Gene Therapy
20170056558 ยท 2017-03-02
Inventors
Cpc classification
A61L27/3608
HUMAN NECESSITIES
C12N2740/15043
CHEMISTRY; METALLURGY
C12N2740/16043
CHEMISTRY; METALLURGY
A61K35/28
HUMAN NECESSITIES
C12N15/86
CHEMISTRY; METALLURGY
C12N5/0647
CHEMISTRY; METALLURGY
A61L27/3687
HUMAN NECESSITIES
International classification
A61L27/36
HUMAN NECESSITIES
Abstract
Use of cyclosporin A (CsA) or a derivative thereof for increasing the efficiency of transduction of an isolated population of human haematopoietic stem and/or progenitor cells by a vector derived from HIV-1, HIV-2, FIV, BW, EIAV, CAEV or visna lentivirus.
Claims
1-6. (canceled)
7. A method of transducing a population of human haematopoietic stem and/or progenitor cells comprising the steps of: a) contacting the population of cells with cyclosporin A (CsA) or a derivative thereof; and b) transducing the population of cells with a vector derived from HIV-1, HIV-2, FIV, BIV, EIAV, CAEV or visna lentivirus.
8. The method of claim 7 wherein steps (a) and (b) are carried out ex vivo or in vitro.
9. The method of claim 7, wherein the percentage of haematopoietic stem and/or progenitor cells transduced by the vector is increased and/or the vector copy number per cell is increased.
10. The method of claim 7, wherein the vector comprises a capsid comprising glutamic acid at position 92 and/or threonine at position 88.
11. The method of claim 7, wherein the cyclosporin A (CsA) or derivative thereof is at a concentration of about 5-50 M.
12. The method of claim 7, wherein the population of cells is contacted with cyclosporin A (CsA) or a derivative thereof in combination with rapamycin.
13. The method of claim 7, wherein the population of cells is contacted with cyclosporin A (CsA) or a derivative thereof in combination with 3 -methyladenine (3-MA).
14. The method of claim 7, wherein the population of haematopoietic stem and/or progenitor cells is obtained from mobilised peripheral blood, bone marrow or umbilical cord blood.
15. The method of claim 7, comprising a further step of enriching the population for haematopoietic stem and/or progenitor cells.
16. A method of gene therapy comprising the steps of: a) transducing a population of human haematopoietic stem and/or progenitor cells according to the method of claim 7; and b) administering the transduced cells to a subject.
17. The method of claim 16 wherein the transduced cells are administered to a subject as part of an autologous stem cell transplant procedure or an allogeneic stem cell transplant procedure.
18. A population of human haematopoietic stem and/or progenitor cells prepared according to the method of claim 7. 19, (Original) A pharmaceutical composition comprising the population of haematopoietic stem and/or progenitor cells of claim 18.
20. The population of haematopoietic stem and/or progenitor cells of claim 18 for use in therapy.
21. The population of haematopoietic stem and/or progenitor cells for use according to claim 20 wherein the population is administered as part of an autologous stem cell transplant procedure or an allogeneic stem cell transplant procedure.
22. Cyclosporin A (CsA) or a derivative thereof for use in haematopoietic stem and/or progenitor cell gene therapy.
23. A method of transducing a population of haematopoietic stem and/or progenitor cells with a vector derived from HIV-1, HIV-2, FIV, BIV, EIAV, CAEV or visna lentivirus, wherein the vector comprises a capsid comprising glutamic acid at position 92 and/or threonine at position 88.
24. The method of claim 23 wherein the transduction is carried out ex vivo or in vitro.
25. (canceled)
Description
DESCRIPTION OF THE DRAWINGS
[0055]
[0056]
[0057]
[0058]
[0059] Sequence alignments of the p24 amino acid sequences of the WT packaging construct (pMDL) with the clade B HIV-1 laboratory strains: (a) IIIB_LAI (X4-tropic); (b) HXB2_LAI (X4-tropic); (c) BAL (R5-tropic); and (d) the infectious molecular clone pNL4.3.
[0060]
[0061]
[0062]
[0063]
[0064]
[0065]
[0066]
[0067]
[0068]
[0069]
[0070]
[0071]
[0072]
[0073]
[0074]
[0075]
[0076]
[0077]
[0078]
[0079]
[0080]
[0081]
[0082]
[0083]
[0084]
[0085]
[0086]
DETAILED DESCRIPTION OF THE INVENTION
[0087] Various preferred features and embodiments of the present invention will now be described by way of non-limiting examples.
[0088] The practice of the present invention will employ, unless otherwise indicated, conventional techniques of chemistry, biochemistry, molecular biology, microbiology and immunology, which are within the capabilities of a person of ordinary skill in the art. Such techniques are explained in the literature. See, for example, Sambrook, J., Fritsch, E. F., and Maniatis, T. (1989) Molecular Cloning: A Laboratory Manual, 2nd Edition, Cold Spring Harbor Laboratory Press; Ausubel, F. M. et al. (1995 and periodic supplements) Current Protocols in Molecular Biology, Ch. 9, 13 and 16, John Wiley & Sons; Roe, B., Crabtree, J., and Kahn, A. (1996) DNA Isolation and Sequencing: Essential Techniques, John Wiley & Sons; Polak, J. M., and McGee, J. O'D. (1990) In Situ Hybridization: Principles and Practice, Oxford University Press; Gait, M. J. (1984) Oligonucleotide Synthesis: A Practical Approach, IRL Press; and Lilley, D. M., and Dahlberg, J. E. (1992) Methods in Enzymology: DNA Structures Part A: Synthesis and Physical Analysis of DNA, Academic Press. Each of these general texts is herein incorporated by reference.
[0089] In one aspect, the present invention provides the use of cyclosporin A (CsA) or a derivative thereof for increasing the efficiency of transduction of an isolated population of human haematopoietic stem and/or progenitor cells by a vector derived from HIV-1, HIV-2, FIV, BIV, EIAV, CAEV or visna lentivirus.
[0090] Increasing the efficiency of transduction refers to an increase in the transduction of haematopoietic stem and/or progenitor cells in the presence of an agent (e.g. CsA or a derivative thereof), in comparison to the transduction achieved in the absence of the agent but under otherwise substantially identical conditions. An increased efficiency of transduction may therefore allow the multiplicity of infection (MOI) and/or the transduction time required to achieve effective transduction to be reduced.
[0091] In one embodiment, the percentage of haematopoietic stem and/or progenitor cells transduced by the vector is increased. In another embodiment, the vector copy number per cell is increased. Preferably both are achieved at the same time.
[0092] Methods for determining the percentage of cells transduced by a vector are known in the art. Suitable methods include flow cytometry, fluorescence-activated cell sorting (FACS) and fluorescence microscopy. The technique employed is preferably one which is amenable to automation and/or high throughput screening.
[0093] For example, a population of cells may be transduced with a vector which harbours a reporter gene. The vector may be constructed such that the reporter gene is expressed when the vector transduces a cell. Suitable reporter genes include genes encoding fluorescent proteins, for example green, yellow, cherry, cyan or orange fluorescent proteins. Once the population of cells has been transduced by the vector, both the number of cells expressing and not-expressing the reporter gene may be quantified using a suitable technique, such as FACS. The percentage of cells transduced by the vector may then be calculated.
