Release media
09587104 ยท 2017-03-07
Assignee
Inventors
- Peter Gray (Taringa, AU)
- Michael John Monteiro (Kenmore, AU)
- Trent Phillip Munro (Chapel Hill, AU)
- Andrew Benjamin James Prowse (Annerley, AU)
Cpc classification
C12N2523/00
CHEMISTRY; METALLURGY
C08L51/003
CHEMISTRY; METALLURGY
C08K5/0008
CHEMISTRY; METALLURGY
A61K47/62
HUMAN NECESSITIES
C08F220/54
CHEMISTRY; METALLURGY
A61K47/32
HUMAN NECESSITIES
C08L53/00
CHEMISTRY; METALLURGY
A61K47/42
HUMAN NECESSITIES
C08K5/0008
CHEMISTRY; METALLURGY
C08F220/54
CHEMISTRY; METALLURGY
C08F2438/03
CHEMISTRY; METALLURGY
C12N5/0606
CHEMISTRY; METALLURGY
C08F120/54
CHEMISTRY; METALLURGY
A61K47/58
HUMAN NECESSITIES
C08F293/005
CHEMISTRY; METALLURGY
C12N5/0062
CHEMISTRY; METALLURGY
C12N2539/10
CHEMISTRY; METALLURGY
C12N2509/00
CHEMISTRY; METALLURGY
C08L53/00
CHEMISTRY; METALLURGY
International classification
A61K47/32
HUMAN NECESSITIES
C08L51/00
CHEMISTRY; METALLURGY
A61K47/42
HUMAN NECESSITIES
C08L53/00
CHEMISTRY; METALLURGY
C08F120/54
CHEMISTRY; METALLURGY
C08F220/54
CHEMISTRY; METALLURGY
C12N5/00
CHEMISTRY; METALLURGY
C08F293/00
CHEMISTRY; METALLURGY
C12M1/12
CHEMISTRY; METALLURGY
Abstract
The present invention relates to a composition comprising polymer particles and functionalized stimulus responsive polymer; the polymer particles (i) comprising block co-polymer, and (ii) having a core-shell structure, said block co-polymer comprising (a) a non-stimulus responsive polymer block that forms at least part of the core structure, and (b) a stimulus responsive polymer block that forms at least part of the shell structure; wherein the stimulus responsive polymer of both the polymer particles and the functionalized stimulus responsive polymer are responsive to at least one common stimulus.
Claims
1. A composition comprising polymer particles and functionalised stimulus responsive polymer; the polymer particles (i) comprising block co-polymer, and (ii) having a core-shell structure, said block co-polymer comprising (a) a non-stimulus responsive polymer block that forms at least part of the core structure, and (b) a stimulus responsive polymer block that forms at least part of the shell structure; wherein the stimulus responsive polymer of both the polymer particles and the functionalised stimulus responsive polymer are responsive to at least one common stimulus.
2. The composition according to claim 1 further comprising a liquid, wherein the stimulus responsive polymer associated with both the polymer particles and the functionalised stimulus responsive polymer are soluble within the liquid.
3. The composition according to claim 1 further comprising a liquid and being in the form of a gel, wherein the stimulus responsive polymer associated with both the polymer particles and the functionalised stimulus responsive polymer are insoluble within the liquid.
4. A cell culture system comprising the composition according to claim 1.
5. A drug delivery system comprising the composition according to claim 1.
6. A method of culturing cells, said method comprising: (i) providing a liquid composition comprising polymer particles and cell functionalised stimulus responsive polymer; the polymer particles (a) comprising block co-polymer, and (b) having a core-shell structure, said block co-polymer comprising (a) a non-stimulus responsive polymer block that forms at least part of the core structure, and (b) a stimulus responsive polymer block that forms at least part of the shell structure; wherein the stimulus responsive polymer of both the polymer particles and the cell functionalised stimulus responsive polymer are (a) responsive to at least one common stimulus, and (b) soluble in the liquid; (ii) subjecting the liquid composition to said common stimulus so as to cause the stimulus responsive polymer of both the polymer particles and the cell functionalised stimulus responsive polymer to transition from being soluble in the liquid to being insoluble in the liquid, wherein said transition promotes aggregation of the polymer particles and the cell functionalised stimulus responsive polymer to form cell clusters; and (iii) culturing cells within and/or on said cell clusters.
7. The method according to claim 6 further comprising a step of: (iv) subjecting the liquid composition comprising the cultured cells to said common stimulus so as to cause the stimulus responsive polymer of both the polymer particles and the cell functionalised stimulus responsive polymer to transition from being insoluble in the liquid to being soluble in the liquid, wherein said transition facilitates release from said cell clusters of individual cells and/or smaller cell clusters.
8. The method according to claim 7 further comprising a step of: (v) removing from the liquid composition at least some of the so formed individual cells and/or smaller cell clusters formed in step (iv).
9. The method according to claim 6, wherein the liquid is an aqueous liquid and the stimulus responsive polymer of both the polymer particles and the cell functionalised stimulus responsive polymer is a thermoresponsive polymer having a common LCST.
10. The method according to claim 9, wherein said common stimulus applied in step (ii) is increasing the temperature of the liquid above the LCST.
11. The method according to claim 9, wherein 37 C. is at or above the LCST.
12. A method of culturing cells, said method comprising: (i) providing a liquid composition comprising, a liquid, cell receptor ligand functionalised stimulus responsive polymer and polymer particles secured to a substrate; the polymer particles (a) comprising block co-polymer, and (b) having a core-shell structure, said block co-polymer comprising (a) a non-stimulus responsive polymer block that forms at least part of the core structure, and (b) a stimulus responsive polymer block that forms at least part of the shell structure; wherein the stimulus responsive polymer of both the polymer particles and the cell receptor ligand functionalised stimulus responsive polymer are (a) responsive to at least one common stimulus, and (b) soluble in the liquid; (ii) subjecting the liquid composition to said common stimulus so as to cause the stimulus responsive polymer of both the polymer particles and the cell receptor ligand functionalised stimulus responsive polymer to transition from being soluble in the liquid to being insoluble in the liquid, wherein said transition promotes aggregation of the polymer particles and the cell receptor ligand functionalised stimulus responsive polymer to form an aggregate structure with a surface comprising the cell receptor ligand; (iii) introducing to the liquid one or more cells that are to be cultured such that it or they bind with a cell receptor ligand; and (iv) culturing cells upon said surface comprising the cell receptor ligand.
13. The method according to claim 12 further comprising a step of: (v) subjecting the liquid composition comprising the cultured cells to said common stimulus so as to cause the stimulus responsive polymer of both the polymer particles and the cell receptor ligand functionalised stimulus responsive polymer to transition from being insoluble in the liquid to being soluble in the liquid, wherein said transition facilitates release of said cultured cells.
14. The method according to claim 13 further comprising a step of: (vi) removing from the liquid composition at least some of the cultured cells formed in step (v).
15. The method according to claim 12, wherein the liquid is an aqueous liquid and the stimulus responsive polymer of both the polymer particles and the cell receptor ligand functionalised stimulus responsive polymer is a thermoresponsive polymer having a common LCST.
16. The method according to claim 15, wherein said common stimulus applied in step (ii) is increasing the temperature of the liquid composition above the LCST.
17. The method according to claim 15, wherein said common stimulus applied in step (v) is decreasing the temperature of the liquid composition below the LCST.
18. The method according to claim 15, wherein 37 C. is at or above the LCST.
19. A method of forming a gel comprising functionalised stimulus responsive polymer, said method comprising: (i) providing a liquid composition comprising a liquid, polymer particles and functionalised stimulus responsive polymer; the polymer particles (a) comprising block co-polymer, and (b) having a core-shell structure, said block co-polymer comprising (a) a non-stimulus responsive polymer block that forms at least part of the core structure, and (b) a stimulus responsive polymer block that forms at least part of the shell structure; wherein the stimulus responsive polymer of both the polymer particles and the functionalised stimulus responsive polymer are (a) responsive to at least one common stimulus, and (b) soluble in the liquid; and (ii) subjecting the liquid composition to said common stimulus so as to cause the stimulus responsive polymer of both the polymer particles and the functionalised stimulus responsive polymer to transition from being soluble in the liquid to being insoluble in the liquid, wherein said transition promotes formation of the gel.
20. A method of releasing from a gel a functionalised stimulus responsive polymer, said method comprising: (i) providing a gel comprising polymer particles, a functionalised stimulus responsive polymer and liquid; the polymer particles (a) comprising block co-polymer, and (b) having a core-shell structure, said block co-polymer comprising (a) a non-stimulus responsive polymer block that forms at least part of the core structure and (b) a stimulus responsive polymer block that forms at least part of the shell structure; wherein the stimulus responsive polymer of both the polymer particles and the functionalised stimulus responsive polymer are (a) responsive to at least one common stimulus, and (b) insoluble in the liquid; and (ii) subjecting the gel to said common stimulus so as to cause the stimulus responsive polymer of both the polymer particles and the functionalised stimulus responsive polymer to transition from being insoluble in the liquid to being soluble in the liquid, wherein said transition causes the gel to become a liquid composition comprising the polymer particles and the functionalised stimulus responsive polymer, thereby promoting release of the functionalised stimulus responsive polymer from the gel.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1) Embodiments of the invention will hereinafter be illustrated by way of example only with reference to the accompanying drawings in which:
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11) Some Figures contain colour representations or entities. Coloured versions of the Figures are available upon request.
DETAILED DESCRIPTION OF THE INVENTION
(12) A composition in accordance with the invention comprises polymer particles. The polymer particles have a core-shell structure as herein described. Provided the polymer particles have the required core-shell structure and can be used as described herein, there is no particular limitation regarding their shape or size.
(13) The polymer particles may have a spherical, ellipsoidal, hoop, cylindrical, rod, or worm like shape. The polymer particles may comprise a mixture of different shaped polymer particles.
(14) In one embodiment, all dimensions of the polymer particles are less than about 1 micron.
(15) In a further embodiment, at least one dimension of the polymer particles is less than about 100 nm, or less than about 70 nm, or less than about 50 nm, or less than about 30 nm, or less than about 20 nm, or less than about 15 nm, or less than about 10 nm.
(16) In another embodiment, the polymer particles have an aspect ratio (average length:average diameter) greater than 1, for example at least 5, or at least 10, or at least 20, or at least 30, or at least 40, or at least 60, or at least 80, or at least 100, or at least 500. The aspect ratio of the polymer particles may range from about 5 to about 1000 or from about 25 to about 500, or about 50 to about 200.
(17) The core-shell structure of the polymer particles comprises block co-polymer. By block co-polymer is meant a co-polymer that is a block polymer having adjacent blocks that are constitutionally different. By having a core-shell structure is meant that the polymer particles have an inner composition (the core) that is surrounded by a substantially different outer composition (the shell). In the context of the present invention, the shell is defined by the stimulus polymer block of the block co-polymer. This stimulus polymer block may be soluble or insoluble relative to a liquid within which the polymer particles are located. The core is defined by the non-stimulus polymer block of the block co-polymer and will typically be insoluble relative to a liquid within which the polymer particles are located.
(18) Thus, the block co-polymer that forms the polymer particles comprises a non-stimulus responsive polymer block and a stimulus responsive block, whereby the non-stimulus responsive polymer block forms at least part of the core structure of the polymer particles and the stimulus responsive polymer block forms at least part of the shell structure of the polymer particles. The polymer particles may therefore be described as having a core comprising non-stimulus responsive polymer and a shell comprising stimulus responsive polymer where the transition from the core to the shell corresponds to a transition from the non-stimulus responsive polymer block of the co-polymer to the stimulus responsive polymer block of the co-polymer.
(19) An important feature of the block co-polymer is the stimulus responsive polymer block. Stimulus responsive polymers (also known as smart polymers) are polymers which undergo a physical or chemical change in response to stimuli such as a change in temperature, pH, ionic strength and/or wavelength of light.
(20) The physical or chemical change exhibited by stimulus responsive polymer in response to a given stimulus can vary depending upon the type of polymer employed. For example, one form of physical change is where in response to a stimulus the polymer undergoes a reversible transition from being hydrophobic in character to being hydrophilic in character.
(21) In one embodiment, the stimulus responsive polymer block of the block co-polymer is of a type that upon being subjected to a stimulus undergoes a transition from being hydrophobic in character to being hydrophilic in character or vice versa.
(22) In a further embodiment, the stimulus responsive polymer block of the block co-polymer is a temperature responsive polymer block that in response to a change in temperature undergoes a physical or chemical transition.
(23) In yet a further embodiment, the stimulus responsive polymer block of the block co-polymer is a temperature responsive polymer that in response to a change in temperature undergoes a transition from being hydrophobic in character to being hydrophilic in character or vice versa.
(24) Those skilled in the art will appreciate that expressions such as hydrophobic in character and hydrophilic in character are generally used in the art to convey favourable or unfavourable interactions between one substance relative to another (e.g. attractive or repulsive interactions) and not to define absolute qualities of a particular substance. For example, hydrophilic materials are more likely to be wetted or dissolved by an aqueous medium (attractive interaction), whereas hydrophobic materials are less, likely to be wetted or dissolved by an aqueous medium (repulsive interaction). Unless otherwise stated, in the context of the present invention these expressions are intended to be a reference to the polarity of the stimulus responsive polymer relative to the polarity of an aqueous liquid. Thus, by being hydrophilic in character the stimulus responsive polymer can be wetted or dissolved by an aqueous liquid. By being hydrophobic in character the stimulus responsive polymer can not be wetted or dissolved by an aqueous liquid.
(25) The stimulus responsive polymer block of the block co-polymer may be in the form of a homopolymer or a co-polymer.
(26) The stimulus responsive polymer block of the block co-polymer may be a natural polymer or a synthetic polymer.
(27) Examples of temperature responsive polymers include homopolymer and co-polymers of N-isopropyl acrylamide (NIPAAm, NIPAm, or NIPAM).
(28) Poly(N-isopropyl acrylamide) homopolymer (P(NIPAAm), PNIPAm, PNIPAM or pNIPAM) is a well known temperature responsive polymer and exhibits a lower critical solution temperature (LCST) of about 36 C. in an aqueous medium. It can reversibly assume (i) an expanded random coil structure below the LCST that is hydrophilic in character and readily wetted or solvated by an the aqueous liquid, and (ii) a collapsed globular structure above the LCST that is hydrophobic in character and not readily wetted or solvated by an aqueous liquid.
(29) When NIPAAm is co-polymerised with one or more hydrophilic ethylenically unsaturated comonomers such as acrylamide, the LCST of the resulting co-polymer, can be raised relative to that of P(NIPAAm). The opposite may occur when NIPAAm is co-polymerised with one or more hydrophobic comonomers, such as N-t-butyl acrylamide. Co-polymers of NIPAAm with hydrophilic monomers such as acrylamide have a higher LCST and generally a broader temperature range of precipitation (relative to P(NIPAAm)), while co-polymers of NIPAAm with hydrophobic monomers such as N-t-butyl acrylamide have a lower LCST (relative to P(NIPAAm) and are generally more likely to retain the sharp transition characteristic of P(NIPAAm).
