subject to freeze-drying. The powder obtained was dispensed to sterile vials. Vials were corked with rubber stoppers and sealed with aluminum caps. The antibody product can be recovered from the lyophilizate with water for injection.

    REFERENCES

    [0197] 1. Porter R. R. 1973. Structural studies of immunoglobulins. Science. 180, 713-716. [0198] 2. Padlan E. A. 1994. Anatomy of the antibody molecule. Mol.Immunol. 31, 169-217. [0199] 3. Dwek R. A., Sutton B. J., Perkins S. J., Rademacher T. W. 1984. Structure-function relationships in immunoglobulins. Biochem. Soc. Symp. 49, 123-136. [0200] 4. Burton D. R. 1985. Immunoglobulin G: functional sites. Mol. Immunol. 22, 161-206. [0201] 5. Hamers Casterman C., Atarhouch T., Muyldermans S., Robinson G., Hamers C., Bajyana Songa E., Bendahman N., Hamers R. 1993. Naturally occurring antibodies devoid of light chains. Nature. 363, 446-448. [0202] 6. S. V. Tillib Molecular Biology, 2011, 45, No. 1, 77-85. Camel nanlantibodiesefficient instrument for investigations, diagnostics and therapy. [0203] 7. Nguyen V. K., Hamers R., Wyns L., Muyldermans S. 1999. Loss of splice consensus signal is responsible for the removal of the entire CH1 domain of the functional camel IGG2A heavy-chain antibodies. Mol. Immunol. 36, 515-524. [0204] 8. Woolven B. P., Frenken L., van der Logt P., Nicholls P. J. 1999. The structure of the llama heavy chain constant genes reveals a mechanism for heavy-chain antibody formation. Immunogenetics. 50, 98-101. [0205] 9. Nguyen V. K., Hamers R., Wyns L., Muyldermans S. 2000. Camel heavy-chain antibodies: diverse germline VHH and specific mechanisms enlarge the antigen-binding repertoire. EMBO J. 19, 921-931. [0206] 10. De Genst E., Saerens D., Muyldermans S., Conrath K. 2006. Antibody repertoire development in camelids. Develop. Comp. Immunol. 30, 187-198. [0207] 11. Muyldermans S., Cambillau C., Wyns L. 2001. Recognition of antigens by single-domain antibody fragments: the superfluous luxury of paired domains. TIBS. 26, 230-235. [0208] 12. De Genst E., Silence K., Decanniere K., Loris R., Kinne J., Muyldermans S. 2006. Molecular basis for the preferential cleft recognition by dromedary heavy chain antibodies. Proc. Natl. Acad. Sci. USA. 103, 4586-4591. [0209] 13. Kabat E., Wu T. T., Perry H. M., Gottesman K S, Foeller C. 1991. Sequence of proteins of immunological interest. US Public Health Services. NIH, Bethesda, Md., Publication no. 91-3242. [0210] 14. Nguyen V. K., Desmyter A., Muyldermans S. 2001. Functional heavy-chain antibodies in camelidae. Adv. Immunol. 79, 261-296. [0211] 15. Muyldermans S., Baral T. N., Retamozzo V. C., et al. 2009. Camelid immunoglobulins and nanobody technology. Vet. Immunol. Immunopathol. 128 (1-3), 178-183. [0212] 16. de Genst E., Silence K., Decanniere K., Loris R., Kinne J., Wyns L., Muyldermans S. 2005. Strong in vivo maturation compensates for structurally restricted H3 loops in antibody repertoires. J. Biol. Chem. 280, 14114-14121. [0213] 17. Lauwereys M., Ghahroudi M., Desmyter A., Kinne J., Holzer W., De Genst E., Wyns L., Muyldermans S. 1998. Potent enzyme inhibitors derived from dromedary heavy chain antibodies. EMBO J. 17, 3512-3520. [0214] 18. Kontermann R E. 2009 Strategies to extend plasma half-lives of recombinant antibodies. BioDrugs.; 23(2):93-109. [0215] 19. Ken Coppieters, Torsten Dreier, Karen Silence, Hans de Haard, Marc Lauwereys, Peter