[0094] Alternatively, quantitative PCR (qPCR) may be used to determine the percentage of cells transduced by a vector that does not harbour a reporter gene. For example, single colonies of CD34.sup.+ cells may be picked from a semi-solid culture and qPCR may be performed on each colony separately to determine the percentage of vector-positive colonies among those analysed.
[0095] Methods for determining vector copy number are also known in the art. The technique employed is preferably one which is amenable to automation and/or high throughput screening. Suitable techniques include quantitative PCR (qPCR) and Southern blot-based approaches.
[0096] Cyclosporin A
[0097] Cyclosporin A (CsA, CAS No. 59865-13-3) is a poly-N-methylated cyclic undecapeptide having the following structure:
##STR00001##
[0098] CsA is an approved immunosuppressive agent for use in prevention of allograft rejection. CsA mediates immunosuppression as a complex with the host peptidyl-prolyl isomerase cyclophilin A (CypA). This inhibits the Ca.sup.2+-dependent phosphatase calcineurin and consequent activation of pro-inflammatory cytokines such as IL-2 (Sokolskaja, E. et al. (2006) Curr. Opin. Microbiol. 9: 404-8). At higher concentrations CsA also exerts anti-tumour activity toward several types of tumour cells, including malignant gliomas resistant to many traditional chemotherapeutics.
[0099] Solutions of CsA for use in the present invention may be prepared using routine methods known in the art. In addition, suitable clinical-grade solutions of CsA are known in the art (e.g. Sandimmune).
[0100] The concentration at which CsA or a derivative thereof is applied to a population of haematopoietic stem and/or progenitor cells may be adjusted for different vector systems to optimise transduction efficiency. Methods for determining transduction efficiency have been described above.
[0101] CsA may be toxic to haematopoietic stem and/or progenitor cells if it is applied at too high a concentration. The toxicity of CsA or a derivative thereof on haematopoietic stem and/or progenitor cells may be determined by quantifying the number of viable cells remaining after exposure to CsA for a certain time. Methods for quantifying the number of viable cells are known in the art.
[0102] A skilled person may therefore select a suitable concentration of CsA or a derivative thereof to maximise increase in transduction efficiency while minimising the effect of toxicity using the approaches described herein.
[0103] The present invention encompasses the use of CsA and derivatives of CsA. The CsA derivatives of the present invention are those which increase the efficiency of transduction of an isolated population of haematopoietic stem and/or progenitor cells by a vector derived from HIV-1, HIV-2, FIV, BIV, EIAV, CAEV or visna lentivirus.
[0104] CsA derivatives of the present invention may have been developed for increased solubility, increased stability and/or reduced toxicity. A number of derivatives of CsA are known in the art.
[0105] CsA derivatives of the invention are preferably of low toxicity for mammals, in particular humans. Preferably, CsA derivatives of the invention are of low toxicity for haematopoietic stem and/or progenitor cells.
[0106] Suitable CsA derivatives may be identified using methods known in the art for determining transduction efficiency. For example, methods for determining the percentage of haematopoietic stem and/or progenitor cells that are transduced by a vector, or methods for determining the vector copy number per cell may be employed. Such methods have been described above. The method employed is preferably one which is amenable to automation and/or high throughput screening of candidate CsA derivatives. The candidate CsA derivatives may form part of a library of CsA derivatives.
[0107] Rapamycin
[0108] Rapamycin (CAS No. 53123-88-9, also known as Sirolimus) is a macrolide produced by Streptomyces hygroscopicus. Rapamycin has the following structure:
##STR00002##
[0109] Rapamycin is also an approved immunosuppressive agent for use in prevention of allograft rejection. Similarly to CsA, rapamycin exerts its immunosuppressive effect through binding and inhibition of a host peptidyl-prolyl isomerase, although in this case FKBP12 (Harding, M. W. et al. (1989) Nature 341: 758-60; Siekierka, J. J. et al. (1989) Nature 341: 755-7).
3-methyladenine
[0110] 3-methyladenine (3-MA, CAS No. 5142-23-4) has the following structure:
##STR00003##
[0111] 3-MA is a widely used inhibitor of autophagy (Kondo, Y. et al (2005) Nat. Rev. Cancer 5: 726-34).
[0112] Haematopoietic Stem and Progenitor Cells
[0113] A stem cell is able to differentiate into many cell types. A cell that is able to differentiate into all cell types is known as totipotent. In mammals, only the zygote and early embryonic cells are totipotent. Stem cells are found in most, if not all, multicellular organisms. They are characterised by the ability to renew themselves through mitotic cell division and differentiate into a diverse range of specialised cell types. The two broad types of mammalian stem cells are embryonic stem cells that are isolated from the inner cell mass of blastocysts, and adult stem cells that are found in adult tissues. In a developing embryo, stem cells can differentiate into all of the specialised embryonic tissues. In adult organisms, stem cells and progenitor cells act as a repair system for the body, replenishing specialised cells, but also maintaining the normal turnover of regenerative organs, such as blood, skin or intestinal tissues.
[0114] Haematopoietic stem cells are multipotent stem cells that may be found, for example, in peripheral blood, bone marrow and umbilical cord blood. HSCs are capable of self-renewal and differentiation into any blood cell lineage. They are capable of recolonising the entire immune system, and the erythroid and myeloid lineages in all the haematopoietic tissues (such as bone marrow, spleen and thymus). They provide for life-long production of all lineages of haematopoietic cells.
[0115] Haematopoietic progenitor cells have the capacity to differentiate into a specific type of cell. In contrast to stem cells however, they are already far more specific: they are pushed to differentiate into their target cell. A difference between stem cells and progenitor cells is that stem cells can replicate indefinitely, whereas progenitor cells can only divide a limited number of times. Haematopoietic progenitor cells can be rigorously distinguished from HSCs only by functional in vivo assay (i.e. transplantation and demonstration of whether they can give rise to all blood lineages over prolonged time periods).
[0116] The haematopoietic stem and progenitor cells of the invention comprise the CD34 cell surface marker (denoted as CD34.sup.+).
[0117] HSPC Source
[0118] A population of haematopoietic stem and/or progenitor cells may be obtained from a tissue sample.
[0119] For example, a population of haematopoietic stem and/or progenitor cells may be obtained from peripheral blood (e.g. adult and foetal peripheral blood), umbilical cord blood, bone marrow, liver or spleen. Preferably, these cells are obtained from peripheral blood or bone marrow. They may be obtained after mobilisation of the cells in vivo by means of growth factor treatment.
[0120] Mobilisation may be carried out using, for example, G-CSF, plerixaphor or combinations thereof. Other agents, such as NSAIDs and dipeptidyl peptidase inhibitors, may also be useful as mobilising agents.
[0121] With the availability of the stem cell growth factors GM-CSF and G-CSF, most haematopoietic stem cell transplantation procedures are now performed using stem cells collected from the peripheral blood, rather than from the bone marrow. Collecting peripheral blood stem cells provides a bigger graft, does not require that the donor be subjected to general anaesthesia to collect the graft, results in a shorter time to engraftment and may provide for a lower long-term relapse rate.
[0122] Bone marrow may be collected by standard aspiration methods (either steady-state or after mobilisation), or by using next-generation harvesting tools (e.g. Marrow Miner).
[0123] In addition, HSPCs may also be derived from induced pluripotent stem cells.