(30) Examples of pH responsive polymers include those derived from pH responsive vinyl monomers such as acrylic acid, methacrylic acid, and other alkyl-substituted acrylic acids, maleic anhydride, maleic acid, 2-acryamido-2-methyl-1-propanesulfonic acid, N-vinyl formamide, N-vinyl acetamide, aminoethyl methacrylate, phosphoryl ethyl acrylate or methacrylate. pH responsive polymers may also be prepared as polypeptides from amino acids (e.g. polylysine or polyglutiamic acid) all derived from naturally occurring polymers such as proteins (e.g. lysozyme, albumin, casein), or polysaccharides (e.g. alginic acid, hyaluronic acid, carrageenan, chitosan, carboxymethyl, cellulose) or nucleic acids such as DNA. pH responsive polymers usually comprise pendant pH sensitive functional groups such as OPO(OH).sub.2, COOH or NH.sub.2.
(31) By co-polymerising a monomer that gives rise to a temperature responsive polymer such as NIPAAm with a small amount (e.g. less than about 10 mole %) of a comonomer that gives rise to a pH responsive polymer such as acrylic acid, the resulting co-polymer can display both temperature and pH responsiveness. The LCST of such a co-polymer can remain unaffected, sometimes even lowered a few degrees, at a pH where the co-polymer is not ionised, but the LCST can be dramatically raised if the pH sensitive groups become ionised. When pH sensitive groups are present at a high concentration, the LCST response of the temperature responsive effect may be for all practical purposes eliminated.
(32) Block co-polymers derived from pH and temperature responsive monomers can be prepared such that they retain both pH and temperature transitions independently. For example, a block co-polymer having a pH responsive block (polyacrylic acid) and a temperature responsive block (P(NIPAAm)) can retain independent pH and temperature responsiveness.
(33) The stimulus responsive polymer block of the block co-polymer may therefore itself be a block co-polymer.
(34) In one embodiment, the stimulus responsive polymer block of the block co-polymer is not in itself a block co-polymer.
(35) Examples of light responsive polymers include those that contain chromophoric groups pendant to or along the main chain of the polymer and, when exposed to an appropriate wavelength of light, can be isomerised from a trans to a cis form, which can be dipolar and more hydrophilic and promote reversible polymer conformational changes. Other light sensitive groups can also be converted by light stimulation from a relatively non-polar hydrophobic, non-ionised state to a hydrophilic ionic state.
(36) In the case of pendant light-sensitive groups such as a light-sensitive dye (e.g. aromatic azo compounds or stilbene derivatives), they may be conjugated to a reactive monomer (an exception is a dye such as chlorophyllin, which already comprises a vinyl group) and then homopolymerised or co-polymerised with one or more other monomers, including temperature responsive or pH responsive monomers. The light sensitive group may also be conjugated to an end of a polymer chain, including a stimulus responsive polymer chain. Techniques for conjugating such light sensitive groups to monomers or polymer chains are known.
(37) Generally, a light responsive polymer will be prepared from vinyl monomers that contain light-sensitive pendant groups. Such monomers may be homopolymerised or co-polymerised with one or more other ethylenically unsaturated monomers.
(38) The light-sensitive groups may be dye molecules that isomerise or become ionised when they absorb certain wavelength of light, converting them from hydrophobic to hydrophilic confirmations or vice versa, or they may be dye molecules which give off heat when they absorb certain wavelength of light. In the former case, the isomerisation alone can cause chain expansion or collapse, while in the later case the polymer can precipitate if it is also temperature responsive.
(39) Examples of chromophoric groups that may give rise to the light responsive properties include aromatic diazo dyes. When a dye of this type is exposed to 350-410 nm UV light, the trans form of the dye, which is hydrophobic in character, can be isomerised to its cis form, which is dipolar and more hydrophilic in character, this in turn can cause polymer conformational changes. Exposure of the dye to visible light at about 750 nm can reverse this phenomenon.
(40) Examples of specific ion responsive polymers include polysaccharides such as carrageenan that change their confirmation, for example, from a random to an ordered confirmation, as a function of exposure to ions such as K.sup.+ or Ca.sup.2+. Other examples of specific ion responsive polymers include polymers with pendant ion chelating groups such histidine or EDTA.
(41) As indicated above, stimulus responsive polymers may be responsive to multiple stimuli. For example, if a light responsive polymer is also temperature responsive, a UV or visible light stimulated conversion of a chromophor conjugated along the polymer backbone to a more hydrophobic or hydrophilic confirmation can also stimulate the dissolution/wetting or precipitation of the polymer, depending upon the polymer composition and temperature. Alternatively, if the chromophor absorbs light and converts it to thermal energy rather than stimulating isomerisation, then the localised heating can also stimulate a phase change in a temperature responsive polymer such as P(NIPAAm) when the system temperature is near the phase separation temperature. The incorporation of multiple sensitivities through the co-polymerisation of appropriate monomers can lend greater versatility to the stimulus responsive polymers used in accordance with the invention.
(42) Provided that the stimulus responsive polymer block of the block co-polymer provides for the polymer particles used in accordance with the invention, there is no particular limitation regarding the number average molecular weight of the stimulus responsive polymer block. The number average molecular weight of the stimulus responsive polymer block will generally fall within the range of about 1,500 to about 40,000, for example from about 2,000 to about 20,000, or from about 2,000 to about 10,000.
(43) Reference to the number average molecular weight of a polymer referred to herein is that which is determined by size exclusion chromatography (SEC).
(44) It can also be convenient to refer to the block length of the stimulus responsive polymer block in terms of the number of polymerised monomer residues that form the block. In that case, the stimulus responsive polymer block will generally comprise from about 20 to 200, or from about 30 to about 150, or from about 40 to about 80 polymerised monomer units.
(45) The block co-polymer that forms the polymer particles also comprises a non-stimulus responsive polymer block. By a non-stimulus responsive polymer block is meant a polymer block that would not be considered by those skilled in the art to be a stimulus responsive polymer block and as such not undergo a physical or chemical change in response to stimuli such as a change in temperature, pH, ionic strength and/or wavelength of light.
(46) The non-stimulus responsive polymer block may be in the form of a homopolymer or a co-polymer.
(47) The non-stimulus responsive polymer block may be a natural polymer or a synthetic polymer.
(48) The non-stimulus responsive polymer block may comprise a polymerised residue of a monomer type that has the required properties to provide for a stimulus responsive polymer. However, in that case, the amount of such polymerised monomer residue will be insufficient to impart stimulus responsive properties to the polymer block.
(49) In one embodiment, the non-stimulus responsive polymer block does not contain polymerised monomer residue of a type that can provide for a stimulus responsive polymer.
(50) Provided that the non-stimulus responsive polymer block of the block co-polymer provides for the polymer particles used in accordance with, the invention, there is no particular limitation regarding the number average molecular weight of the non-stimulus responsive polymer block. The number average molecular weight of the non-stimulus responsive polymer block will generally fall within the range of about 500 to about 40,000, for example from about 2,000 to about 20,000, or from about 4,000 to about 10,000.
(51) The non-stimulus responsive polymer block and the stimulus responsive polymer block of the block co-polymer will generally be prepared via the polymerisation of suitable ethylenically unsaturated monomers. The monomers used to prepare the block co-polymer will of course be appropriately selected to provide for the non-stimulus responsive and stimulus responsive polymer blocks, respectively. Such monomers will also generally be capable of being polymerised with other monomers. The factors which determine co-polymerisability of various monomers are well documented in the art. For example, see: Greenlee, R. Z., in Polymer Handbook 3.sup.rd Edition (Brandup, J., and Immergut. E. H. Eds) Wiley: New York, 1989 p II/53.
(52) Suitable ethylenically unsaturated monomers that may be polymerised to prepare the block co-polymer include those of formula (I):
(53) ##STR00001## where U and W are independently selected from CO.sub.2H, CO.sub.2R.sup.1, COR.sup.1, CSR.sup.1, CSOR.sup.1, COSR.sup.1, CONH.sub.2, CONHR.sup.1, CONR.sup.1.sub.2, hydrogen, halogen and optionally substituted C.sub.1-C.sub.4 alkyl or U and W form together a lactone, anhydride or imide ring that may itself be optionally substituted, where the optional substituents are independently selected from hydroxy, CO.sub.2H, CO.sub.2R.sup.1, COR.sup.1, CSR.sup.1, CSOR.sup.1, COSR.sup.1, CN, CONH.sub.2, CONHR.sup.1, CONR.sup.1.sub.2, OR.sup.1, SR.sup.1, O.sub.2CR.sup.1, SCOR.sup.1, and OCSR.sup.1; V is selected from hydrogen, R.sup.1, CO.sub.2H, CO.sub.2R.sup.1, COR.sup.1, CSR.sup.1, CSOR.sup.1, COSR.sup.1, CONH.sub.2, CONHR.sup.1, CONR.sup.1.sub.2, OR.sup.1, SR.sup.1, O.sub.2CR.sup.1, SCOR.sup.1, and OCSR.sup.1; where the or each R.sup.1 is independently selected from optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted arylalkyl, optionally substituted heteroarylalkyl, optionally substituted alkylaryl, optionally substituted alkylheteroaryl, and an optionally substituted polymer chain.
(54) The or each R.sup.1 may also be independently selected from optionally substituted C.sub.1-C.sub.22 alkyl, optionally substituted C.sub.2-C.sub.22 alkenyl, optionally substituted C.sub.2-C.sub.22 alkynyl, optionally substituted C.sub.6-C.sub.18 aryl, optionally substituted C.sub.3-C.sub.18 heteroaryl, optionally substituted C.sub.3-C.sub.18 carbocyclyl, optionally substituted C.sub.2-C.sub.18 heterocyclyl, optionally substituted C.sub.7-C.sub.24 arylalkyl, optionally substituted C.sub.4-C.sub.18 heteroarylalkyl, optionally substituted C.sub.7-C.sub.24 alkylaryl, optionally substituted C.sub.4-C.sub.18 alkylheteroaryl, and an optionally substituted polymer chain.
(55) R.sup.1 may also be selected from optionally substituted C.sub.1-C.sub.18 alkyl, optionally substituted C.sub.2-C.sub.18 alkenyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aralkyl, optionally substituted heteroarylalkyl, optionally substituted alkaryl, optionally substituted alkylheteroaryl and a polymer chain.
(56) In one embodiment, R.sup.1 may be independently selected from optionally substituted C.sub.1-C.sub.6 alkyl.
(57) Examples of optional substituents for R.sup.1 include those selected from alkyleneoxidyl (epoxy), hydroxy, alkoxy, acyl, acyloxy, formyl, alkylcarbonyl, carboxy, sulfonic acid, alkoxy- or aryloxy-carbonyl, isocyanato, cyano, silyl, halo, amino, including salts and derivatives thereof. Examples polymer chains include those selected from polyalkylene oxide, polyarylene ether and polyalkylene ether.
(58) Examples of monomers of formula (I) include maleic anhydride, N-alkylmaleimide, N-arylmaleimide, dialkyl fumarate and cyclopolymerisable monomers, acrylate and methacrylate esters, acrylic and methacrylic acid, styrene, N-alkylacrylamides, acrylamide, methacrylamide, and methacrylonitrile, mixtures of these monomers, and mixtures of these monomers with other monomers.
(59) Further examples of monomers of formula (I) include: methyl methacrylate, ethyl methacrylate, propyl methacrylate (all isomers), butyl methacrylate (all isomers), 2-ethylhexyl methacrylate, isobornyl methacrylate, methacrylic acid, benzyl methacrylate, phenyl methacrylate, methacrylonitrile, alpha-methylstyrene, methyl acrylate, ethyl acrylate, propyl acrylate (all isomers), butyl acrylate (all isomers), 2-ethylhexyl acrylate, isobornyl acrylate, acrylic acid, benzyl acrylate, phenyl acrylate, acrylonitrile, styrene, functional methacrylates, acrylates and styrenes selected from glycidyl methacrylate, 2-hydroxyethyl methacrylate, hydroxypropyl methacrylate (all isomers), hydroxybutyl methacrylate (all isomers), N,N-dimethylaminoethyl methacrylate, N,N-diethylaminoethyl methacrylate, triethyleneglycol methacrylate, itaconic anhydride, itaconic acid, glycidyl acrylate, 2-hydroxyethyl acrylate, hydroxypropyl acrylate (all isomers), hydroxybutyl acrylate (all isomers), N,N-dimethylaminoethyl acrylate, N,N-diethylaminoethyl acrylate, triethyleneglycol acrylate, methacrylamide, N-methylacrylamide, N-isopropylacrylamide, N,N-dimethylacrylamide, N-tert-butylmethacrylamide, N-n-butylmethacrylamide, N-methylolmethacrylamide, N-ethylolmethacrylamide, N-tert-butylacrylamide, N-n-butylacrylamide, N-methylolacrylamide, N-ethylolacrylamide, vinyl benzoic acid (all isomers), diethylamino styrene (all isomers), alpha-methylvinyl benzoic acid (all isomers), diethylamino alpha-methylstyrene (all isomers), p-vinylbenzene sulfonic acid, p-vinylbenzene sulfonic sodium salt, trimethoxysilylpropyl methacrylate, triethoxysilylpropyl methacrylate, tributoxysilylpropyl methacrylate, dimethoxymethylsilylpropyl methacrylate, diethoxymethylsilylpropyl methacrylate, dibutoxymethylsilylpropyl methacrylate, diisopropoxymethylsilylpropyl methacrylate, dimethoxysilylpropyl methacrylate, diethoxysilylpropyl methacrylate, dibutoxysilylpropyl methacrylate, diisopropoxysilylpropyl methacrylate, trimethoxysilylpropyl acrylate, triethoxysilylpropyl acrylate, tributoxysilylpropylacrylate, dimethoxymethylsilylpropyl acrylate, diethoxymethylsilylpropyl acrylate, dibutoxymethylsilylpropyl acrylate, diisopropoxymethylsilylpropyl acrylate, dimethoxysilylpropyl acrylate, diethoxysilylpropyl acrylate, dibutoxysilylpropyl acrylate, diisopropoxysilylpropyl acrylate, vinyl acetate, vinyl butyrate, vinyl benzoate, vinyl chloride, vinyl fluoride, vinyl bromide, maleic anhydride, N-phenylmaleimide, N-butylmaleimide, N-vinylpyrrolidone, N-vinylcarbazole, butadiene, ethylene and chloroprene. This list is not exhaustive.
(60) In one embodiment, the block co-polymer comprises a non-stimulus responsive polymer block derived from one or more monomers selected from styrene, 4-methylstyrene and n-butyl acrylate.
(61) In a further embodiment, the block co-polymer comprises a stimulus responsive polymer block derived from one or more monomers selected from N-isopropylacrylamide and monomethoxyl ether poly(ethylene oxide) acrylate.
(62) In a further embodiment, the block co-polymer comprises a polystyrene non-stimulus polymer block and a poly(N-isopropylacrylamide) stimulus responsive polymer block.
(63) Provided that the polymer particles have the required block co-polymer composition, there is no particular limitation on the method by which they may be prepared.