Casteels, Els Beirnaert, Heidi Jonckheere, 2006 Formatted anti-tumor necrosis factor alpha VHH proteins derived from camelids show superior potency and targeting to inflamed joints in a murine model of collagen-induced arthritis Arthritis & Rheumatology.; 54(6):1856-66. [0216] 20. Gabrielle Richard, Ashley J Meyers, Michael D McLean, Mehdi Arbabi-Ghahroudi, Roger MacKenzie, J Christopher Hall2013. In Vivo Neutralization of a-Cobratoxin with High-Affinity Llama Single-Domain Antibodies (V.sub.HHs) and a V.sub.HH-Fc Antibody. PLoS One 22; 8(7):e69495. [0217] 21. Jan Terje Andersen, Maria Gonzalez-Pajuelo, Stian Foss, Ole J. B. Landsverk, Debora Pinto, Alexander Szyroki, Hans J. de Haard, Michael Saunders, Peter Vanlandschoot Inger Sandlie 2012, Selection of Nanobodies that Target Human Neonatal Fc Receptor. Scientific Reports, 3,1118. [0218] 22. Vincke C.sup.1, Loris R, Saerens D, Martinez-Rodriguez S, Muyldermans S, Conrath K. 2009 General strategy to humanize a camelid single-domain antibody and identification of a universal humanized nanobody scaffold. J Biol Chem. January 30; 284(5): 3273-84. [0219] 23. Barthelemy P A, Raab H, Appleton B A, Bond C J, Wu P, Wiesmann C, Sidhu S S. 2008 Comprehensive analysis of the factors contributing to the stability and solubility of autonomous human VH domains. J Biol Chem. February 8; 283(6):3639-54. [0220] 24. Conrath K, Vincke C, Stijlemans B, Schymkowitz J, Decanniere K, Wyns L, Muyldermans S, Loris R. Antigen binding and solubility effects upon the veneering of a camel VHH in framework-2 to mimic a VH. J Mol Biol. 2005 Jul. 1; 350 (1): 112-25. [0221] 25. Hermeling S, Crommelin D J, Schellekens H, Jiskoot W (2004) Structure-immunogenicity relationships of therapeutic proteins. Pharm Res 21:897-903 [0222] 26. Handbook of pharmaceutical manufacturing formulations. Volume 6. Sterile products/Sarfaraz K. Niazi, 2004. [0223] 27. J. de Haard H., van Neer N., Anneke Reurs, E. Hufton S., Roovers R., Henderikx P., de Bruin A., Arends J.-W. and Hoogenboom H. A Large Non-immunized Human Fab Fragment Phage Library That Permits Rapid Isolation and Kinetic Analysis of High Affinity Antibodies. J Biol Chem. 1999 Jun. 25 274(26):18218-30. [0224] 28. WO 2010/001251. [0225] 29. Koch-Nolte F., Reyelt J., Schow B., Schwarz N., Scheuplein F., Rothenburg S., Haag F., Alzogaray V., Cauerhff A. and Goldbaum F. Single domain antibodies from llama effectively and specifically block T cell ecto-ADP-ribosyltransferase ART2.2 in vivo. FASEB J., 2007 November; 21(13):3490-8. [0226] 30. Sidhu S., Lowman H., Cunningham B., Wells J. Phage display for selection of novel binding peptides. J. Methods Enzymol. 2000; 328: 333-63. [0227] 31. Marks J., Hoogenboom H., Bonnert T., McCafferty J., Griffiths A., Winter G. By-passing immunization: Human antibodies from V-gene libraries displayed on phage. J Mol Biol. 1991 Dec. 5; 222(3):581-97. [0228] 32. Vaughan T., Williams A., Pritchard K., Osbourn J., Pope A., Earnshaw J., McCafferty J., Hodits R., Wilton J. and Johnson K. Human Antibodies with Sub-nanomolar Affinities Isolated from a Large Non-immunized Phage Display Library. Nat Biotechnol. 1996 March; 14 (3): 309-14. [0229] 34. Environ Microbiol. 2006 February; 72(2):1141-7; MAbs. 2012 May-June; 4(3): 341-8. [0230] 35. Cummings M., Farnum M., and Nelen M. Universal Screening Methods and Applications of ThermoFluor. J Biomol Screen 2006 11(7): 854-863.