[0124] HSC Characteristics
[0125] HSCs are typically of low forward scatter and side scatter profile by flow cytometric procedures. Some are metabolically quiescent, as demonstrated by Rhodamine labelling which allows determination of mitochondrial activity. HSCs may comprise certain cell surface markers such as CD34, CD45, CD133, CD90 and CD49f. They may also be defined as cells lacking the expression of the CD38 and CD45RA cell surface markers. However, expression of some of these markers is dependent upon the developmental stage and tissue-specific context of the HSC. Some HSCs called side population cells exclude the Hoechst 33342 dye as detected by flow cytometry. Thus, HSCs have descriptive characteristics that allow for their identification and isolation.
[0126] Negative Markers
[0127] CD38 is the most established and useful single negative marker for human HSCs.
[0128] Human HSCs may also be negative for lineage markers such as CD2, CD3, CD14, CD16, CD19, CD20, CD24, CD36, CD56, CD66b, CD271 and CD45RA. However, these markers may need to be used in combination for HSC enrichment.
[0129] By negative marker it is to be understood that human HSCs lack the expression of these markers.
[0130] Positive Markers
[0131] CD34 and CD133 are the most useful positive markers for HSCs.
[0132] Some HSCs are also positive for lineage markers such as CD90, CD49f and CD93. However, these markers may need to be used in combination for HSC enrichment.
[0133] By positive marker it is to be understood that human HSCs express these markers.
[0134] Differentiated Cells
[0135] A differentiated cell is a cell which has become more specialised in comparison to a stem cell or progenitor cell. Differentiation occurs during the development of a multicellular organism as the organism changes from a single zygote to a complex system of tissues and cell types. Differentiation is also a common process in adults: adult stem cells divide and create fully-differentiated daughter cells during tissue repair and normal cell turnover. Differentiation dramatically changes a cell's size, shape, membrane potential, metabolic activity and responsiveness to signals. These changes are largely due to highly-controlled modifications in gene expression. In other words, a differentiated cell is a cell which has specific structures and performs certain functions due to a developmental process which involves the activation and deactivation of specific genes. Here, a differentiated cell includes differentiated cells of the haematopoietic lineage such as monocytes, macrophages, neutrophils, basophils, eosinophils, erythrocytes, megakaryocytes/platelets, dendritic cells, T-cells, B-cells and NK-cells. For example, differentiated cells of the haematopoietic lineage can be distinguished from stem cells and progenitor cells by detection of cell surface molecules which are not expressed or are expressed to a lesser degree on undifferentiated cells. Examples of suitable human lineage markers include CD33, CD13, CD14, CD15 (myeloid), CD19, CD20, CD22, CD79a (B), CD36, CD71, CD235a (erythroid), CD2, CD3, CD4, CD8 (T) and CD56 (NK).
[0136] Isolation and Enrichment of Populations of Cells
[0137] By isolated population of cells it is to be understood that the population of cells has been previously removed from the body. An isolated population of cells may be cultured and manipulated ex vivo or in vitro using standard techniques known in the art. An isolated population of cells may later be reintroduced into a subject. Said subject may be the same subject from which the cells were originally isolated or a different subject.
[0138] A population of cells may be purified selectively for cells that exhibit a specific phenotype or characteristic, and from other cells which do not exhibit that phenotype or characteristic, or exhibit it to a lesser degree. For example, a population of cells that expresses a specific marker (such as CD34) may be purified from a starting population of cells. Alternatively, or in addition, a population of cells that does not express another marker (such as CD38) may be purified.
[0139] By enriching a population of cells for a certain type of cells it is to be understood that the concentration of that type of cells is increased within the population. The concentration of other types of cells may be concomitantly reduced.
[0140] Purification or enrichment may result in the population of cells being substantially pure of other types of cell.
[0141] Purifying or enriching for a population of cells expressing a specific marker (e.g. CD34 or CD38) may be achieved by using an agent that binds to that marker, preferably substantially specifically to that marker.
[0142] An agent that binds to a cellular marker may be an antibody, for example an anti-CD34 or anti-CD38 antibody.
[0143] The term antibody refers to complete antibodies or antibody fragments capable of binding to a selected target, and including Fv, ScFv, F(ab) and F(ab).sub.2, monoclonal and polyclonal antibodies, engineered antibodies including chimeric, CDR-grafted and humanised antibodies, and artificially selected antibodies produced using phage display or alternative techniques.
[0144] In addition, alternatives to classical antibodies may also be used in the invention, for example avibodies, avimers, anticalins, nanobodies and DARPins.
[0145] The agents that bind to specific markers may be labelled so as to be identifiable using any of a number of techniques known in the art. The agent may be inherently labelled, or may be modified by conjugating a label thereto. By conjugating it is to be understood that the agent and label are operably linked. This means that the agent and label are linked together in a manner which enables both to carry out their function (e.g. binding to a marker, allowing fluorescent identification, or allowing separation when placed in a magnetic field) substantially unhindered. Suitable methods of conjugation are well known in the art and would be readily identifiable by the skilled person.
[0146] A label may allow, for example, the labelled agent and any cell to which it is bound to be purified from its environment (e.g. the agent may be labelled with a magnetic bead, or an affinity tag, such as avidin), detected or both. Detectable markers suitable for use as a label include fluorophores (e.g. green, cherry, cyan and orange fluorescent proteins) and peptide tags (e.g. His tags, Myc tags, FLAG tags and HA tags).
[0147] A number of techniques for separating a population of cells expressing a specific marker are known in the art. These include magnetic bead-based separation technologies (e.g. closed-circuit magnetic bead-based separation), flow cytometry, fluorescence-activated cell sorting (FACS), affinity tag purification (e.g. using affinity columns or beads, such biotin columns to separate avidin-labelled agents) and microscopy-based techniques.
[0148] It may also be possible to perform the separation using a combination of different techniques, such as a magnetic bead-based separation step followed by sorting of the resulting population of cells for one or more additional (positive or negative) markers by flow cytometry.
[0149] Clinical grade separation may be performed, for example, using the CliniMACS system (Miltenyi). This is an example of a closed-circuit magnetic bead-based separation technology.
[0150] It is also envisaged that dye exclusion properties (e.g. side population or rhodamine labelling) or enzymatic activity (e.g. ALDH activity) may be used to enrich for HSCs.
[0151] Vectors
[0152] A vector is a tool that allows or facilitates the transfer of an entity from one environment to another. The vectors used to transduce haematopoietic stem and/or progenitor cells in the present invention are viral vectors. The viral vectors are derived from HIV-1, HIV-2, FIV, BIV, EIAV, CAEV or visna lentivirus. These viruses are all lentiviruses.
[0153] By vector derived from a certain type of virus, it is to be understood that the vector comprises at least one component part derivable from that type of virus.
[0154] Vectors derived from SIV are not included in the present invention. The present invention does not encompass vectors comprising SIV-derived capsid proteins.
[0155] Retroviral and Lentiviral Vectors
[0156] A retroviral vector may be derived from or may be derivable from any suitable retrovirus. A large number of different retroviruses have been identified. Examples include murine leukaemia virus (MLV), human T-cell leukaemia virus (HTLV), mouse mammary tumour virus (MMTV), Rous sarcoma virus (RSV), Fujinami sarcoma virus (FuSV), Moloney murine leukaemia virus (Mo-MLV), FBR murine osteosarcoma virus (FBR MSV), Moloney murine sarcoma virus (Mo-MSV), Abelson murine leukaemia virus (A-MLV), avian myelocytomatosis virus-29 (MC29) and avian erythroblastosis virus (AEV). A detailed list of retroviruses may be found in Coffin, J. M. et al. (1997) Retroviruses, Cold Spring Harbour Laboratory Press, 758-63.