(64) The polymer particles may, for example, be prepared according to methodology outlined in WO 2010/091465, the entire contents of which are incorporated herein by cross-reference. In that case, the polymer particles may be prepared using conventional dispersion polymerisation techniques (e.g. conventional emulsion, mini-emulsion and suspension polymerisation) and equipment.
(65) For example, the polymer particles may be prepared by a method that comprises providing a dispersion having a continuous aqueous phase, a dispersed organic phase comprising one or more ethylenically unsaturated monomers, a stimulus responsive polymer having a controlled radical polymerisation moiety covalently bound thereto, and a stabiliser for the organic phase. Having prepared the dispersion, the one or more ethylenically unsaturated monomers are polymerised under the control of the controlled radical polymerisation moiety.
(66) The one or more ethylenically unsaturated monomers used are selected so as to provide for a non-stimulus responsive polymer block. Accordingly, the polymerisation provides for a block copolymer comprising a non-stimulus responsive polymer block and a stimulus responsive polymer block.
(67) By being polymerised under the control of the controlled radical polymerisation moiety is meant that polymerisation of the monomers proceeds via the appropriate controlled radical polymerisation mechanism to form polymer. The controlled radical polymerisation moiety is therefore a moiety that can participate in controlled or mediate the radical polymerisation of one or more ethylenically unsaturated monomers according to a particular type of controlled radical polymerisation so as to form a polymer chain.
(68) Examples of controlled radical polymerisation include iniferter polymerisation, stable free radical mediated polymerisation (SFRP), atom transfer radical polymerisation (ATRP), and reversible addition fragmentation chain transfer (RAFT) polymerisation. For example, where the controlled radical polymerisation moiety is a RAFT moiety, the polymerisation of the monomers will proceed via a RAFT mechanism to form polymer.
(69) Such polymerisation provides for a dispersion of polymer particles comprising block co-polymer chains having a stimulus responsive polymer block and a non-stimulus responsive polymer block. By subjecting the so formed polymer particles to an appropriate stimulus (i.e. a stimulus that causes the stimulus responsive polymer block of the block co-polymer to undergo a chemical or physical transition), the polymer particles can undergo a morphogenic transformation to form a variety polymer particles with different morphologies. For example, where the stimulus responsive polymer used in the polymerisation comprises a temperature responsive stimulus polymer block, the resulting polymer particles may be provided with a rod or worm like shape by subjecting the dispersion of polymer particles to heating/cooling cycles above and below the LCST of the stimulus responsive polymer block.
(70) Confirmation of the various shapes of polymer particles formed may be established using a conventional analytical technique such as Transmission Electron Microscopy (TEM).
(71) In addition to the polymer particles, the composition in accordance with the invention also comprises functionalised stimulus responsive polymer. By the expression functionalised stimulus responsive polymer is meant stimulus responsive polymer having attached to it by physical or chemical association (e.g. a covalent bond) a functional entity that is to be released from a release medium according to the invention. There is no particular limitation regarding the nature of such a functional entity provided that it, or a modified or derived form thereof, can be released from the release medium.
(72) For example, the functionalised stimulus responsive polymer may be functionalised with a functional entity selected from biological material, drugs, and cell receptor ligand.
(73) Examples of biological material include, but are not limited to, cells, proteins, peptides, nucleic acids, lipids and carbohydrates.
(74) Examples of cell receptor ligands include, but are not limited to, proteins, peptides, neurotransmitters, hormones, drugs, agonists and antagonists.
(75) Specific examples of cells include, but are not limited to, Embryonic stem cells (hESCs), Mesenchymal stem cells (MSCs), Hematopoietic stem cells (HSCs), Neural stem cells (NSCs), Cancer Stem Cells (CSCs), Induced pluripotent stem cells, Adult stem cells, Foetal Stem Cells, Tissue specific stem cells, Umbilical Cord Stem Cells, Placenta Derived Stem Cells, Chinese Hamster Ovary Cells (CHO), Baby Hamster Kidney Cells (BHK), human amniocytes, NS0 cells, PER.C6 cells, Madin-Darby canine kidney cell (MDCK), Hybridoma Cells, Human embryonic kidney cells (HEK), Muscovy Duck (AGE.CR), Vero cells (African green monkey), NIH-3T3, MRC-5, WI-38, FRhl-2, chicken embryo fibroblasts (CEF), chicken embryo kidney (CEK) and blastoderm-derived embryonic stem cells (e.g., EB14, Vivalis), insect cells (eg Sf9 and High Five), HeLa cells, COS cells, and primary or immortalised human cells.
(76) Specific examples of proteins include, but are not limited to, extracellular matrix components and proteoglycans e.g. Vitronectin, Laminin, Collagen, Fibronectin and Elastin.
(77) Specific examples of peptides include, but are not limited to, cell adhesion motifs including RGD, YIGSR, REDV and poly-alanine, and thrombopoietin (TPO) derived peptides.
(78) Specific examples of drugs include, but are not limited to, Aphidicolin, Blebbistatin, Colchicine, Cytochalasin, Latrunculin, Leptomycin, ROCK Inhibitor (Y-27632), glycogen synthase kinase 3 inhibitors (e.g. BIO (6-bromoindirubin-3-oxime) and CHIR99021), RA (retinoic acid), Pluripotin/SC1, PD0325901, A83-01, IDE1, () Indolactam V, Stauprimide, SB431542, BIX-01294, RG108, (+)Bayk 8644, Parnate, Kenpaullone, Valproic Acid, Reversine and phorbol myristate acetate.
(79) The stimulus responsive polymer component of the functionalised stimulus responsive polymer may be a stimulus responsive polymer as herein described. The functional entity and the stimulus responsive polymer may be chemically or physically associated with each other using techniques known in the art. For example, the functional entity and the stimulus responsive polymer may each be provided with complimentary reactive functional groups that undergo chemical reaction to provide for a covalent bond between the functional entity and the stimulus responsive polymer.
(80) Compositions in accordance with the invention may comprise liquid. When the composition is a liquid composition, the stimulus responsive polymer associated with both the polymer particles and the functionalised stimulus responsive polymer are soluble within the liquid. To prevent the polymer particles from dissolving entirely in the liquid, the non-stimulus responsive polymer block of the co-polymer that forms the polymer particle core will of course be insoluble within the liquid.
(81) In one embodiment, the liquid is a hydrophilic liquid, such as an aqueous liquid.
(82) In addition to selecting the stimulus responsive polymer associated with the polymer particles and the functionalised stimulus responsive polymer to have a desired solubility in the liquid, the respective stimulus responsive polymers are also selected to be responsive to at least one common stimulus. In other words, the respective stimulus responsive polymers can undergo a physical or chemical change in response to the same stimulus. For example, the stimulus responsive polymer of both the polymer particles and the functionalised stimulus responsive polymer may be temperature responsive polymers.
(83) Generally, the stimulus responsive polymer of both the polymer particles and the functionalised stimulus responsive polymer will not only be responsive to at least one common stimulus, but both stimulus responsive polymers will respond to that common stimulus in the same or a similar manner. For example, where the stimulus responsive polymer of both the polymer particles and the functionalised stimulus responsive polymer are temperature responsive polymers, they will both have the same or a similar LSCT.
(84) In one embodiment, the stimulus responsive polymer of both the polymer particles and the functionalised stimulus responsive polymer (a) are temperature responsive polymers, and (b) have an LSCT that differs by no more than 5 C., or 4 C., or 3 C., or 2 C., or 1 C.
(85) When the stimulus responsive polymer associated with both the polymer particles and the functionalised stimulus responsive polymer is soluble in the liquid, the functionalised stimulus responsive polymer and the polymer particles present within the liquid composition as discrete separate entities (i.e. they do not aggregate).
(86) Provided that the composition can function as intended, there is no particular limitation regarding the liquid that can be used. In one embodiment the liquid is a hydrophilic liquid, such as an aqueous liquid, water soluble alcohol or polyether such as polyethylene oxide. As an aqueous liquid, the water may comprise one or more water soluble liquids or solids.
(87) With reference to
(88) With particular reference to
(89) With particular reference to
(90) A similar consideration applies to
(91) There is no particular limitation regarding the amount of polymer particles and functionalised stimulus responsive polymer, or the ratio of polymer particles to functionalised stimulus responsive polymer, that may be used in the compositions of the invention. The amount and ratio used will typically be governed by the intended application and can be readily determined by those skilled in the art.
(92) Where the compositions are to be used in the formation of a gel, they will comprise a liquid and the polymer particles are present within the liquid at a concentration that is sufficient to transform the liquid into a gel upon at least the stimulus responsive polymer of the polymer particles being subjected to the at least one common stimulus. To form the gel the polymer particles are provided such that they can readily associate with each other and develop an aggregate structure (i.e. form a collection of particles in physical communication with each other).
(93) The CGC for a given type of polymer particle will vary primarily depending on the aspect ratio of the particles. To form the gel the polymer particles will be provided at or above their CGC. Polymer particles with a low aspect ratio will typically have a higher CGC than those particles with a high aspect ratio. For example, polymer particles with an aspect ratio of 10 may have a CGC of around 5-10 wt %, whereas polymer particles with an aspect ratio of 100 may have a CGC of around 0.1-0.5 wt %. Those skilled in the art will be able to readily determine the CGC for a given polymer particle or mixture of polymer particles.
(94) By the term gel is meant an apparent solid like mass have a jelly like consistency that does not exhibit typical liquid flow characteristics. A composition in accordance with the invention presenting in the form of a gel will comprise the polymer particles, the stimulus responsive polymer and a liquid.
(95) Without wishing to be limited by theory, it is believed that causing (through applying a stimulus) the stimulus responsive polymer of the polymer particles to undergo a physical or chemical transition, for example from being soluble in the liquid to being insoluble in the liquid, can lead to the formation of three dimensional aggregated structures of the particles. Where the polymer particles are present at or above their CGC this aggregation is believed to give rise to a percolated particle network which in turn causes the composition to transition from being in a liquid state into the gel.
(96) Also without wishing to be limited by theory, it is believed that causing (through applying a stimulus) the stimulus responsive polymer of the functionalised stimulus responsive polymer to undergo a physical or chemical transition, for example from being soluble in the liquid to being insoluble in the liquid, leads to the functionalised stimulus responsive polymer forming an aggregated structure with the polymer particles (having also undergone a similar transition). This in turn in effect binds the functionalised stimulus responsive polymer to the aggregate structure (i.e. to form the release medium), which depending on the concentration of the polymer particles may or may not form part of a gel.
(97) For example, a composition in accordance with the invention may comprise polymer particles and functionalised stimulus responsive polymer within an aqueous liquid. The block co-polymer of the polymer particles may comprise (a) a hydrophobic non-stimulus responsive polymer block that forms at least part of the core structure and is insoluble within the aqueous liquid, and (b) a thermo-responsive polymer block that forms at least part of the shell structure, and below it's LCST is soluble within the aqueous liquid. The functionalised stimulus responsive polymer may be a functionalised thermo-responsive polymer, with the thermoresponsive polymer (a) having the same LCST as the thermo-responsive polymer block that forms at least part of the shell structure, and (b) below it's LCST is soluble within the aqueous liquid. At a temperature below the LCST the polymer particles and the functionalised thermo-responsive polymer present as separate and discrete entities.
(98) Subjecting the liquid to an increase in temperature above the LCST of the thermo-responsive polymer of both the polymer particles and the functionalised thermo responsive polymer causes the hydrophilic character of the thermo-responsive polymer to transition from being soluble in the aqueous liquid to being hydrophobic in character and insoluble in the aqueous liquid. This transition causes the polymer particles and functionalised thermo-responsive polymer to associate and form an aggregate structure.
(99) Formation of the aggregate structure gives rise to a release medium from which the functionalised thermo-responsive polymer or a modified form thereof can subsequently be released.
(100) Development of fully defined conditions for reproducible, large-scale production of hESC remains significant challenge for widespread therapeutic application. In other cell-based manufacturing industries, such as production of biopharmaceuticals, the cells used can be grown as mono-dispersed suspension cultures at large-scale (10,000-20,000 L) in stirred tank bioreactors. hESC, however, are yet to be readily adapted to suspension culture and require adherence to a biologically active substrate for high viability, long-term growth and expansion, while maintaining their undifferentiated state, limiting clinical and commercial use.
(101) hESCs are typically derived from the inner cell mass of a 5-6-day old blastocyst of a fertilized embryo. They possess two important characteristics: (1) the ability to proliferate indefinitely while maintaining a stable karyotype, and (2) the ability to differentiate into somatic cells from all four adult cell lineages (ectoderm, mesoderm, endoderm and the germ cells). However, for these applications to become a reality, it is important to develop robust, scalable and standardized systems to produce initially, undifferentiated hESC expansion followed by highly efficient differentiation to the lineage of interest. Reproducible expansion of undifferentiated hESC or induced pluripotent stem cells (iPSC, together collectively termed pluripotent stem cells, PSC) in quantities sufficient for lineage specific differentiation is expected to provide a powerful system for subsequent use in cell therapy or drug discovery.
(102) The response of any given PSC cell line to a culture condition can be influenced by a number of factors including lot-to-lot variability of media components, genetic variability, whether the line is hESC or iPSC and specifically regarding iPSC, and whether the iPSC have in fact been de-differentiated to an equivalent developmental stage as their hESC cousins.
(103) Not all PSCs are created equal. In fact, what constitutes a PSC is consistently evolving, from the first derivation of hESC in 1998 to the generation of iPSC in 2006 and the recent discovery of Oct4.sup.+, pluripotent cells in the mammary glands. In addition, hESC have always been compared to mouse embryonic stem cells (mESC) with many key differences between the two that were thought, at one point, to stem from the fact they were cell lines from different species. However, recent research suggests hESC may be similar to mouse epiblast stem cells and the difference between mESC and hESC was due to hESC being slightly further along the developmental pathway. With such variables in mind, a major issue becomes generating a reproducible culture system capable of cell expansion for multiple cell lines.
(104) The issue of reproducibility can also be considered in the context of media composition and the extracellular matrix (ECM). The concerns regarding lot-to-lot variability and potential immunogenic response to cells grown in or on animal derived components is known in the literature. As such, culture processes for PSC have progressed from the fetal bovine serum (FBS) containing media, mouse feeder layer co-culture system originally used for hESC derivation to systems that utilise increasingly defined media formulations. The efficiency and utilisation of defined media is reliant on effective selection of attachment matrices usually based on mouse derived ECM mixtures Matrigel or Geltrex. Recently, advances have been made in replacing these animal derived components with fully defined substrates consisting of either recombinant proteins like laminin, vitronectin, fibronectin and E-cadherin or simple polymers decorated with small peptides.
(105) Reports have shown that laminin-511 is able to maintain long-term pluripotent expansion of hESCs with stable karyotype in mTeSR1 media compared to other laminins which include laminin-332, laminin-411 and laminin-111. Another ECM protein well-studied and characterised in its support of pluripotent hESC expansion is vitronectin (VN). Other studies have shown hESC maintenance is capable with a short, recombinantly produced fragment of the VN somatomedin B domain followed by the arginine-glycine-aspartic acid (RGD) motif responsible for association with cell surface integrins and cell binding. Further studies have highlighted some of the variations in the response of hESC to ECM constitution by recombinantly producing fragments of VN comprised of different VN domains showing that under their specific growth conditions, the RGD motif and heparin binding domains gave the best response from hESC in regards to attachment and growth.
(106) The importance of cell-cell and cell-ECM contact has also been demonstrated in a recent set of studies in which it was shown 1) a role for Rho kinases and myosin in embryonic cell-cell signalling, 2) that enzymatic dissociation of hESC led to fatal disruption of cell surface E-cadherin and integrin signalling, and 3) that actin-myosin contraction post enzymatic dissociation is responsible for increased cell death through tissue disorganisation (Anoikis). Enzymatic digestion can destroy cell surface integrins and growth factor receptors responsible for important survival and pluripotency maintenance signalling pathways. The ability to culture hESC using non-enzymatic methods and appropriate selection of surface substrate is critical for the future of stem cells in therapeutic applications.
(107) However, such systems/advances in ECM constitution are limited in their scalability due to the restrictions of 2D culture.
(108) To overcome this, 3D suspension systems may be a suitable option as they allow reproducible, controllable automation for mass production of high quality cells, at the same time eliminating labor-intensive and time-consuming methods involved with adherent culture vessels.
(109) However, expansion of PSCs in 3D systems can be problematic in that firstly, PSC are grown in a cluster of cells termed embryoid bodies (EB) which were originally utilised for PSC differentiation. Second, the requirement for cell-cell contact in PSC cultures as outlined above make single cell or small cluster expansion of PSCs prone to high rates of cell death, 50% or higher, even in the presence of inhibitors of actin-myosin induced anoikis. Thirdly, if EBs or PSC aggregates are required for 3D expansion, the aggregate size needs to be closely controlled as this impacts on the behaviour of the cells in terms of growth and pluripotent status. Finally, PSC expansion requires reproducibility such that clinically relevant numbers of cells are attained for efficient differentiation to the cell type of interest. For example cardiomyocytes, to treat a patient with myocardial infarction, the hypothetical number of cardiomyocytes required has been estimated at approximately 1-210.sup.9 cells. Current use of mini-bioreactors or suspended embryoid bodies for differentiation cultures have reported low yields of cardiomyocyte generation from 3.110.sup.4 to 1.110.sup.5 cardiomyocytes per ml.
(110) With these factors in mind, conventional PSC, 3D expansion techniques utilise media that contain one or more undefined components, use enzymatic or other passage methods that subsequently require cell death inhibitors, or maintain low expansion rates no better than 2D equivalents limiting the potential for scale up.
(111) The present invention provides a unique solution to at least some of the problems with hPSC culture. Compositions according to the invention can offer excellent biocompatibility and allow cellular growth and subsequent non-enzymatic release of cells using an applied non-invasive stimulus.
(112) The unique compositions according to the invention can offer advantages over conventional cell culture compositions/techniques, including: 1) the inclusion of different growth factors or ECM fragments that can be tuned on demand, 2) non-invasive stimuli can be used to promote release of the cells, which is gentler on the cells, thereby removing the need for enzymes or ROCKi, and 3) composition is easily transferable between 2D and 3D environments thus making it applicable for therapeutic applications.
(113) In one embodiment for cell culture, a composition in accordance with the invention may comprise polymer particles and functionalised stimulus responsive polymer within an aqueous liquid. The block co-polymer of the polymer particles may comprise (a) a hydrophobic non-stimulus responsive polymer block that forms at least part of the core structure and is insoluble within the aqueous liquid, and (b) a thermo-responsive polymer block that forms at least part of the shell structure, and below it's LCST is soluble within the aqueous liquid. The functionalised stimulus responsive polymer may be a functionalised thermo-responsive polymer, with the thermoresponsive polymer (a) having the same LCST as the thermo-responsive polymer block that forms at least part of the shell structure, and (b) below it's LCST is soluble within the aqueous liquid. At a temperature below the LCST the polymer particles and the functionalised thermo-responsive polymer present as separate and discrete entities.
(114) Subjecting the liquid to an increase in temperature above the LCST of the thermo-responsive polymer of both the polymer particles and the functionalised thermo responsive polymer causes the hydrophilic character of the thermo-responsive polymer to transition from being soluble in the aqueous liquid to being hydrophobic in character and insoluble in the aqueous liquid. This transition causes the polymer particles and functionalised thermo-responsive polymer to associate and form an aggregate structure.
(115) Formation of the aggregate structure gives rise to a release medium from which the functionalised thermo-responsive polymer or a modified form thereof can subsequently be released.
(116) Where the polymer particles are secured to a substrate, the so formed release medium can present on the surface of that substrate. For example, the polymer particles may be secured to a substrate such as a layer of mouse embryonic fibroblasts (MEF). The functionalised thermo-responsive polymer in that case may be a protein functionalised thermo-responsive polymer, where the protein is capable of binding with a desired cell type. When the liquid is below the LCST, the polymer particles and the protein functionalised thermo-responsive polymer will present as discrete separate entities.
(117) Upon heating the liquid to or above the LCST, the protein functionalised thermo-responsive polymer will aggregate onto and be retained by the tethered polymer particles so as to form an aggregate structure that serves as the release medium. In that state, the surface of the polymer particles may be replete with protein from the protein functionalised thermo-responsive polymer. One or more cells capable of binding with the protein component of the protein functionalised stimulus responsive can then be introduced to the liquid. The one or more cells may then bind with the protein and proliferate across this protein rich surface, with new cells also binding with the proteins. Proliferation of cells in this way may provide conditions that can advantageously sustain cell pluripotency and viability.
(118) Reducing the temperature of the liquid to below the LCST after sufficient proliferation has taken place can promote disassociation of the aggregate structure which in turn can facilitate release of the now cell functionalised thermo-responsive polymer. In other words, the cultured cells can advantageously be released for harvest from the substrate in an effective and non-invasive manner.
(119) Examples of such substrates include, glass, metal, ceramic, plastic, feeder cells (e.g. fibroblasts such as mouse embryonic fibroblasts, and combinations thereof.
(120) In one embodiment, the present invention therefore provides a method of culturing cells, said method comprising: (i) providing a liquid composition comprising a liquid, polymer particles secured to a substrate and cell receptor ligand functionalised stimulus responsive polymer; the polymer particles (a) comprising block co-polymer, and (b) having a core-shell structure, said block co-polymer comprising (a) a non-stimulus responsive polymer block that forms at least part of the core structure, and (b) a stimulus responsive polymer block that forms at least part of the shell structure; wherein the stimulus responsive polymer of both the polymer particles and the cell receptor ligand functionalised stimulus responsive polymer are (a) responsive to at least one common stimulus, and (b) soluble in the liquid; (ii) subjecting the liquid composition to said common stimulus so as to cause the stimulus responsive polymer of both the polymer particles and the cell receptor ligand functionalised stimulus responsive polymer to transition from being soluble in the liquid to being insoluble in the liquid, wherein said transition promotes aggregation of the polymer particles and the cell receptor ligand functionalised stimulus responsive polymer to form an aggregate structure with a surface comprising the cell receptor ligand; (iii) introducing to the liquid one or more cells that are to be cultured such that it or they bind with a cell receptor ligand; and (iv) culturing cells upon said surface comprising the cell receptor ligand.
(121) This method may further comprise a step of: (v) subjecting the liquid composition comprising the cultured cells to said common stimulus so as to cause the stimulus responsive polymer of both the polymer particles and the cell receptor ligand functionalised stimulus responsive polymer to transition from being insoluble in the liquid to being soluble in the liquid, wherein said transition facilitates release of said cultured cells.
(122) This method may also further comprise a step of (vi) removing from the liquid composition at least some of the cultured cells formed in step (v).
(123) This method may also further comprise a step of (vii) repeating one or more of steps (i)-(v) after step (vi) so as to culture further cells upon said surface comprising cell receptor ligand.
(124) In a further embodiment, the present invention also provides a method of culturing cells, said method comprising: (i) providing a gel composition comprising a liquid, polymer particles and cell receptor ligand functionalised stimulus responsive polymer; the polymer particles (a) comprising block co-polymer, and (b) having a core-shell structure, said block co-polymer comprising (a) a non-stimulus responsive polymer block that forms at least part of the core structure, and (b) a stimulus responsive polymer block that forms at least part of the shell structure; wherein the stimulus responsive polymer of both the polymer particles and the cell functionalised stimulus responsive polymer are (a) responsive to at least one common stimulus, and (b) insoluble in the liquid; (ii) introducing to the gel one or more cells that are to be cultured such that it or they bind with a cell receptor ligand; and (iii) culturing cells on and/or within the gel.
(125) This method may further comprise a step of: (iv) subjecting the gel comprising the cultured cells to said common stimulus so as to cause the stimulus responsive polymer of both the polymer particles and the cell receptor ligand functionalised stimulus responsive polymer to transition from being insoluble in the liquid to being soluble in the liquid, wherein said transition facilitates release of said cultured cells.
(126) This method may also further comprise a step of: (v) removing from the liquid composition at least some of the cultured cells formed in step (iv).
(127) This method may also further comprise a step of: (vi) repeating one or more of steps (i)-(iv) after step (v) so as to culture further cells on and/or within the gel.
(128) Where the polymer particles are free to move (i.e. they are not secured to a fixed or non-mobile substrate), by maintaining the temperature of the liquid below the LCST the functionalised thermo-responsive polymer and the polymer particles will present as separate discrete entities in the liquid, and by increasing the temperature of the liquid above the LCST the functionalised thermo-responsive polymer and the polymer particles will associate to form three dimensional aggregate structures. The functionalised thermo-responsive polymer in that case may also be a protein functionalised thermo-responsive polymer, where the protein is capable of binding with a desired cell type.
(129) In that case, when the temperature of the liquid is below the LCST a plurality of desired cells can be introduced such that the cells bind to protein presented by the protein functionalised thermo-responsive polymer to in effect form cell functionalised thermo responsive polymer. More than one protein functionalised thermo-responsive polymer will typically, bind with each cell.
(130) The temperature of the liquid can then be increased to above the LCST which will cause the now cell functionalised thermo-responsive polymer and the polymer particles to associate and form an aggregate structure. In forming the aggregate structure, cells of the cell functionalised thermo-responsive polymer will inherently form clusters, with the aggregate structure of the polymer particles and the cell functionalised thermo-responsive polymer representing a release medium from which the retained cell functionalised thermo-responsive polymer may be released.
(131) Cells within the so formed cell clusters may then proliferate to form larger cell clusters. Proliferation of cells in this way may provide conditions that can advantageously sustain cell pluripotency and viability.
(132) Reducing the temperature of the liquid to below the LCST after sufficient proliferation has taken place can promote disassociation of the aggregate structure which in turn can facilitate release of the cell functionalised thermo-responsive polymer and consequent break up of the cell clusters. In other words, the composition according to the invention advantageously enables cells to be cultured in cell clusters dispersed within a liquid where the cultured cell clusters can subsequently be broken up into individual cells and/or smaller cell clusters in an effective and non-invasive manner.
(133) According to this form of the invention, once the cultured cell clusters have been broken down into individual cells and/or smaller cell clusters, additional protein functionalised thermo-responsive polymer can be introduced at a temperature below the LCST and the cell culture process repeated. In this way cells can advantageously cultured and harvested in a continuous cyclic process.
(134) In one embodiment, the present invention therefore provides a method of culturing cells, said method comprising: (i) providing a liquid composition comprising a liquid, polymer particles and cell functionalised stimulus responsive polymer; the polymer particles (a) comprising block co-polymer, and (b) having a core-shell structure, said block co-polymer comprising (a) a non-stimulus responsive polymer block that forms at least part of the core structure, and (b) a stimulus responsive polymer block that forms at least part of the shell structure; wherein the stimulus responsive polymer of both the polymer particles and the cell functionalised stimulus responsive polymer are (a) responsive to at least one common stimulus, and (b) soluble in the liquid; (ii) subjecting the liquid composition to said common stimulus so as to cause the stimulus responsive polymer of both the polymer particles and the cell functionalised stimulus responsive polymer to transition from being soluble in the liquid to being insoluble in the liquid, wherein said transition promotes aggregation of the polymer particles and the cell functionalised stimulus responsive polymer to form cell clusters; and (iii) culturing cells within and/or on said cell clusters.
(135) This method may further comprise a step of: (iv) subjecting the liquid composition comprising the cultured cells to said common stimulus so as to cause the stimulus responsive polymer of both the polymer particles and the cell functionalised stimulus responsive polymer to transition, from being insoluble in the liquid to being soluble in the liquid, wherein said transition facilitates release from said cell clusters of individual cells and/or smaller cell clusters.
(136) This method may also further comprise a step of: (v) removing from the liquid composition at least some of the so formed individual cells and/or smaller cell clusters formed in step (iv).
(137) This method may also further comprise a step of: (vi) repeating one or more of steps (i)-(iv) after step (v) so as to culture further cells within and/or on the so formed cell clusters.
(138) Methods of culturing cells according to the invention can advantageously be performed continuously such that cells can be repeatedly cultured and then harvested.
(139) Where the polymer particles are present within the liquid at a concentration equal to or above the particles CGC, upon heating the liquid above the LCST the liquid will instead be transformed into a gel and cell culture may alternatively be conducted as herein described.
(140) Thus, in the form of a gel composition the invention can advantageously be used to retain matter such as drugs and/or biological material that present as the functional entity of the functionalised stimulus responsive polymer.
(141) Where the functional entity of the functionalised stimulus responsive polymer is a drug, the composition in the form of a gel can advantageously be used as a release media for that drug. Such a drug release media may be provided in any desired shape, for example with the gel taking on the shape of the container within which the gel was formed.
(142) Gel formed using the composition of the invention has excellent stability and can be maintained in a gel state for days, months and even years.
(143) Provided a given drug also has adequate stability, a composition according to the invention in the form of a gel which comprises the drug can also advantageously remain in a stable gel state for days, months and even years.
(144) Where the composition in accordance with the invention is to be used for cell culture, the functional entity of the functionalised stimulus responsive polymer used will generally be a cell receptor ligand such as a protein that can bind with the cell(s) of interest. A combination of different receptor ligand functionalised stimulus responsive polymers may be used. For example, one or more receptor ligands may be selected to provide for a particular function. Generally, a selected receptor ligand will at the very least be capable of binding to a cell. However, a given receptor ligand may also be selected to promote survival and/or proliferation of a cell (e.g. growth factor proteins).
(145) In one embodiment, the functionalised stimulus responsive polymer used in accordance with the invention is a cell receptor ligand functionalised stimulus responsive polymer.
(146) A composition in accordance with the invention in the form of the gel might be prepared using a cell receptor ligand functionalised stimulus responsive polymer, whereby the cell receptor ligand is selected such that it can bind with a desired cell(s). Seed cells can then be introduced to the formed gel such that they migrate and bind with the cell receptor ligand of the cell receptor ligand functionalised stimulus responsive polymer. The resulting gel can then be used to culture the cells.