[0157] Retroviruses may be broadly divided into two categories, simple and complex. Retroviruses may be even further divided into seven groups. Five of these groups represent retroviruses with oncogenic potential. The remaining two groups are the lentiviruses and the spumaviruses. A review of these retroviruses is presented in Coffin, J. M. et al. (1997) Retroviruses, Cold Spring Harbour Laboratory Press, 758-63.
[0158] The basic structure of retrovirus and lentivirus genomes share many common features such as a 5 LTR and a 3 LTR. Between or within these are located a packaging signal to enable the genome to be packaged, a primer binding site, integration sites to enable integration into a host cell genome, and gag, pol and env genes encoding the packaging componentsthese are polypeptides required for the assembly of viral particles. Lentiviruses have additional features, such as rev and RRE sequences in HIV, which enable the efficient export of RNA transcripts of the integrated provirus from the nucleus to the cytoplasm of an infected target cell.
[0159] In the provirus, these genes are flanked at both ends by regions called long terminal repeats (LTRs). The LTRs are responsible for proviral integration and transcription. LTRs also serve as enhancer-promoter sequences and can control the expression of the viral genes.
[0160] The LTRs themselves are identical sequences that can be divided into three elements: U3, R and U5. U3 is derived from the sequence unique to the 3 end of the RNA. R is derived from a sequence repeated at both ends of the RNA. U5 is derived from the sequence unique to the 5 end of the RNA. The sizes of the three elements can vary considerably among different retroviruses.
[0161] In a defective retroviral vector genome gag, pol and env may be absent or not functional.
[0162] In a typical retroviral vector, at least part of one or more protein coding regions essential for replication may be removed from the virus. This makes the viral vector replication-defective. Portions of the viral genome may also be replaced by a library encoding candidate modulating moieties operably linked to a regulatory control region and a reporter moiety in the vector genome in order to generate a vector comprising candidate modulating moieties which is capable of transducing a target host cell and/or integrating its genome into a host genome.
[0163] Lentivirus vectors are part of the larger group of retroviral vectors. A detailed list of lentiviruses may be found in Coffin, J. M. et al. (1997) Retroviruses, Cold Spring Harbour Laboratory Press, 758-63. In brief, lentiviruses can be divided into primate and non-primate groups. Examples of primate lentiviruses include but are not limited to human immunodeficiency virus (HIV), the causative agent of human acquired immunodeficiency syndrome (AIDS); and simian immunodeficiency virus (SIV). Examples of non-primate lentiviruses include the prototype slow virus visna/maedi virus (VMV), as well as the related caprine arthritis-encephalitis virus (CAEV), equine infectious anaemia virus (EIAV), and the more recently described feline immunodeficiency virus (FIV) and bovine immunodeficiency virus (BIV).
[0164] The lentivirus family differs from retroviruses in that lentiviruses have the capability to infect both dividing and non-dividing cells (Lewis, Pet al. (1992) EMBO J. 11: 3053-8; Lewis, P. F. et al. (1994) J. Virol. 68: 510-6). In contrast, other retroviruses, such as MLV, are unable to infect non-dividing or slowly dividing cells such as those that make up, for example, muscle, brain, lung and liver tissue.
[0165] A lentiviral vector, as used herein, is a vector which comprises at least one component part derivable from a lentivirus. Preferably, that component part is involved in the biological mechanisms by which the vector infects cells, expresses genes or is replicated.
[0166] The lentiviral vector may be a primate vector. The lentiviral vector may be a non-primate vector (i.e. derived from a virus which does not primarily infect primates, especially humans).
[0167] Examples of non-primate lentiviruses may be any member of the family of lentiviridae which does not naturally infect a primate.
[0168] As examples of lentivirus-based vectors, HIV-1- and HIV-2-based vectors are described below.
[0169] The HIV-1 vector contains cis-acting elements that are also found in simple retroviruses. It has been shown that sequences that extend into the gag open reading frame are important for packaging of HIV-1. Therefore, HIV-1 vectors often contain the relevant portion of gag in which the translational initiation codon has been mutated. In addition, most HIV-1 vectors also contain a portion of the env gene that includes the RRE. Rev binds to RRE, which permits the transport of full-length or singly spliced mRNAs from the nucleus to the cytoplasm. In the absence of Rev and/or RRE, full-length HIV-1 RNAs accumulate in the nucleus. Alternatively, a constitutive transport element from certain simple retroviruses such as Mason-Pfizer monkey virus can be used to relieve the requirement for Rev and RRE. Efficient transcription from the HIV-1 LTR promoter requires the viral protein Tat.
[0170] Most HIV-2-based vectors are structurally very similar to HIV-1 vectors. Similar to HIV-1-based vectors, HIV-2 vectors also require RRE for efficient transport of the full-length or singly spliced viral RNAs.
[0171] In one system, the vector and helper constructs are from two different viruses, and the reduced nucleotide homology may decrease the probability of recombination. In addition to vectors based on the primate lentiviruses, vectors based on FIV have also been developed as an alternative to vectors derived from the pathogenic HIV-1 genome. The structures of these vectors are also similar to the HIV-1 based vectors.
[0172] Preferably the viral vector used in the present invention has a minimal viral genome.
[0173] By minimal viral genome it is to be understood that the viral vector has been manipulated so as to remove the non-essential elements and to retain the essential elements in order to provide the required functionality to infect, transduce and deliver a nucleotide sequence of interest to a target host cell. Further details of this strategy can be found in WO 1998/017815.
[0174] Preferably the plasmid vector used to produce the viral genome within a host cell/packaging cell will have sufficient lentiviral genetic information to allow packaging of an RNA genome, in the presence of packaging components, into a viral particle which is capable of infecting a target cell, but is incapable of independent replication to produce infectious viral particles within the final target cell. Preferably the vector lacks a functional gag-pol and/or env gene and/or other genes essential for replication.
[0175] However, the plasmid vector used to produce the viral genome within a host cell/packaging cell will also include transcriptional regulatory control sequences operably linked to the lentiviral genome to direct transcription of the genome in a host cell/packaging cell. These regulatory sequences may be the natural sequences associated with the transcribed viral sequence (i.e. the 5 U3 region), or they may be a heterologous promoter, such as another viral promoter (e.g. the CMV promoter).
[0176] The vectors may be self-inactivating (SIN) vectors in which the viral enhancer and promoter sequences have been deleted. SIN vectors can be generated and transduce non-dividing cells in vivo with an efficacy similar to that of wild-type vectors. The transcriptional inactivation of the long terminal repeat (LTR) in the SIN provirus should prevent mobilisation by replication-competent virus. This should also enable the regulated expression of genes from internal promoters by eliminating any cis-acting effects of the LTR.
[0177] The vectors may be integration-defective. Integration defective lentiviral vectors (IDLVs) can be produced, for example, either by packaging the vector with catalytically inactive integrase (such as an HIV integrase bearing the D64V mutation in the catalytic site; Naldini, L. et al. (1996) Science 272: 263-7; Naldini, L. et al. (1996) Proc. Natl. Acad. Sci. USA 93: 11382-8; Leavitt, A. D. et al. (1996) J. Virol. 70: 721-8) or by modifying or deleting essential att sequences from the vector LTR (Nightingale, S. J. et al. (2006) Mol. Ther. 13: 1121-32), or by a combination of the above.
[0178] HIV-Derived Vectors
[0179] HIV-derived vectors for use in the present invention are not particularly limited in terms of HIV strain. Numerous examples of sequences of HIV strains may be found at the HIV Sequence Database (http://www.hiv.lanl.gov/content/index).
[0180] In a preferred embodiment, the vector derived from HIV-1 excludes a vector which comprises a capsid protein or a gene encoding for a capsid protein which comprises proline at position 86, glutamine at position 87, valine at position 91 and isoleucine at position 96.
[0181] In addition, vectors derived from SIV (i.e. including SIV component parts) are not included in the present invention.
[0182] For example, a HIV-1-derived vector may be derived from any of the HIV-1 strains NL4-3, IIIB_LAI or HXB2_LAI (X4-tropic), or BAL (R5-tropic), or a chimaera thereof. Preferably, HIV-1-derived vectors are derived from the pMDLg/pRRE Gag-Pol-expressing packaging construct (FIGS. 1-4; U.S. Pat. No. 7,629,153; U.S. Pat. No. 8,652,837; Naldini, L. et al. (1996) Science 272: 263-7; Follenzi, A. et al. (2002) Methods Enzymol. 346: 454-65).
[0183] A HIV-2-derived vector may be derived, for example, from the HIV-2 strain ROD.
[0184] Capsid Proteins
[0185] In a lentiviral particle, the genetic material is contained within a capsid shell and the capsid is in turn contained within a viral envelope. The capsid itself is comprised of a lattice of individual capsid proteins.
[0186] The capsid (CA or p24) protein is encoded by the viral gag gene and is comprised within the Gag polyprotein. Mature capsid is generated by processing of the precursor Gag.
[0187] Herein, amino acid residues within capsid are numbered following a convention whereby the N-terminal proline of the mature capsid derived from the pMDLg/pRRE system is assigned to be residue 1. The amino acid sequence of the mature capsid derived from the pMDLg/pRRE is:
TABLE-US-00001 PIVQNIQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATP QDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRVHPVHAGPIAPGQMRE PRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSP TSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANP DCKTILKALGPGATLEEMMTACQGVGGPGHKARV
[0188] Identities of individual residues and positions of mutations are described herein with reference to this numbering convention. A skilled person would readily be able to determine analogous positions in homologous proteins by performing a sequence alignment to this capsid protein. For example, sequence alignments comparing capsid proteins of a number of HIV-1-derived vectors are shown in
[0189] Incorporating glutamic acid at position 92 and/or threonine at position 88 of the capsid protein gives rise to improved transduction efficiency in the presence of CsA.
[0190] Accordingly, in one embodiment of the present invention, the vector comprises a capsid comprising glutamic acid at position 92.
[0191] In another particularly preferred embodiment, the vector comprises a capsid comprising threonine at position 88.
[0192] The vector of the invention may comprise both glutamic acid at position 92 and threonine at position 88.
[0193] In addition, another aspect of the present invention provides the use of an HIV-1, HIV-2, FIV, BIV, EIAV, CAEV or visna lentivirus-derived capsid mutant for increasing the efficiency of transduction of an isolated population of haematopoietic stem and/or progenitor cells by a vector derived from HIV-1, HIV-2, FIV, BIV, EIAV, CAEV or visna lentivirus in comparison to a vector lacking said mutation, wherein the capsid mutant comprises glutamic acid at position 92 and/or threonine at position 88.
[0194] Positions 92 and 88 are indicated in
[0195] For example,
[0196] It should be understood, however, that the skilled person would readily be able to generate alternative polynucleotide sequences that give rise to the same amino acid sequences due to the degeneracy of the genetic code.
[0197] Nucleotide of Interest
[0198] The vector used in the present invention preferably comprises a nucleotide of interest.
[0199] Preferably the nucleotide of interest gives rise to a therapeutic effect.
[0200] Suitable NOIs include, but are not limited to sequences encoding enzymes, cytokines, chemokines, hormones, antibodies, anti-oxidant molecules, engineered immunoglobulin-like molecules, single chain antibodies, fusion proteins, immune co-stimulatory molecules, immunomodulatory molecules, anti-sense RNA, microRNA, shRNA, siRNA, ribozymes, miRNA target sequences, a transdomain negative mutant of a target protein, toxins, conditional toxins, antigens, tumour suppressor proteins, growth factors, transcription factors, membrane proteins, surface receptors, anti-cancer molecules, vasoactive proteins and peptides, anti-viral proteins and ribozymes, and derivatives thereof (such as derivatives with an associated reporter group). The NOIs may also encode pro-drug activating enzymes.
[0201] An example of a NOI is the beta-globin chain which may be used for gene therapy of thalassemia/sickle cell disease.
[0202] NOIs also include those useful for the treatment of other diseases requiring non-urgent/elective gene correction in the myeloid lineage such as: chronic granulomatous disease (CGD, e.g. the gp91phox transgene), leukocyte adhesion defects, other phagocyte disorders in patients without ongoing severe infections and inherited bone marrow failure syndromes (e.g. Fanconi anaemia), as well as primary immunodeficiencies (SCIDs).
[0203] NOIs also include those useful in the treatment of lysosomal storage disorders and immunodeficiencies.
[0204] Pharmaceutical Composition
[0205] The cells of the present invention may be formulated for administration to subjects with a pharmaceutically acceptable carrier, diluent or excipient. Suitable carriers and diluents include isotonic saline solutions, for example phosphate-buffered saline, and potentially contain human serum albumin.
[0206] Handling of the cell therapy product is preferably performed in compliance with FACT-JACIE International Standards for cellular therapy.
[0207] Haematopoietic Stem and/or Progenitor Cell Transplantation
[0208] The present invention provides a population of haematopoietic stem and/or progenitor cells prepared according to a method of the invention for use in therapy, for example for use in gene therapy.
[0209] The use may be as part of a haematopoietic stem and/or progenitor cell transplantation procedure.
[0210] Haematopoietic stem cell transplantation (HSCT) is the transplantation of blood stem cells derived from the bone marrow (in this case known as bone marrow transplantation) or blood. Stem cell transplantation is a medical procedure in the fields of haematology and oncology, most often performed for people with diseases of the blood or bone marrow, or certain types of cancer.
[0211] Many recipients of HSCTs are multiple myeloma or leukaemia patients who would not benefit from prolonged treatment with, or are already resistant to, chemotherapy. Candidates for HSCTs include paediatric cases where the patient has an inborn defect such as severe combined immunodeficiency or congenital neutropenia with defective stem cells, and also children or adults with aplastic anaemia who have lost their stem cells after birth. Other conditions treated with stem cell transplants include sickle-cell disease, myelodysplastic syndrome, neuroblastoma, lymphoma, Ewing's Sarcoma, Desmoplastic small round cell tumour and Hodgkin's disease. More recently non-myeloablative, or so-called mini transplant, procedures have been developed that require smaller doses of preparative chemotherapy and radiation. This has allowed HSCT to be conducted in the elderly and other patients who would otherwise be considered too weak to withstand a conventional treatment regimen.
[0212] In one embodiment, a population of haematopoietic stem and/or progenitor cells prepared according to a method of the invention is administered as part of an autologous stem cell transplant procedure.