(147) Alternatively, at least some of such cell receptor ligand functionalised stimulus responsive polymer can first be bound to a cell(s) prior to forming the gel, and the resulting cell functionalised stimulus responsive polymer, optionally in conjunction with cell receptor ligand functionalised stimulus responsive polymer, used in forming the gel. In that case, cell functionalised stimulus responsive polymer (to function as a seed cell), optionally in conjunction with cell receptor ligand functionalised stimulus responsive polymer, is contained and subsequently retained within the gel upon its formation. The resulting gel can then be used for cell culture.
(148) Where the compositions are to be used in the formation of a gel for cell culture, that gel may be formed on a substrate (as herein described), and cells allowed to proliferate within and/or on the gel. Upon forming a gel in accordance with the invention, the gel can advantageously adhere to the surface upon which the gel is formed. For example, the gel may be formed within a plastic container. In that case, the so formed gel can advantageously adhere to the surface of that container.
(149) Cell receptor ligand functionalised stimulus responsive polymer used in accordance with the invention may be prepared using techniques known in the art. For example, the cell receptor ligand may be a protein and the stimulus responsive polymer-protein conjugate can be prepared using a SS coupling reaction.
(150) A given cell may bind with more than one cell receptor ligand functionalised stimulus responsive polymer chains. Equally, a given cell receptor ligand functionalised stimulus responsive polymer chain may bind with more than one cell.
(151) Cells may be cultured in accordance with the invention using conventional cell culture methodology. For example, cells may be cultured in both 2D and 3D formats.
(152) Compositions in accordance with the invention can advantageously allow cells to maintain pluripotency during cell growth and expansion. The compositions achieve this at least in part by providing a support for the cells to aggregate in either static or suspension culture. The compositions can also be designed to incorporate the required cellular cues to maintain the pluripotent state, for example through integrin signalling and interaction with integrin binding molecules.
(153) An important feature of the invention is that upon forming the aggregate structure of the polymer particles and functionalised stimulus responsive polymer, the functionalised stimulus responsive polymer can be released from that structure by subjecting the structure to a stimulus, such as a change in temperature. It will be appreciated that the functional entity of the functionalised stimulus responsive polymer used at the outset to form the aggregate structure may or may not present in the same form at the time of being released from aggregate structure.
(154) For example, the functional entity of the functionalised stimulus responsive polymer may be a drug, and it is this drug functionalised stimulus responsive polymer that is ultimately released from the aggregate structure.
(155) As a further example, the functional entity of the functionalised stimulus responsive polymer may be a cell receptor ligand. Where the composition is used for cell culture, that cell receptor ligand may bind with a cell during cell culture and the functionalised stimulus responsive polymer might then best be described as a cell functionalised stimulus responsive polymer. In that case, the cell receptor ligand functionalised stimulus responsive polymer is still released from the aggregate structure albeit in a modified form with a cell attached to it.
(156) In one embodiment, the functionalised stimulus responsive polymer is provided with a biodegradable coupling between the functional entity (e.g. drug or cell receptor ligand) and the stimulus responsive polymer such that upon release from the release medium the biodegradable coupling degrades and the functional entity is cleaved from the stimulus responsive polymer.
(157) Where the compositions in accordance with the invention are used for cell culture, release of cell functionalised stimulus responsive polymer from the aggregate structure can be promoted by, for example, subjecting the aggregate structure to a stimulus, such as lowering it's temperature, whereby the stimulus responsive polymer of both the polymer particles and the functionalised stimulus responsive polymer become soluble in the liquid within which the aggregate structure is contained. Release of cell functionalised stimulus responsive polymer can also be facilitated by application of mechanical shear stress.
(158) In this specification optionally substituted is taken to mean that a group may or may not be substituted or fused (so as to form a condensed polycyclic group) with one, two, three or more of organic and inorganic groups, including those selected from: alkyl, alkenyl, alkynyl, carbocyclyl, aryl, heterocyclyl, heteroaryl, acyl, aralkyl, alkaryl, alkheterocyclyl, alkheteroaryl, alkcarbocyclyl, halo, haloalkyl, haloalkenyl, haloalkynyl, haloaryl, halocarbocyclyl, haloheterocyclyl, haloheteroaryl, haloacyl, haloaryalkyl, hydroxy, hydroxyalkyl, hydroxyalkenyl, hydroxyalkynyl, hydroxycarbocyclyl, hydroxyaryl, hydroxyheterocyclyl, hydroxyheteroaryl, hydroxyacyl, hydroxyaralkyl, alkoxyalkyl, alkoxyalkenyl, alkoxyalkynyl, alkoxycarbocyclyl, alkoxyaryl, alkoxyheterocyclyl, alkoxyheteroaryl, alkoxyacyl, alkoxyaralkyl, alkoxy, alkenyloxy, alkynyloxy, aryloxy, carbocyclyloxy, aralkyloxy, heteroaryloxy, heterocyclyloxy, acyloxy, haloalkoxy, haloalkenyloxy, haloalkynyloxy, haloaryloxy, halocarbocyclyloxy, haloaralkyloxy, haloheteroaryloxy, haloheterocyclyloxy, haloacyloxy, nitro, nitroalkyl, nitroalkenyl, nitroalkynyl, nitroaryl, nitroheterocyclyl, nitroheteroayl, nitrocarbocyclyl, nitroacyl, nitroaralkyl, amino (NH.sub.2), alkylamino, dialkylamino, alkenylamino, alkynylamino, arylamino, diarylamino, aralkylamino, diaralkylamino, acylamino, diacylamino, heterocyclamino, heteroarylamino, carboxy, carboxyester, amido, alkylsulphonyloxy, arylsulphenyloxy, alkylsulphenyl, arylsulphenyl, thio, alkylthio, alkenylthio, alkynylthio, arylthio, aralkylthio, carbocyclylthio, heterocyclylthio, heteroarylthio, acylthio, sulfoxide, sulfonyl, sulfonamide, aminoalkyl, aminoalkenyl, aminoalkynyl, aminocarbocyclyl, aminoaryl, aminoheterocyclyl, aminoheteroaryl, aminoacyl, aminoaralkyl, thioalkyl, thioalkenyl, thioalkynyl, thiocarbocyclyl, thioaryl, thioheterocyclyl, thioheteroaryl, thioacyl, thioaralkyl, carboxyalkyl, carboxyalkenyl, carboxyalkynyl, carboxycarbocyclyl, carboxyaryl, carboxyheterocyclyl, carboxyheteroaryl, carboxyacyl, carboxyaralkyl, carboxyesteralkyl, carboxyesteralkenyl, carboxyesteralkynyl, carboxyestercarbocyclyl, carboxyesteraryl, carboxyesterheterocyclyl, carboxyesterheteroaryl, carboxyesteracyl, carboxyesteraralkyl, amidoalkyl, amidoalkenyl, amidoalkynyl, amidocarbocyclyl, amidoaryl, amidoheterocyclyl, amidoheteroaryl, amidoacyl, amidoaralkyl, formylalkyl, formylalkenyl, formylalkynyl, formylcarbocyclyl, formylaryl, formylheterocyclyl, formylheteroaryl, formylacyl, formylaralkyl, acylalkyl, acylalkenyl, acylalkynyl, acylcarbocyclyl, acylaryl, acylheterocyclyl, acylheteroaryl, acylacyl, acylaralkyl, sulfoxidealkyl, sulfoxidealkenyl, sulfoxidealkynyl, sulfoxidecarbocyclyl, sulfoxidearyl, sulfoxideheterocyclyl, sulfoxideheteroaryl, sulfoxideacyl, sulfoxidearalkyl, sulfonylalkyl, sulfonylalkenyl, sulfonylalkynyl, sulfonylcarbocyclyl, sulfonylaryl, sulfonylheterocyclyl, sulfonylheteroaryl, sulfonylacyl, sulfonylaralkyl, sulfonamidoalkyl, sulfonamidoalkenyl, sulfonamidoalkynyl, sulfonamidocarbocyclyl, sulfonamidoaryl, sulfonamidoheterocyclyl, sulfonamidoheteroaryl, sulfonamidoacyl, sulfonamidoaralkyl, nitroalkyl, nitroalkenyl, nitroalkynyl, nitrocarbocyclyl, nitroaryl, nitroheterocyclyl, nitroheteroaryl, nitroacyl, nitroaralkyl, cyano, sulfate, phosphate, triarylmethyl, triarylamino, oxadiazole, and carbazole groups. Optional substitution may also be taken to refer to where a CH.sub.2 group in a chain or ring is replaced by a group selected from O, S, NR.sup.a, C(O) (i.e. carbonyl), C(O)O (i.e. ester), and C(O)NR.sup.a (i.e. amide), where R.sup.a is as defined herein.
(159) Preferred optional substituents include alkyl, (e.g. C.sub.1-6 alkyl such as methyl, ethyl, propyl, butyl, cyclopropyl, cyclobutyl, cyclopentyl or cyclohexyl), hydroxyalkyl (e.g. hydroxymethyl, hydroxyethyl, hydroxypropyl), alkoxyalkyl (e.g. methoxymethyl, methoxyethyl, methoxypropyl, ethoxymethyl, ethoxyethyl, ethoxypropyl etc) alkoxy (e.g. C.sub.1-6 alkoxy such as methoxy, ethoxy, propoxy, butoxy, cyclopropoxy, cyclobutoxy), halo, trifluoromethyl, trichloromethyl, tribromomethyl, hydroxy, phenyl (which itself may be further substituted e.g., by C.sub.1-6 alkyl, halo, hydroxy, hydroxyC.sub.1-6 alkyl, C.sub.1-6 alkoxy, haloC.sub.1-6alkyl, cyano, nitro OC(O)C.sub.1-6 alkyl, and amino), benzyl (wherein benzyl itself may be further substituted e.g., by C.sub.1-6 alkyl, halo, hydroxy, hydroxyC.sub.1-6alkyl, C.sub.1-6 alkoxy, haloC.sub.1-6 alkyl, cyano, nitro OC(O)C.sub.1-6 alkyl, and amino), phenoxy (wherein phenyl itself may be further substituted e.g., by C.sub.1-6 alkyl, halo, hydroxy, hydroxyC.sub.1-6 alkyl, C.sub.1-6 alkoxy, haloC.sub.1-6 alkyl, cyano, nitro OC(O)C.sub.1-6 alkyl, and amino), benzyloxy (wherein benzyl itself may be further substituted e.g., by C.sub.1-6 alkyl, halo, hydroxy, hydroxyC.sub.1-6 alkyl, C.sub.1-6 alkoxy, haloC.sub.1-6 alkyl, cyano, nitro OC(O)C.sub.1-6 alkyl, and amino), amino, alkylamino (e.g. C.sub.1-6 alkyl, such as methylamino, ethylamino, propylamino etc), dialkylamino (e.g. C.sub.1-6 alkyl, such as dimethylamino, diethylamino, dipropylamino), acylamino (e.g. NHC(O)CH.sub.3), phenylamino (wherein phenyl itself may be further substituted e.g., by C.sub.1-6 alkyl, halo, hydroxy, hydroxyC.sub.1-6 alkyl, C.sub.1-6 alkoxy, haloC.sub.1-6 alkyl, cyano, nitro OC(O)C.sub.1-6 alkyl, and amino), nitro, formyl, C(O)-alkyl (e.g. C.sub.1-6 alkyl, such as acetyl), 0-C(O)-alkyl (e.g. C.sub.1. 6alkyl, such as acetyloxy), benzoyl (wherein the phenyl group itself may be further substituted e.g., by C.sub.1-6 alkyl, halo, hydroxy hydroxyC.sub.1-6 alkyl, C.sub.1-6 alkoxy, haloC.sub.1-6 alkyl, cyano, nitro OC(O)C.sub.1-6alkyl, and amino), replacement of CH.sub.2 with CO, CO.sub.2H, CO.sub.2alkyl (e.g. C.sub.1-6 alkyl such as methyl ester, ethyl ester, propyl ester, butyl ester), CO.sub.2phenyl (wherein phenyl itself may be further substituted e.g., by C.sub.1-6 alkyl, halo, hydroxy, hydroxyl C.sub.1-6 alkyl, C.sub.1-6 alkoxy, halo C.sub.1-6 alkyl, cyano, nitro OC(O)C.sub.1-6 alkyl, and amino), CONH.sub.2, CONHphenyl (wherein phenyl itself may be further substituted e.g., by C.sub.1-6 alkyl, halo, hydroxy, hydroxyl C.sub.1-6 alkyl, C.sub.1-6 alkoxy, halo C.sub.1-6 alkyl, cyano, nitro OC(O)C.sub.1-6 alkyl, and amino), CONHbenzyl (wherein benzyl itself may be further substituted e.g., by C.sub.1-6 alkyl, halo, hydroxy hydroxyl C.sub.1-6 alkyl, C.sub.1-6 alkoxy, halo C.sub.1-6 alkyl, cyano, nitro OC(O)C.sub.1-6 alkyl, and amino), CONHalkyl (e.g. C.sub.1-6 alkyl such as methyl ester, ethyl ester, propyl ester, butyl amide) CONHdialkyl (e.g. C.sub.1-6 alkyl) aminoalkyl (e.g., HNC.sub.1-6 alkyl-, C.sub.1-6alkylHNC.sub.1-6 alkyl- and (C.sub.1-6 alkyl).sub.2NC.sub.1-6 alkyl-), thioalkyl (e.g., HSC.sub.1-6 alkyl-), carboxyalkyl (e.g., HO.sub.2CC.sub.1-6 alkyl-), carboxyesteralkyl (e.g., C.sub.1-6 alkylO.sub.2CC.sub.1-6 alkyl-), amidoalkyl (e.g., H.sub.2N(O)CC.sub.1-6 alkyl-, H(C.sub.1-6 alkyl)N(O)CC.sub.1-6 alkyl-), formylalkyl (e.g., OHCC.sub.1-6alkyl-), acylalkyl (e.g., C.sub.1-6 alkyl(O)CC.sub.1-6 alkyl-), nitroalkyl (e.g., O.sub.2NC.sub.1-6 alkyl-), sulfoxidealkyl (e.g., R(O)SC.sub.1-6 alkyl, such as C.sub.1-6 alkyl(O)SC.sub.1-6 alkyl-), sulfonylalkyl (e.g., R(O).sub.2SC.sub.1-6 alkyl- such as C.sub.1-6 alkyl(O).sub.2SC.sub.1-6 alkyl-), sulfonamidoalkyl (e.g., .sub.2HRN(O)SC.sub.1-6 alkyl, H(C.sub.1-6 alkyl)N(O)SC.sub.1-6 alkyl-), triarylmethyl, triarylamino, oxadiazole, and carbazole.
(160) As used herein, the term alkyl, used either alone or in compound words denotes straight chain, branched or cyclic alkyl, preferably C.sub.1-20 alkyl, e.g. C.sub.1-10 or C.sub.1-6. Examples of straight chain and branched alkyl include methyl, ethyl, n-propyl, isopropyl, n-butyl, sec-butyl, t-butyl, n-pentyl, 1,2-dimethylpropyl, 1,1-dimethyl-propyl, hexyl, 4-methylpentyl, 1-methylpentyl, 2-methylpentyl, 3-methylpentyl, 1,1-dimethylbutyl, 2,2-dimethylbutyl, 3,3-dimethylbutyl, 1,2-dimethylbutyl, 1,3-dimethylbutyl, 1,2,2-trimethylpropyl, 1,1,2-trimethylpropyl, heptyl, 5-methylhexyl, 1-methylhexyl, 2,2-dimethylpentyl, 3,3-dimethylpentyl, 4,4-dimethylpentyl, 1,2-dimethylpentyl, 1,3-dimethylpentyl, 1,4-dimethyl-pentyl, 1,2,3-trimethylbutyl, 1,1,2-trimethylbutyl, 1,1,3-trimethylbutyl, octyl, 6-methylheptyl, 1-methylheptyl, 1,1,3,3-tetramethylbutyl, nonyl, 1-, 2-, 3-, 4-, 5-, 6- or 7-methyloctyl, 1-, 2-, 3-, 4- or 5-ethylheptyl, 1-, 2- or 3-propylhexyl, decyl, 1-, 2-, 3-, 4-, 5-, 6-, 7- and 8-methylnonyl, 1-, 2-, 3-, 4-, 5- or 6-ethyloctyl, 1-, 2-, 3- or 4-propylheptyl, undecyl, 1-, 2-, 3-, 4-, 5-, 6-, 7-, 8- or 9-methyldecyl, 1-, 2-, 3-, 4-, 5-, 6- or 7-ethylnonyl, 1-, 2-, 3-, 4- or 5-propyloctyl, 1-, 2- or 3-butylheptyl, 1-pentylhexyl, dodecyl, 1-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9- or 10-methylundecyl, 1-, 2-, 3-, 4-, 5-, 6-, 7- or 8-ethyldecyl, 1-, 2-, 3-, 4-, 5- or 6-propylnonyl, 1-, 2-, 3- or 4-butyloctyl, 1-2-pentylheptyl and the like. Examples of cyclic alkyl include mono- or polycyclic alkyl groups such as cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, cyclooctyl, cyclononyl, cyclodecyl and the like. Where an alkyl group is referred to generally as propyl, butyl etc, it will be understood that this can refer to any of straight, branched and cyclic isomers where appropriate. An alkyl group may be optionally substituted by one or more optional substituents as herein defined.
(161) The term alkenyl as used herein denotes groups formed from straight chain, branched or cyclic hydrocarbon residues containing at least one carbon to carbon double bond including ethylenically mono-, di- or polyunsaturated alkyl or cycloalkyl groups as previously defined, preferably C.sub.2-20 alkenyl (e.g. C.sub.2-10 or C.sub.2-6). Examples of alkenyl include vinyl, allyl, 1-methylvinyl, butenyl, iso-butenyl, 3-methyl-2-butenyl, 1-pentenyl, cyclopentenyl, 1-methyl-cyclopentenyl, 1-hexenyl, 3-hexenyl, cyclohexenyl, 1-heptenyl, 3-heptenyl, 1-octenyl, cyclooctenyl, 1-nonenyl, 2-nonenyl, 3-nonenyl, 1-decenyl, 3-decenyl, 1,3-butadienyl, 1,4-pentadienyl, 1,3-cyclopentadienyl, 1,3-hexadienyl, 1,4-hexadienyl, 1,3-cyclohexadienyl, 1,4-cyclohexadienyl, 1,3-cycloheptadienyl, 1,3,5-cycloheptatrienyl and 1,3,5,7-cyclooctatetraenyl. An alkenyl group may be optionally substituted by one or more optional substituents as herein defined.
(162) As used herein the term alkynyl denotes groups formed from straight chain, branched or cyclic hydrocarbon residues containing at least one carbon-carbon triple bond including ethylenically mono-, di- or polyunsaturated alkyl or cycloalkyl groups as previously defined. Unless the number of carbon atoms is specified the term preferably refers to C.sub.2-20 alkynyl (e.g. C.sub.2-10 or C.sub.2-6). Examples include ethynyl, 1-propynyl, 2-propynyl, and butynyl isomers, and pentynyl isomers. An alkynyl group may be optionally substituted by one or more optional substituents as herein defined.
(163) The term halogen (halo) denotes fluorine, chlorine, bromine or iodine (fluoro, chloro, bromo or iodo).
(164) The term aryl (or carboaryl) denotes any of single, polynuclear, conjugated and fused residues of aromatic hydrocarbon ring systems (e.g. C.sub.6-24 or C.sub.6-18). Examples of aryl include phenyl, biphenyl, terphenyl, quaterphenyl, naphthyl, tetrahydronaphthyl, anthracenyl, dihydroanthracenyl, benzanthracenyl, dibenzanthracenyl, phenanthrenyl, fluorenyl, pyrenyl, idenyl, azulenyl, chrysenyl. Preferred aryl include phenyl and naphthyl. An aryl group may or may not be optionally substituted by one or more optional substituents as herein defined. The term arylene is intended to denote the divalent form of aryl.
(165) The term carbocyclyl includes any of non-aromatic monocyclic, polycyclic, fused or conjugated hydrocarbon residues, preferably C.sub.3-20 (e.g. C.sub.3-10 or C.sub.3-8). The rings may be saturated, e.g. cycloalkyl, or may possess one or more double bonds (cycloalkenyl) and/or one or more triple bonds (cycloalkynyl). Particularly preferred carbocyclyl moieties are 5-6-membered or 9-10 membered ring systems. Suitable examples include cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, cyclooctyl, cyclononyl, cyclodecyl, cyclopentenyl, cyclohexenyl, cyclooctenyl, cyclopentadienyl, cyclohexadienyl, cyclooctatetraenyl, indanyl, decalinyl and indenyl. A carbocyclyl group may be optionally substituted by one or more optional substituents as herein defined. The term carbocyclylene is intended to denote the divalent form of carbocyclyl.
(166) The term heteroatom or hetero as used herein in its broadest sense refers to any atom other than a carbon atom which may be a member of a cyclic organic group. Particular examples of heteroatoms include nitrogen, oxygen, sulfur, phosphorous, boron, silicon, selenium and tellurium, more particularly nitrogen, oxygen and sulfur.
(167) The term heterocyclyl when used alone or in compound words includes any of monocyclic, polycyclic, fused or conjugated hydrocarbon residues, preferably C.sub.3-20 (e.g. C.sub.3-10 or C.sub.3-8) wherein one or more carbon atoms are replaced by a heteroatom so as to provide a non-aromatic residue. Suitable heteroatoms include O, N, S, P and Se, particularly O, N and S. Where two or more carbon atoms are replaced, this may be by two or more of the same heteroatom or by different heteroatoms. The heterocyclyl group may be saturated or partially unsaturated, i.e. possess one or more double bonds. Particularly preferred heterocyclyl are 5-6 and 9-10 membered heterocyclyl. Suitable examples of heterocyclyl groups may include azridinyl, oxiranyl, thiiranyl, azetidinyl, oxetanyl, thietanyl, 2H-pyrrolyl, pyrrolidinyl, pyrrolinyl, piperidyl, piperazinyl, morpholinyl, indolinyl, imidazolidinyl, imidazolinyl, pyrazolidinyl, thiomorpholinyl, dioxanyl, tetrahydrofuranyl, tetrahydropyranyl, tetrahydropyrrolyl, tetrahydrothiophenyl, pyrazolinyl, dioxalanyl, thiazolidinyl, isoxazolidinyl, dihydropyranyl, oxazinyl, thiazinyl, thiomorpholinyl, oxathianyl, dithianyl, trioxanyl, thiadiazinyl, dithiazinyl, trithianyl, azepinyl, oxepinyl, thiepinyl, indenyl, indanyl, 3H-indolyl, isoindolinyl, 4H-quinolazinyl, chromenyl, chromanyl, isochromanyl, pyranyl and dihydropyranyl. A heterocyclyl group may be optionally substituted by one or more optional substituents as herein defined. The term heterocyclylene is intended to denote the divalent form of heterocyclyl.
(168) The term heteroaryl includes any of monocyclic, polycyclic, fused or conjugated hydrocarbon residues, wherein one or more carbon atoms are replaced by a heteroatom so as to provide an aromatic residue. Preferred heteroaryl have 3-20 ring atoms, e.g. 3-10. Particularly preferred heteroaryl are 5-6 and 9-10 membered bicyclic ring systems. Suitable heteroatoms include, O, N, S, P and Se, particularly O, N and S. Where two or more carbon atoms are replaced, this may be by two or more of the same heteroatom or by different heteroatoms. Suitable examples of heteroaryl groups may include pyridyl, pyrrolyl, thienyl, imidazolyl, furanyl, benzothienyl, isobenzothienyl, benzofuranyl, isobenzofuranyl, indolyl, isoindolyl, pyrazolyl, pyrazinyl, pyrimidinyl, pyridazinyl, indolizinyl, quinolyl, isoquinolyl, phthalazinyl, 1,5-naphthyridinyl, quinozalinyl, quinazolinyl, quinolinyl, oxazolyl, thiazolyl, isothiazolyl, isoxazolyl, triazolyl, oxadialzolyl, oxatriazolyl, triazinyl, and furazanyl. A heteroaryl group may be optionally substituted by one or more optional substituents as herein defined. The term heteroarylene is intended to denote the divalent form of heteroaryl.
(169) The term acyl either alone or in compound words denotes a group containing the moiety CO (and not being a carboxylic acid, ester or amide) Preferred acyl includes C(O)R.sup.e, wherein R.sup.e is hydrogen or an alkyl, alkenyl, alkynyl, aryl, heteroaryl, carbocyclyl, or heterocyclyl residue. Examples of acyl include formyl, straight chain or branched alkanoyl (e.g. C.sub.1-20) such as acetyl, propanoyl, butanoyl, 2-methylpropanoyl, pentanoyl, 2,2-dimethylpropanoyl, hexanoyl, heptanoyl, octanoyl, nonanoyl, decanoyl, undecanoyl, dodecanoyl, tridecanoyl, tetradecanoyl, pentadecanoyl, hexadecanoyl, heptadecanoyl, octadecanoyl, nonadecanoyl and icosanoyl; cycloalkylcarbonyl such as cyclopropylcarbonyl cyclobutylcarbonyl, cyclopentylcarbonyl and cyclohexylcarbonyl; aroyl such as benzoyl, toluoyl and naphthoyl; aralkanoyl such as phenylalkanoyl (e.g. phenylacetyl, phenylpropanoyl, phenylbutanoyl, phenylisobutylyl, phenylpentanoyl and phenylhexanoyl) and naphthylalkanoyl (e.g. naphthylacetyl, naphthylpropanoyl and naphthylbutanoyl]; aralkenoyl such as phenylalkenoyl (e.g. phenylpropenoyl, phenylbutenoyl, phenylmethacryloyl, phenylpentenoyl and phenylhexenoyl and naphthylalkenoyl (e.g. naphthylpropenoyl, naphthylbutenoyl and naphthylpentenoyl); aryloxyalkanoyl such as phenoxyacetyl and phenoxypropionyl; arylthiocarbamoyl such as phenylthiocarbamoyl; arylglyoxyloyl such as phenylglyoxyloyl and naphthylglyoxyloyl; arylsulfonyl such as phenylsulfonyl and napthylsulfonyl; heterocycliccarbonyl; heterocyclicalkanoyl such as thienylacetyl, thienylpropanoyl, thienylbutanoyl, thienylpentanoyl, thienylhexanoyl, thiazolylacetyl, thiadiazolylacetyl and tetrazolylacetyl; heterocyclicalkenoyl such as heterocyclicpropenoyl, heterocyclicbutenoyl, heterocyclicpentenoyl and heterocyclichexenoyl; and heterocyclicglyoxyloyl such as thiazolyglyoxyloyl and thienylglyoxyloyl. The R.sup.e residue may be optionally substituted as described herein.
(170) The term sulfoxide, either alone or in a compound word, refers to a group S(O)R.sup.f wherein R.sup.f is selected from hydrogen, alkyl, alkenyl, alkynyl, aryl, heteroaryl, heterocyclyl, carbocyclyl, and aralkyl. Examples of preferred R.sup.f include C.sub.1-20alkyl, phenyl and benzyl.
(171) The term sulfonyl, either alone or in a compound word, refers to a group S(O).sub.2R.sup.f, wherein R.sup.f is selected from hydrogen, alkyl, alkenyl, alkynyl, aryl, heteroaryl, heterocyclyl, carbocyclyl and aralkyl. Examples of preferred R.sup.f include C.sub.1-20alkyl, phenyl and benzyl.
(172) The term sulfonamide, either alone or in a compound word, refers to a group S(O)NR.sup.fR.sup.f wherein each R.sup.f is independently selected from hydrogen, alkyl, alkenyl, alkynyl, aryl, heteroaryl, heterocyclyl, carbocyclyl, and aralkyl. Examples of preferred R.sup.f include C.sub.1-20alkyl, phenyl and benzyl. In one embodiment at least one R.sup.f is hydrogen. In another embodiment, both R.sup.f are hydrogen.
(173) The term, amino is used here in its broadest sense as understood in the art and includes groups of the formula NR.sup.aR.sup.b wherein R.sup.a and R.sup.b may be any independently selected from hydrogen, alkyl, alkenyl, alkynyl, aryl, carbocyclyl, heteroaryl, heterocyclyl, arylalkyl, and acyl. R.sup.a and R.sup.b, together with the nitrogen to which they are attached, may also form a monocyclic, or polycyclic ring system e.g. a 3-10 membered ring, particularly, 5-6 and 9-10 membered systems. Examples of amino include NH.sub.2, NHalkyl (e.g. C.sub.1-20alkyl), NHaryl (e.g. NHphenyl), NHaralkyl (e.g. NHbenzyl), NHacyl (e.g. NHC(O)C.sub.1-20alkyl, NHC(O)phenyl), Nalkylalkyl (wherein each alkyl, for example C.sub.1-20, may be the same or different) and 5 or 6 membered rings, optionally containing one or more same or different heteroatoms (e.g. O, N and S).
(174) The term amido is used here in its broadest sense as understood in the art and includes groups having the formula C(O)NR.sup.aR.sup.b, wherein R.sup.a and R.sup.b are as defined as above. Examples of amido include C(O)NH.sub.2, C(O)NHalkyl (e.g. C.sub.1-20alkyl), C(O)NHaryl (e.g. C(O)NHphenyl), C(O)NHaralkyl (e.g. C(O)NHbenzyl), C(O)NHacyl (e.g. C(O)NHC(O)C.sub.1-20alkyl, C(O)NHC(O)phenyl), C(O)Nalkylalkyl (wherein each alkyl, for example C.sub.1-20, may be the same or different) and 5 or 6 membered rings, optionally containing one or more same or different heteroatoms (e.g. O, N and S).
(175) The term carboxy ester is used here in its broadest sense as understood in the art and includes groups having the formula CO.sub.2R.sup.g, wherein R.sup.g may be selected from groups including alkyl, alkenyl, alkynyl, aryl, carbocyclyl, heteroaryl, heterocyclyl, aralkyl, and acyl. Examples of carboxy ester include CO.sub.2C.sub.1-20alkyl, CO.sub.2aryl (e.g. CO.sub.2phenyl), CO.sub.2aralkyl (e.g. CO.sub.2 benzyl).
(176) As used herein, the term aryloxy refers to an aryl group attached through an oxygen bridge. Examples of aryloxy substituents include phenoxy, biphenyloxy, naphthyloxy and the like.