[0213] In another embodiment, a population of haematopoietic stem and/or progenitor cells prepared according to a method of the invention is administered as part of an allogeneic stem cell transplant procedure.
[0214] By autologous stem cell transplant procedure it is to be understood that the starting population of cells (which are then transduced according to a method of the invention) is obtained from the same subject as that to which the transduced cell population is administered. Autologous transplant procedures are advantageous as they avoid problems associated with immunological incompatibility and are available to subjects irrespective of the availability of a genetically matched donor.
[0215] By allogeneic stem cell transplant procedure it is to be understood that the starting population of cells (which are then transduced according to a method of the invention) is obtained from a different subject as that to which the transduced cell population is administered. Preferably, the donor will be genetically matched to the subject to which the cells are administered to minimise the risk of immunological incompatibility.
[0216] Suitable doses of transduced cell populations are such as to be therapeutically and/or prophylactically effective. The dose to be administered may depend on the subject and condition to be treated, and may be readily determined by a skilled person.
[0217] Haematopoietic progenitor cells provide short term engraftment. Accordingly, gene therapy by administering transduced haematopoietic progenitor cells would provide a non-permanent effect in the subject. For example, the effect may be limited to 1-6 months following administration of the transduced haematopoietic progenitor cells. An advantage of this approach would be better safety and tolerability, due to the self-limited nature of the therapeutic intervention.
[0218] Such haematopoietic progenitor cell gene therapy may be suited to treatment of acquired disorders, for example cancer, where time-limited expression of a (potentially toxic) anti-cancer nucleotide of interest may be sufficient to eradicate the disease.
[0219] The methods, cell populations and/or CsA of the present invention may be useful in the treatment of the disorders listed in WO 1998/005635. For ease of reference, part of that list is now provided: cancer, inflammation or inflammatory disease, dermatological disorders, fever, cardiovascular effects, haemorrhage, coagulation and acute phase response, cachexia, anorexia, acute infection, HIV infection, shock states, graft-versus-host reactions, autoimmune disease, reperfusion injury, meningitis, migraine and aspirin-dependent anti-thrombosis; tumour growth, invasion and spread, angiogenesis, metastases, malignant, ascites and malignant pleural effusion; cerebral ischaemia, ischaemic heart disease, osteoarthritis, rheumatoid arthritis, osteoporosis, asthma, multiple sclerosis, neurodegeneration, Alzheimer's disease, atherosclerosis, stroke, vasculitis, Crohn's disease and ulcerative colitis; periodontitis, gingivitis; psoriasis, atopic dermatitis, chronic ulcers, epidermolysis bullosa; corneal ulceration, retinopathy and surgical wound healing; rhinitis, allergic conjunctivitis, eczema, anaphylaxis; restenosis, congestive heart failure, endometriosis, atherosclerosis or endosclerosis.
[0220] In addition, or in the alternative, the methods, cell populations and/or CsA of the present invention may be useful in the treatment of the disorders listed in WO 1998/007859. For ease of reference, part of that list is now provided: cytokine and cell proliferation/differentiation activity; immunosuppressant or immunostimulant activity (e.g. for treating immune deficiency, including infection with human immune deficiency virus; regulation of lymphocyte growth; treating cancer and many autoimmune diseases, and to prevent transplant rejection or induce tumour immunity); regulation of haematopoiesis, e.g. treatment of myeloid or lymphoid diseases; promoting growth of bone, cartilage, tendon, ligament and nerve tissue, e.g. for healing wounds, treatment of burns, ulcers and periodontal disease and neurodegeneration; inhibition or activation of follicle-stimulating hormone (modulation of fertility); chemotactic/chemokinetic activity (e.g. for mobilising specific cell types to sites of injury or infection); haemostatic and thrombolytic activity (e.g. for treating haemophilia and stroke); anti-inflammatory activity (for treating e.g. septic shock or Crohn's disease); as antimicrobials; modulators of e.g. metabolism or behaviour; as analgesics; treating specific deficiency disorders; in treatment of e.g. psoriasis, in human or veterinary medicine.
[0221] In addition, or in the alternative, the methods, cell populations and/or CsA of the present invention may be useful in the treatment of the disorders listed in WO 1998/009985. For ease of reference, part of that list is now provided: macrophage inhibitory and/or T cell inhibitory activity and thus, anti-inflammatory activity; anti-immune activity, i.e. inhibitory effects against a cellular and/or humoral immune response, including a response not associated with inflammation; inhibit the ability of macrophages and T cells to adhere to extracellular matrix components and fibronectin, as well as up-regulated fas receptor expression in T cells; inhibit unwanted immune reaction and inflammation including arthritis, including rheumatoid arthritis, inflammation associated with hypersensitivity, allergic reactions, asthma, systemic lupus erythematosus, collagen diseases and other autoimmune diseases, inflammation associated with atherosclerosis, arteriosclerosis, atherosclerotic heart disease, reperfusion injury, cardiac arrest, myocardial infarction, vascular inflammatory disorders, respiratory distress syndrome or other cardiopulmonary diseases, inflammation associated with peptic ulcer, ulcerative colitis and other diseases of the gastrointestinal tract, hepatic fibrosis, liver cirrhosis or other hepatic diseases, thyroiditis or other glandular diseases, glomerulonephritis or other renal and urologic diseases, otitis or other oto-rhino-laryngological diseases, dermatitis or other dermal diseases, periodontal diseases or other dental diseases, orchitis or epididimo-orchitis, infertility, orchidal trauma or other immune-related testicular diseases, placental dysfunction, placental insufficiency, habitual abortion, eclampsia, pre-eclampsia and other immune and/or inflammatory-related gynaecological diseases, posterior uveitis, intermediate uveitis, anterior uveitis, conjunctivitis, chorioretinitis, uveoretinitis, optic neuritis, intraocular inflammation, e.g. retinitis or cystoid macular oedema, sympathetic ophthalmia, scleritis, retinitis pigmentosa, immune and inflammatory components of degenerative fondus disease, inflammatory components of ocular trauma, ocular inflammation caused by infection, proliferative vitreo-retinopathies, acute ischaemic optic neuropathy, excessive scarring, e.g. following glaucoma filtration operation, immune and/or inflammation reaction against ocular implants and other immune and inflammatory-related ophthalmic diseases, inflammation associated with autoimmune diseases or conditions or disorders where, both in the central nervous system (CNS) or in any other organ, immune and/or inflammation suppression would be beneficial, Parkinson's disease, complication and/or side effects from treatment of Parkinson's disease, AIDS-related dementia complex HIV-related encephalopathy, Devic's disease, Sydenham chorea, Alzheimer's disease and other degenerative diseases, conditions or disorders of the CNS, inflammatory components of stokes, post-polio syndrome, immune and inflammatory components of psychiatric disorders, myelitis, encephalitis, subacute sclerosing pan-encephalitis, encephalomyelitis, acute neuropathy, subacute neuropathy, chronic neuropathy, Guillaim-Barre syndrome, Sydenham chora, myasthenia gravis, pseudo-tumour cerebri, Down's Syndrome, Huntington's disease, amyotrophic lateral sclerosis, inflammatory components of CNS compression or CNS trauma or infections of the CNS, inflammatory components of muscular atrophies and dystrophies, and immune and inflammatory related diseases, conditions or disorders of the central and peripheral nervous systems, post-traumatic inflammation, septic shock, infectious diseases, inflammatory complications or side effects of surgery, bone marrow transplantation or other transplantation complications and/or side effects, inflammatory and/or immune complications and side effects of gene therapy, e.g. due to infection with a viral carrier, or inflammation associated with AIDS, to suppress or inhibit a humoral and/or cellular immune response, to treat or ameliorate monocyte or leukocyte proliferative diseases, e.g. leukaemia, by reducing the amount of monocytes or lymphocytes, for the prevention and/or treatment of graft rejection in cases of transplantation of natural or artificial cells, tissue and organs such as cornea, bone marrow, organs, lenses, pacemakers, natural or artificial skin tissue.