(177) As used herein, the term acyloxy refers to an acyl group wherein the acyl group is in turn attached through an oxygen atom. Examples of acyloxy include hexylcarbonyloxy (heptanoyloxy), cyclopentylcarbonyloxy, benzoyloxy, 4-chlorobenzoyloxy, decylcarbonyloxy (undecanoyloxy), propylcarbonyloxy (butanoyloxy), octylcarbonyloxy (nonanoyloxy), biphenylcarbonyloxy (eg 4-phenylbenzoyloxy), naphthylcarbonyloxy (eg 1-naphthoyloxy) and the like.
(178) As used herein, the term alkyloxycarbonyl refers to an alkyloxy group attached through a carbonyl group. Examples of alkyloxycarbonyl groups include butylformate, sec-butylformate, hexylformate, octylformate, decylformate, cyclopentylformate and the like.
(179) As used herein, the term arylalkyl refers to groups formed from straight or branched chain alkanes substituted with an aromatic ring. Examples of arylalkyl include phenylmethyl (benzyl), phenylethyl and phenylpropyl.
(180) As used herein, the term alkylaryl refers to groups formed from aryl groups substituted with a straight chain or branched alkane. Examples of alkylaryl include methylphenyl and isopropylphenyl.
(181) The present invention will hereinafter be further described with reference to the following non-limiting examples.
EXAMPLES
Materials
(182) Solvents used were HPLC or AR grade. Activated basic alumina (Aldrich: Brockmann I, standard grade, 150 mesh, 58 ), MilliQ water, sodium dodecyl sulphate (SDS: Aldrich, 99%) were used as received. Styrene (STY: Aldrich, >99%) was passed through a basic alumina column to remove inhibitor. N-isopropylacrylamide (NIPAM: Aldrich, 97%) was recrystallised from hexane, Azobisisobutyronitrile (AIBN: Riedel-de Haen) from methanol prior to use. Carbondisulfide (99%), 1-butanethiol (99%), methyl bromopropionate (98%), dimethyl sulfoxide (DMSO, >99.9%), Aldrithil-2 (98%), hexylamine (99%) were used as received from Aldrich. Triethyleneamine (>99%) was used as received from MERCK. hESC lines MEL1 (male) and MEL2 (female) were provided by Stem Core Queensland (Formerly Australian Stem Cell Centre) and routinely maintained as manually passaged cultures on mouse embryonic fibroblast feeder layers under approval from the Australian National Health and Medical Research Council (Licence No. 309709). Media used in all experimentation was StemPro serum free media for hESC (Life Technologies Carlsbad, Calif., USA). Controls were seeded onto tissue culture plastic dishes (BD Falcon) coated for one hour in 1:200 Geltrex.
Analytical Techniques
(183) Size Exclusion Chromatography (SEC)
(184) SEC measurements were performed using a Waters Alliance 2690 Separations Module equipped with an auto-sampler, Differential Refractive Index (RI) detector and a Photo Diode Array (PDA) detector connected in series. HPLC grade tetrahydrofuran was used as eluent at flow rate 1 mL/min. The columns consisted of two 7.8300 mm Waters linear Ultrastyragel SEC columns connected in series. Polystyrene standards were used for calibration.
(185) Transmission Electron Microscopy (TEM)
(186) The nanostructure appearance of the polymer latex was analyzed using a JEOL-1010 transmission electron microscope utilizing an accelerating voltage of 100 kV with spot size 6 at ambient temperature. A typical TEM grid preparation was as follows: A polymerization mixture was diluted with Milli-Q water to approximately 0.05 wt %. A formvar pre-coated copper TEM grid was then dipped in the diluted latex solution and dried on filter paper at 25 C.
(187) 1H Nuclear Magnetic Resonance (NMR) Spectroscopy
(188) All NMR spectra were recorded on a Bruker DRX 500 MHz spectrometer.
(189) Matrix-Assisted Laser Desorption Ionization-Time-of-Flight (MALDI-ToF) Mass
(190) Spectrometry
(191) MALDI-ToF MS spectra were obtained using a Bruker MALDI-ToF autoflex III smart beam equipped with a nitrogen laser (337 nm, 200 Hz maximum firing rate) with a mass range of 600-400,000 Da. Spectra were recorded in both reflectron mode (2,000-5,000 Da) and linear mode (5,000-20,000 Da). Trans-2-[3-(4-tert-butylphenyl)-2-methyl-propenylidene]malononitrile (DCTB; 20 mg/mL in THF) was used as the matrix and Na(CF3COO) (1 mg/mL in THF) as the cation source. Samples were prepared by co-spotting the matrix (20 L), Na(CF3COO) (1 L), and polymer (20 L, 1 mg/mL in THF) solutions on the target plate.
(192) Cells were adapted to single cell passage using TrypLE (Life Technologies) enzymatic digestion. Cells were detached from the tissue culture surface using TrypLE (Life Technologies) and plated on glass coverslips (inserted into 24 well plates) or organ culture dishes coated with pNIPAM/PSTY diblock copolymer functionalised with either Vitronectin, Fibronectin or RGD peptide (Table 1) in StemPro (Life Technologies). Cells were seeded at 510.sup.4 cells/coverslip or organ culture dish for attachment assays and 110.sup.6 for cell sheet formation. For binding controls, organ culture dishes and coverslips were coated with Geltrex (Life Technologies) diluted 1:200 in DMEM-F12. Images were taken on an EVOS.sub.fl inverted microscope (Advanced Microscopy Group, Bothell Wash.) at 20 magnification and cells counted manually using a standard haemocytometer. For temperature dependant detachment cells were released from the surface by incubation at room temperature or 4 C. with gentle agitation. Cell sheets were released from the pNIPAM/PSTY diblock copolymer ECM functionalised surface 24 hrs post seeding.
(193) TABLE-US-00001 TABLE1 Recombinantproteinfragmentsequences Proteinor Peptide Fragment Sequence RGD GRGDS(SEQIDNO:1) Fibronectin MPLSPPTNLHLEANPDTGVLTVSWERSTTPDITGY TypeII, RITTTPTNGQQGNSLEEVVHADQSSCTFDNLSPGL domains7-10 EYNVSVYTVKDDKESVPISDTIIPAVPPPTDLRFT NIGPDTMRVTWAPPPSIDLTNFLVRYSPVKNEEDV AELSISPSDNAVVLTNLLPGTEYVVSVSSVYEQHE STPLRGRQKTGLDSPTGIDFSDITANSFTVHWIAP RATITGYRIRHHPEHFSGRPREDRVPHSRNSITLT NLTPGTEYVVSIVALNGREESPLLIGQQSTVSDVP RDLEVVAATPTSLLISWDAPAVTVRYYRITYGETG GNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAV TGRGDSPASSKPISINYRTSDPNSSSVDKLAAALE HHHHHH(SEQIDNO:2) Vitronectin MDQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTD SMBdomain YTAECKPQVTRGDVFTMLEHHHHHH (SEQIDNO:3) GFP MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGP CKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPK YGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLD ANLAGSGSGSDPMVSKGEELFTGVVPILVELDGDV NGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPW PTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGY VQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKG IDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPD NHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLG MDELYKKLAAGSGSGYDPEGSGSGHHHHHH (SEQIDNO:4) mCherry MSDKIIHLTDDSFDTDVLICADGAILVDFWAEWCG PCICMIAPILDEIADEYQGKLTVAKLNIDQNPGTA PKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEF LDANLAGSGSGSDPMVSKGEEDNMAIIKEFMRFKV HMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKG GPLPFAWDILSPQFMYGSICAYVKHPADIPDYLIC LSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFI YKVKLRGTNFPSDGPVMQICKTMGWEASSERMYPE DGALKGEIKQRLKLKDGGHYDAEVKTTYICAKKPV QLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHS TGGMDELYKKLAAGSGSGYDPEGSGSGHHHHHH (SEQIDNO:5)
Example 1
Part (a): Synthesis of Methyl 2-(Butylthiocarbonothioylthio)Propanoate
(194) ##STR00002##
(195) To a stirred solution of 1-butanethiol (10 mL, 0.093 mol) and TEA (14.3 mL, 0.103 mol) in DCM (100 mL) under nitrogen atmosphere was added dropwise carbon disulfide (6.18 mL, 0.103 mol) in DCM (50 mL) over a period of 30 min at 0 C. The solution gradually turned yellow during the addition. After complete addition the solution was stirred at room temperature for 1 h. MBP (11.5 mL, 0.103 mol) in DCM (50 mL) was then added dropwise to the solution over a period of 30 min, and stirred for 2 h. DCM was removed under nitrogen and the residue dissolved in diethylether. This solution was washed with cold 10% HCl solution (350 mL) and MilliQ water (350 mL) and then dried over anhydrous MgSO.sub.4. The solvent was removed under vacuum and the residual yellow oil was purified by column chromatography (9:1 petroleum ether/ethyl acetate on silica, second band).
(196) .sup.1H NMR (CDCl.sub.3) ppm 0.92 (tr, J=7.5 Hz, 3H, CH.sub.3), 1.43 (mult, J=7.5 Hz, 2H, CH.sub.2), 1.62 (d, J=7.5 Hz, 3H, CH.sub.3), 1.65 (quin, J=7.5 Hz, 2H, CH.sub.2), 3.36 (tr, J=7.5 Hz, 2H, CH.sub.2), 3.73 (s, 3H, CH.sub.3), 4.84 (quad, J=7.5 Hz, 1H, CH); .sup.13C NMR (CDCl.sub.3) 13.55, 16.91, 22.02, 29.89, 36.94, 47.68, 52.82, 171.63 (CHC(O)O), 221.99 (SC(S)S)
Part (b): Synthesis of PNIPAM43-SC(S)SC4H9 by RAFT Polymerization
(197) NIPAM (15 g, 0.133 mol), RAFT agent (0.75 g 3.010.sup.3 mol) and AIBN (50 mg, 3.010.sup.4 mol) were dissolved in 30 ml DMSO in a 50 ml Schlenk flask. The solution was purged by Ar for 30 min. The reaction solution was then immersed in preheated oil-bath at 60 C. for 16 h. The reaction was stopped by cooling in ice-bath and exposing the solution to the air. The polymerization mixture was then diluted by 500 ml DCM and washed by Milli-Q water for three times. The organic phase was dried over MgSO.sub.4, filtered, concentrated and precipitated in diethyl ether. After filtration, the yellow powder was dried under vacuum at R.T. for 48 h. (M.sub.n,GPC=4800).
(198) .sup.1H NMR (CDCl.sub.3, 298K, 500 MHz); 6.47 (b, NHCO of poly(NIPAM) repeating units), 3.97 (b, NHCH(CH.sub.3).sub.2 of poly(NIPAM) repeating units), 4.62 (b, 1H, CHSC(S)SC.sub.4H.sub.9), 3.97 (b, NHCH(CH.sub.3).sub.2 of poly(NIPAM) repeating units), 3.66 (b, 3H, CH.sub.3O-RAFT residual group) 3.34 (b, 2H, SC(S)SCH.sub.2C.sub.3H.sub.7), 1.06-2.45 (b, methylene and methine protons of poly(NIPAM) backbone), 1.12 (b, methyl protons of poly(NIPAM) repeating units), 0.90 (b, 6H, methyl protons of RAFT residual group).
(199) ##STR00003##
PART (c): Synthesis of Pyridine Disulfide Functionalized Poly(NIPAM)-PDS
(200) PNIPAM.sub.43-SC(S)SC.sub.4H.sub.9 (M.sub.n,GPC=4800, 0.29 g, 6.010.sup.5 mol), Aldrithiol-2 (40 mg, 1.810.sup.4 mol) and TEA (40 mg, 1.810.sup.4 mol) were dissolved in 5 ml DMF. The solution was purged by Ar for 20 min and hexylamine (40 mg, 1.810.sup.4 mol) was added via a gas-tight syringe. After stirring overnight at room temperature, the reaction mixture was blown with air line to remove some DMF. The residual was then dissolved in dichloromethane and precipitate in diethyl ether. The dissolution/precipitation operation was repeated for three times and filtered. The polymer was then dried under vacuum at room temperature for 48 h to give 0.22 g of white powdery product with yield as 75.8%.
(201) .sup.1H NMR (CDCl.sub.3, 298K, 500 MHz); 8.45 (b, 1H, pyridine proton), 7.63 (b, 2H, pyridine protons), 7.13 (b, 1H; pyridine proton), 6.47 (b, NHCO of poly(NIPAM) repeating units), 3.97 (b, NHCH(CH.sub.3).sub.2 of poly(NIPAM) repeating units), 3.66 (b, 3H, CH.sub.3O-RAFT residual group) 3.46 (b, 1H, methine proton close to the disulfide linkage), 1.36-2.10 (b, methylene and methine protons of poly(NIPAM) backbone), 1.12 (b, methyl protons of poly(NIPAM) repeating units), 0.88 (b, 3H, methyl protons of RAFT residual group).
(202) ##STR00004##
Part (d): Synthesis of Poly(NIPAM)-Protein (GFP, Cheery, Fibronectin and Vitronectin) Conjugation
(203) Recombinant proteins (GFP and mCherry) or ECM peptides (fibronectin and vitronectin) were produced as described in the literature and sequences are shown in Table 1. The PNIPAM-PDS was dissolved in Milli-Q water with a concentration of 10 mg/mL. The proteins were already in solution (at different concentrations). The PNIPAM-PDS solution was added to the protein solutions, so that a 3:1 molar ratio was achieved. The reaction mixtures were slowly shaken for 6 h at RT. The conjugation efficiency was measured by UV-Vis Spectrometry. The absorbance at 340 nm ascribed to the pyridinthione which was released out from PNIPAM-PDS after conjugate with proteins was used to quantify the conjugation efficiency. For GFP, Cherry, Fibronectin and Vitronectin, the conjugation efficiency were 100%, 97.7%, 89.6% and 28.0% respectively. The solution was then dialyzed against water for 1 day (3-times water change) and freeze-dried protein.
(204) ##STR00005##
Part (e): RAFT-Mediated Polymerization of Styrene with PNIPAM43-SC(S)SC4H9 macroCTA and SDS in Water to Make Worms and Nanospheres
(205) A typical polymerization was performed as follows: PNIPAM.sub.43-SC(S)SC.sub.4H.sub.9 (0.350 g, 7.410.sup.5 mol, 5 wt %), SDS (0.0145 g, 5.010.sup.5 mol) and Milli-Q water (6.25 g) were added to a 10 mL Schlenk tube equipped with magnetic stirrer bar. To dissolve the polymer the solution was cooled below the LCST of PNIPAM by placing the flask in an ice bath. The polymer solution was purged with argon for 40 min. A mixture of styrene (0.350 g, 3.410.sup.3 mol, 5 wt %) and AIBN (0.0012 g, 7.310.sup.6 mol) was added with to the cooled polymer solution. The reaction mixture was purged with argon for another 10 min, and the polymerization heating in an oil bath at 70 C. for 3 h. (SEC: Mn=8300, PDI=1.10).
(206) ##STR00006##
(207) For making worms, 3 mL latex solution was added to a preheated glass vial with 60 L of toluene as platicizer. The mixture was shaken for 10 seconds and then cooled down to 25 C. The polymeric worms in water was then freeze-dried to recover the powdery worms. For making the nanospheres, after polymerization the reaction vessel was open to the air to stop the reaction and continued heating at 70 C. for 4 h to remove any unpolymerized STY, monomer. The polymeric nanospheres in water were then freeze-dried to recover the powdery worms. Both the worms and nanospheres were then characterized by TEM (
Part (f): Formation of Thermo-Responsive Matrix Between PNIPAM-Protein and Worms or Nanospheres
(208) Freeze-dried worms (or nanospheres) were rehydrated with Milli-Q water at 4 C. PNIPAM-Protein solution (4 C.) was then added to the worms (or nanosphere) suspension and mixed by shaking. The solution was then heated above the LCST (29 C.) to allow the binding of PNIPAM-protein on the matrix surface of worms (or nanospheres).
Example 2
Human Embryonic Stem Cell Culture
(209) All mammalian tissue culture reagents described here were from Life Technologies (Carlsbad, Calif., USA) unless otherwise stated. hESC lines used were NKX2-5 (eGFP/w) (hES3 background, a kind donation from Andrew Elefanty and Ed Stanley.sup.1), H9 (WiCell, Wisconsin, Mich., USA), MEL1 and MEL2 (referenced in.sup.2). NKX2-5, MEL1 and MEL2 were maintained by Stem Core Queensland and routinely supported as manually passaged cultures on MEF feeder layers as previously described.sup.3. Prior to experiments, cells were adapted to single cell passage as previously described.sup.4,5 in Knockout serum replacement media containing 4 ng/mL basic fibroblast growth factor (bFGF) and 0.1 mM (3-mercaptoethanol (Sigma-Aldrich, Grand Island, N.Y., USA).
Part (a): Attachment of Human Embryonic Stem Cells to Functionalised PNIPAM/ROD Diblock Copolymers
(210) A mixture of 35 L of pWorms (30% w/v) in PBS was combined with 35 L of pVN or pFN in PBS (ranging from 0-50 g of each ECM polymer conjugate). These solutions were spun coat at 4000 rpm for 30 s onto organ culture dishes (15 mm diameter tissue culture surface, BD Biosciences, Franklin Lakes, N.J., USA). Single cell suspensions of MEL1 or MEL2 cells were plated in StemPro media at 510.sup.4 cells per dish. After 2 h binding, unbound cells were washed from the surface with warm PBS at 37 C. Images were taken on an EVOSn inverted microscope (Advanced Microscopy Group, Bothell Wash.) at 20 magnification and cells counted manually.sup.6.
(211) In a two component system (as in
Part (b): Temperature Dependant, Enzyme Free Dissociation of Human Embryonic Stem Cells
(212) By decreasing the temperature below the LCST of the PNIPAM, hESC detached without the aid of enzymes, from the surface. We cultured cells for 24 h at 37 C. on Geltrex coated tissue culture plates or on glass slides coated with worms mixed with poly(NIPAM)-protein at 4 C. for 1 h. We cultured cells for 24 hours at 37 C. on Geltrex coated tissue culture plates or on glass slides coated with worms/poly(NIPAM)-protein (i.e. protein was either Fibronectin or Vitronectin). The culture was cooled to 4 C. for 1 h. Incubation of cells on Geltrex control surfaces at 4 C. had no significant impact on cell morphology with no cell rounding, a distinctive characteristic of cell detachment (
Part (c): Generation of Human Embryonic Stem Cell Sheets
(213) An organ culture dish prepared above with 50 g of either pVN or pFN was seeded with MEL1 or MEL2 cells at 110.sup.6 cells/dish, and cultured for 24 h to allow cell junctions to form. The dishes were removed from the 37 C. incubator, and left at RT (i.e. below the LCST of the PNIPAM) for 30 min to allow release of cell sheets. Cells were also seeded at low cell density (110.sup.5/dish) to further demonstrate enzyme-free detachment and released below the LCST after incubation at 4 C. Geltrex (0.5% v/v in DMEM-F12) coated onto the organ culture dishes were used as the control. Incubation of these cultures at room temperature readily liberated cell sheets that could be completely removed with gentle agitation (
Example 3
Part (a): Formation and Dissociation of Human Embryonic Stem Cell Clumps (Embryoid Bodies)
(214) hESC 3D Embryoid Body Formation with pVN and pWorms
(215) MEL1, MEL2 and NKX2-5 were used to form embryoid bodies (EB) in APEL media using the spin EB process as previously described.sup.7 with some modifications. Briefly, 50 L of cell suspensions containing 3500 cells were seeded per well in a round bottom 96-well plate at RT. Concentrations of pWorms (156 g/mL), pVN (14 g/mL) and bFGF (100 ng/mL) were added to the cell suspension. Plates were then centrifuged at 37 C. at 480 g for 5 min. Cells were incubated at 37 C. under a 5% CO.sub.2 and 5% O.sub.2 atmosphere. On day 3, EBs were incubated at RT for 30 min prior to gentle pipetting to break apart the EBs.
(216) Spin EB Formation and Dissociation in the Absence of Polyvinyl Alcohol
(217) APEL media was made as previously described except polyvinyl alcohol (PVA) was removed and the equivalent volume replaced with F-12 nutrient mix. PVA-free media was designated AEL. pWorms (0-1560 g/mL) and pVN (0-50 g/mL) were added to AEL media with 100 ng/mL bFGF. EBs were scored for efficient formation on day 1 based on uniformity of density, spherical EB structure and smoothness of EB boundary. Based on a dilution series of pVN and pWorm (
(218) 3D hESC Expansion with pVN and pWorms
(219) Based on a dilution series of pVN and pWorms (
(220) Embryoid Body (EB) Morphology and Cell Growth Kinetics
(221) Bright field pictures of EBs were taken using an EVOSn inverted microscope (Advanced Microscopy Group) on days 10, 11 and 18. EB diameters were measured in m using Image J (v1.41). Sixty EBs were sized per replicate per condition totaling 180 per condition. For cell counts, a selection of EBs were dissociated using TrypLE and stained with Trypan Blue for dead cell exclusion before counting on a haemocytometer.
(222) Representative fold expansion is outlined in
(223) Quantitative PCR
(224) The full protocol used closely adheres to recent guidelines on conducting and reporting on qPCR results.sup.9. RNA extraction and DNA removal was performed using the Qiagen RNeasy RNA extraction kit (Qiagen) and on column DNASE set. Briefly, RNA was extracted from hESC at Day 18 post expansion or from differentiating cells at varying time points as indicated in figures. One microgram of DNA free RNA was converted to cDNA using Life Technologies's Superscript III First Strand Sythesis Supermix. CDNA was diluted 1:10 before qPCR. Primer sequences used for qPCR can be found in Table 2. QPCR was performed using an Applied Biosystems 7500 Fast ThermoCycler and SYBR Green Master Mix as described.sup.10. Primer-product specificity was confirmed by the presence of one peak in a step-wise melt curve analysis. Fold change representation was determined relative to hESC grown on MEF. All genes of interest were referenced to 3 housekeeping genes: human 0actin, HPRT and GAPDH.sup.11 using the Pfaffl method.sup.12. All experiments and qPCR runs were conducted in triplicate. Results are displayed in
(225) TABLE-US-00002 TABLE2 qPCRprimersequences Size Gene Direction Sequence bp B-Actin Forward GCTGTGCTACGTCGCCCTG 61 (SEQIDNO:6) Reverse GGAGGAGCTGGAAGC (SEQIDNO:7) NANOG Forward CAAAGGCAAACAACCCACTT 158 (SEQIDNO:8) Reverse TCTGCTGGAGGCTGAGGTAT (SEQIDNO:9) OCT-4 Forward TGAAGCTGGAGAAGGAGAAG 134 (SEQIDNO:10) Reverse ATCGGCCTGTGTATATCCC (SEQIDNO:11) GAPDH Forward GAAGGTGAAGGTCGGAGTCA 109 (SEQIDNO:12) Reverse AATGAAGGGGTCATTGATGG (SEQIDNO:13) HPRT Forward GGGAGGCCATCACATTGTAG 168 (SEQIDNO:14) Reverse TCCCCTGTTGACTGGTCATT (SEQIDNO:15)
Flow Cytometry
(226) Cells were fixed in 4% formalin upon dissociation and stained overnight at 4 C. with primary antibody mouse IgG1, anti-Oct-4 (2 g/mL) (Merck Millipore). Isotype specific secondary antibody conjugated to Alexa fluor 488 was used at 1 g/mL Expression of pluripotent marker Oct-4 was determined by flow cytometry using a C6 Accuri flow cytometer with Sampler arm (BD Biosciences). Data was analysed using CFlow Sampler software (v1.0.264.15, BD Biosciences) and results displayed in
(227) Further discussion relating
(228)
(229) (A) Examples of EB clump classification after gentle manual titration at RT. EBs were formed using the Spin EB protocol in APEL media containing pWORMs (156 g/mL) and pVN (14 g/mL). On day 3, EBs were incubated at RT for 20 min before passing through a 200 L pipette tip to dissociate. Scale bars are 1000 m. (B) Percentage of broken EBs after manual dissociation. EBs were formed in APEL media with or without pWORMs/pVN as defined in A. On day 3 EBs were manually, dissociated at 37 C. or at RT and classified as broken or unbroken. (C) Distribution of EB clump size after dissociation at RT. After RT dissociation, EBs were classified according to size into four categories as outlined in A. (D) Bright field images of EBs formed during titration of pWORM and pVN in the absence of PVA. EBs were formed using the spin coat method in the absence of PVA while titrating the pWORM and pVN concentrations as shown. EBs were scored 1 to 4 on day 1 for formation based on formation of EBs (1), partial formation (2), varying clump formation (3) and no formation (4). Scores for formation were averaged across 3 independent experiments and 6 technical replicates within each experiment, n=18. (E) EB dissociation at RT in PVA free media with pWORMs and pVN. EBs formed in AEL media with pWORMs (1.56 ng/mL) and pVN (50 g/mL) were dissociated on day 3 and classified according to EB clump sizes as outlined in (A). APEL; Albumin Polyvinylalcohol Essential Lipids, pVN; PNIPAM-Vitronectin, AEL; Albumin Essential Lipids.
(230)
(231) (A) Fold expansion of Nkx2-5 hESC as embryoid bodies. EBs were formed using the spin EB method at 3,500 cells/aggregate in SP media with and without BSA and PNIPAM (pVN 50 g/mL and pWorms 1.56 ng/mL). EBs were passaged on day 3 and 10 by incubating at RT for 20 mins followed by gentle pipetting. Fold change was based on total cell number on day 18 compared to input cell number on day 0. (B) Average EB diameter. EBs were photographed on days 10, 11 and 18. EB diameter was determined using Image J image analysis software. 60 EBs were sized per sample per replicate, n=180. (C) EB size distribution before and after passage. (D) qPCR analysis of Nanog and Oct4 gene expression. On day 18, mRNA was extracted from EBs and converted to cDNA before qPCR measurement of Oct4 and Nanog expression. Fold change is relative to hESC grown on MEF feeder layers and average using three housekeeping genes (3-actin, GAPDH and HPRT. Error bars represent standard deviation of 3 independent experiments. (E) Oct4 protein expression measured by flow cytometry. SP; StemPro, BSA; bovine serum albumin, PNIPAM; cultures with pVN 50 g/mL and 1.56 ng/mL pWORMs, APEL; Albumin Polyvinylalcohol Essential Lipids, 2D VN; hESC on tissue culture plastic coated with vitronectin, 2D MEF; hESC grown on mouse embryonic fibroblast feeder layers.
REFERENCES
(232) 1 Elliott, D. A. et al. NKX2-5(eGFP/w) hESCs for isolation of human cardiac progenitors and cardiomyocytes. Nat Methods 8, 1037-1040, doi:nmeth.1740 [pii] 10.1038/nmeth.1740 (2011). 2 Prowse, A. B. et al. Long term culture of human embryonic stem cells on recombinant vitronectin in ascorbate free media. Biomaterials 31, 8281-8288, doi:S0142-9612(10)00880-X [pii] 10.1016/j.biomaterials.2010.07.037 (2010). 3 Thomson, J. A. et al. Embryonic stem cell lines derived from human blastocysts. Science 282, 1145-1147 (1998). 4 Amit, M. et al. Human feeder layers for human embryonic stem cells. Biol Reprod 8, 2150-2156, doi:10.1095/biolreprod.102.012583 biolreprod.102.012583 [pii] (2003). 5 Ng, E. S., Davis, R. P., Hatzistavrou, T., Stanley, E. G. & Elefanty, A. G. Directed differentiation of human embryonic stem cells as spin embryoid bodies and a description of the hematopoietic blast colony forming assay. Curr Protoc Stem Cell Biol Chapter 1, Unit 1D 3, doi:10.1002/9780470151808.sc01d03s4 (2008). 6 Mizutani, A., Kikuchi, A., Yamato, M., Kanazawa, H. & Okano, T. Preparation of thermoresponsive polymer brush surfaces and their interaction with cells. Biomaterials 29, 2073-2081, doi:10.1016/j.biomaterials.2008.01.004 (2008). 7 Ng, E. S., Davis, R., Stanley, E. G. & Elefanty, A. G. A protocol describing the use of a recombinant protein-based, animal product-free medium (APEL) for human embryonic stem cell differentiation as spin embryoid bodies. Nat Protoc 3, 768-776, doi:nprot.2008.42 [pii] 10.1038/nprot.2008.42 (2008). 8 Wang, L. et al. Self-renewal of human embryonic stem cells requires insulin-like growth factor-1 receptor and ERBB2 receptor signaling. Blood 110, 4111-4119, doi:blood-2007-03-082586 [pii] 10.1182/blood-2007-03-082586 (2007). 9 Bustin, S. A. et al. The MIQE guidelines: minimum information for publication of quantitative real-time PCR experiments. Clin Chem 55, 611-622, doi:clinchem.2008.112797 [pii] 10.1373/clinchem.2008.112797 (2009). 10 Prowse, A. B. et al. Analysis of mitochondrial function and localisation during human embryonic stem cell differentiation in vitro. PLoS One 7, e52214, doi:10.1371/journal.pone.0052214 PONE-D-12-24905 [pii] (2012). 11 Vandesompele, J. et al. Accurate normalization of real-time quantitative RT-PCR data by geometric averaging of multiple internal control genes. Genome Biol 3, RESEARCH0034 (2002). 12 Pfaffl, M. W. A new mathematical model for relative quantification in real-time RT-PCR. Nucleic Acids Res 29, e45 (2001).
(233) Throughout this specification and the claims which follow, unless the context requires otherwise, the word comprise, and variations such as comprises and comprising, will be understood to imply the inclusion of a stated integer or step or group of integers or steps but not the exclusion of any other integer or step or group of integers or steps.
(234) The reference in this specification to any prior publication (or information derived from it), or to any matter which is known, is not, and should not be taken as an acknowledgment or admission or any form of suggestion that that prior publication (or information derived from it) or known matter forms part of the common general knowledge in the field of endeavour to which this specification relates.