[0222] In addition, or in the alternative, the methods, cell populations and/or CsA of the present invention may be useful in the treatment of -thalassemia, chronic granulomatous disease, metachromatic leukodystrophy, mucopolysaccharidoses disorders and other lysosomal storage disorders.
[0223] Kit
[0224] In another aspect, the present invention provides a kit comprising CsA and/or cell populations of the invention.
[0225] The CsA and/or cell populations may be provided in suitable containers. The kit may also include instructions for use.
[0226] Method of Treatment
[0227] It is to be appreciated that all references herein to treatment include curative, palliative and prophylactic treatment; although in the context of the present invention references to preventing are more commonly associated with prophylactic treatment. The treatment of mammals, particularly humans, is preferred. Both human and veterinary treatments are within the scope of the present invention.
EXAMPLES
Example 1
[0228] Materials and Methods
[0229] Vectors
[0230] Third generation lentivirus (LV) stocks were prepared, concentrated and titred as previously described (Dull, T. et al. (1998) J. Virol. 72: 8463-71; Follenzi, A. et al. (2000) Nat. Genetics 25: 217-22). Briefly, self-inactivating (SIN) LV vectors were produced using the transfer vector pCCLsin.cPPT.hPGK.eGFP.Wpre, the packaging plasmid pMDLg/pRRE, Rev-expressing pCMV-Rev and the VSV-g envelope-encoding pMD2.VSV-G plasmids. Bald vector, a normal LV produced by omitting the Env-encoding plasmid during vector production, was produced as a negative control. During vector production, the Env construct was substituted by pcDNA3.1 (Invitrogen Inc.). For SINLV capsid mutants, vectors were produced as described above, except that the wild-type pMDLg/pRRE was replaced with a packaging plasmid harbouring a specific point-mutation in the p24 coding region as follows: pMDLg/pRRE-N74D; pMDLg/pRRE-P90A; pMDLg/pRRE-A105T; pMDLg/pRRE-V86M; pMDLg/pRRE-A92E; pMDLg/pRRE-A88T. All modified packaging plasmids were purchased from GenScript Inc. The SIN-retroviral vector (SIN-RV) was produced as previously described (Montini, E. et al. (2006) Nat. Biotechnol. 24: 687-96) using as transfer vector RVrkat43.2MLV_GFP, the packaging plasmid pCM-gag-pol and the VSV-g envelope-encoding pMD2.VSV-G plasmid.
[0231] Cells
[0232] Cell Lines
[0233] The human embryonic kidney 293T cells (HEK293T) as well as the human K562 myelogenous leukaemia cell lines were maintained in Iscove's modified Dulbecco's medium (IMDM; Sigma) supplemented with 10% foetal bovine serum (FBS; Gibco), penicillin (100 IU/mL), streptomycin (100 g/mL) and 2% glutamine.
[0234] Primary Cells
[0235] Human CD34.sup.+ HSPC, CD4.sup.+ T cells and CD14.sup.+ monocytes were isolated through positive magnetic bead selection according to the manufacturer's instructions (Miltenyi) from umbilical cord blood collected upon informed consent from healthy volunteers according to the Institutional Ethical Committee approved protocol (TIGET01). Otherwise, cord blood (CB) and bone marrow (BM)-derived CD34.sup.+ cells were purchased from Lonza.
[0236] CD4.sup.+ T cells were activated in RPMI, supplemented with 10% FBS, penicillin (100 IU/mL), streptomycin (100 g/mL), 2% glutamine, phytohaemagglutanin (PHA) (2 g/mL, Roche) and IL-2 (300 IU/mL, Novartis) for three days and maintained in RPMI supplemented with 10% FBS, penicillin (100 IU/mL), streptomycin (100 g/mL), 2% glutamine and IL-2 (300 UI/mL). Monocyte-derived macrophages (MDM) were differentiated from isolated CD14.sup.+ monocytes in DMEM supplemented with 10% FBS, penicillin (100 IU/mL), streptomycin (100 g/mL), 2% glutamine and 5% human serum AB (Lonza) for seven days.
[0237] All cells were maintained in a 5% CO.sub.2 humidified atmosphere at 37 C.
[0238] Transduction
[0239] Human CB and BM-derived haematopoietic stem/progenitor cells (HSPC) were cultured in serum-free StemSpan medium (StemCell Technologies) supplemented with 100 ng/mL recombinant human stem cell factor (rhSCF), 20 ng/mL recombinant human thrombopoietin (rhTPO), 100 ng/mL recombinant human Flt3 ligand (rhFlt3) and 20 ng/mL recombinant human IL6 (rhIL6) (all from Peprotech) 16 to 24 hours prior to transduction. HSPC were then transduced at a concentration of 110.sup.6 cells per mL with vesicular stomatitis virus glycoprotein (VSV-G)-pseudotyped SINLV for 20 hours at the indicated multiplicity of infection (MOI) in the same medium. After transduction, cells were washed and maintained serum-free StemSpan supplemented with cytokines as above until the reading of GFP-positive (GFP+) cells by FACS. After FACS they were maintained in Roswell Park Memorial Institute medium (RPMI, Lonza) supplemented with 10% FBS, 25 ng/mL rhSCF, 5 ng/mL rhIL6, 25 ng/mL rhFlt3 and 5 ng/mL rhTPO for another seven days before analysis of vector copy numbers. MDM were transduced 7 days after differentiation. T lymphocytes were transduced at a concentration of 10.sup.6 cells per mL, after 3 days of stimulation. All the cells were exposed to the vector for 16-20 hours.
[0240] Compounds
[0241] Cyclosporin A, FK506, rapamycin and 3-MA (all from Sigma-Aldrich) were resuspended and stored according to the manufacturer's instructions. They were added to the transduction medium at the indicated concentration and washed out with the vector 16-20 hours later.
[0242] Transplantation of Human HSPC in NSG Mice
[0243] NOD-SCID-IL2Rg/ (NSG) mice were purchased from Jackson laboratory. All animal procedures were performed according to protocols approved by the Animal Care and Use Committee of the Ospedale San Raffaele (IACUC 661) and communicated to the Ministry of Health and local authorities according to Italian law. Human cord blood-derived CD34.sup.+ cells (purchased from Lonza, 2C-101) were pre-stimulated and transduced as described previously with SINLV-GFP at a MOI of 10 in presence of DMSO/CsA/Rapa or their combination as indicated. After transduction, 1.310.sup.5 cells were infused into the tail vein of sublethally irradiated 10-week-old NSG mice (radiation dose: 200 cGy for mice weighing 18-25 g and 220 cGy for mice above 25 g of weight). Transduced and untransduced cells were also cultured in vitro for 14 days for further analysis. In vitro cultured cells and BM cells isolated from transplanted mice at the time of sacrifice were then used to quantify the VCN by qPCR.
[0244] Colony-Forming Cell Assay
[0245] Colony-forming cell assays were performed by plating 810.sup.2 human cord blood-derived CD34.sup.+ cells transduced with SINLV-GFP at a MOI of 10 in presence of the different compounds in a methylcellulose-based medium (Methocult GF4434, Stem Cell Technologies). 15 days later, colonies were scored by light microscopy for colony numbers and morphology. CFU-E and BFU-E were scored as erythroid colonies, while CFU-G, CFU-M, CFU-GM and CFU-GEMM as myeloid colonies.
[0246] Flow Cytometry
[0247] All cytometric analyses were performed using a FACSCanto III instrument and LSRFortessa instruments (BD Biosciences), and analysed with FACS Express software (De Novo Software).
[0248] Transduced Cells
[0249] GFP expression in transduced cells was measured 5-7 days post-transduction. Adherent MDM were detached by scraping in 5 mM PBS-EDTA, washed and resuspended in PBS containing 2% FBS. Cells grown in suspension were washed and resuspended in PBS containing 2% FBS. To exclude dead cells from the analysis, 10 ng/mL 7-aminoactinomycin D (7-AAD) was added.
[0250] Human Colonies
[0251] Human differentiated cells from CFC were harvested from a single plate (pool of colonies) and mixed into a single cell suspension. Cells were then washed and resuspended in PBS containing 2% FBS. For immunostaining, cells were incubated with anti-human receptor blocking antibodies for 15 min at 4 C. and then stained for 20 min at 4 C. with anti-human CD235a and CD33 antibodies (for antibodies, see Table 1). To exclude dead cells from the analysis, cells were washed and resuspended in PBS containing 10 ng/mL 7-aminoactinomycin D (7-AAD).
TABLE-US-00002 TABLE 1 Fluoro- Antibody chrome Dilution Clone Company Code hCD235a APC 1:25 GA-R2 BD 551336 Biosciences hCD33 BV421 1:25 WM53 BD 562854 Biosciences Anti human 1:50 Miltenyi 120-000-442 FCR Blocking Biotec hCD45 APCh7 1:25 2D1 BD 641417 Biosciences hCD19 PE 1:25 SJ25C1 BD 345789 Biosciences hCD33 PeCy7 1:25 P67.6 BD 333952 Biosciences hCD3 APC 1:25 UCHT1 BD 555335 Biosciences hCD13 BV 1:25 WM15 BD 562596 Biosciences hCD34 PeCy7 1:25 8G12 BD 348811 Biosciences hCD38 V450 1:25 HB7 BD 646851 Biosciences hCD90 APC 1:25 5E10 BD 559869 Biosciences Hcd133/2 PE 1:25 293C3 Miltenyi 130-090-853 Biotec
[0252] Peripheral Blood From Mice
[0253] For each mouse, 250 L of peripheral blood were added to 15 L of PBS containing 45 mg/mL EDTA. For immunostaining, a known volume of whole blood (100 L) was first incubated with anti-human FcIII/II receptor (Cd16/Cd32) blocking antibodies for 15 min at 4 C. and then incubated in the presence of monoclonal antibodies (for antibodies, see Table 1) for 20 min at 4 C. Erythrocytes were removed by lysis with the TQ-Prep workstation (Beckman-Coulter) in the presence of an equal volume of FBS (100 L) to protect white blood cells.
[0254] Bone Marrow
[0255] BM cells were obtained by flushing the femurs in PBS 2% FBS solution. Cells (110.sup.6 cells) were washed, resuspended in 100 L of PBS containing 2% FBS, and incubated with anti-human receptor (Cd16/Cd32) blocking antibodies for 15 min at 4 C. Staining was then performed with monoclonal antibodies (for antibodies, see Table 1) for 20 min at 4 C. Cells were washed and finally resuspended in PBS containing 2% FBS.
[0256] Spleen
[0257] Spleens were first smashed and the resulting cell suspension was passed through 40 m nylon filter and washed in cold phosphate buffered saline (PBS) containing 2 mM EDTA and 0.5% bovine serum albumin (BSA). Cells were incubated with anti-human receptor (Cd16/Cd32) blocking antibodies for 15 min at 4 C. and then stained with anti-human monoclonal antibodies (for antibodies, see Table 1) for 20 min at 4 C. Cells were finally washed and resuspended in PBS containing 2% FBS.
[0258] RNA Extraction, qPCR and Gene Expression Analysis
[0259] RNA extraction from cells was performed using the RNeasy Plus Mini Kit (Qiagen). Briefly, cells were lysed in Buffer RLT plus, supplemented with -mercaptoethanol. RNA was then extracted according to manufacturer's instructions. The extracted mRNAs were retrotranscribed using the SuperScript Vilo kit (11754250, Invitrogen). qPCR analyses were done using TaqMan probes from Applied Biosystems (see below). qPCR was run for 40 cycles using the Viia 7 instrument while the Viia 7 software was then used to extract the raw data (Ct). To determine gene expression, the difference (Ct) between the threshold cycle (Ct) of each gene and that of the reference gene was calculated by applying an equal threshold. Relative quantification values were calculated as the fold-change expression of the gene of interest over its expression in the reference sample, by the formula 2-Ct. The expression of the human CypA gene was assessed in K562 cell line, CD4.sup.+ primary T cells, MDM and CB-derived CD34.sup.+ cells. The expression was normalised using the housekeeping gene HPRT1. The following Taqman probes from Applied Biosystems were used: PPIA (Hs99999904_m1) and HPRT1 (Hs01003267_m1).
[0260] Replication Intermediates
[0261] CB-derived CD34.sup.+ cells were transduced at a MOI of 100, in the presence or absence of CsA or rapamycin. To analyse viral replication intermediates, transduced cells were washed and resuspended in Monini lysis buffer (0.1% polyoxyethylene 10 lauryl ether (Sigma), 0.1 mg/mL proteinase K (Promega)) (25 L per 110.sup.5 cells), incubated at 65 C. for 2 h and heat inactivated at 94 C. for 15 min (Monini, P. et al. (1999) Blood 93: 4044-58). Lysis of the cells to retrieve late-RT and 2LTR intermediates was performed at 24 hours post-transduction. Late-RT and 2LTR circles were measured by semi-quantitative Taqman assay with primers described below and normalised using the human TERT gene. Results are expressed as fold versus the DMSO control, as described above.
[0262] The primers to detect late-RT products are:
TABLE-US-00003 LATERT(5NC2rev): 5-GAGTCCTGCGTCGAGAGAG-3 (Naldini,L.etal.(1996)Science272:263-7) LATERTfwDU3sense: 5-TCACTCCCAACGAAGACAAGATC-3 (Matrai,J.etal.(2011)Hepatology53:1696-707)
[0263] The primers to detect 2LTR products are, according to (De laco A, Luban J. Inhibition of HIV-1 infection by TNPO3 depletion is determined by capsid and detectable after viral cDNA enters the nucleus. Retrovirology. 2011; 8: 98;
TABLE-US-00004 2junct: 5-CAGTGTGGAAAATCTCTAGCAGTAC-3 J2rev: 5-GCCGTGCGCGCTTCAGCAAGC-3
[0264] Other primers to detect 2LTR products are (
TABLE-US-00005 2LTRfw: 5-AACTAGGGAACCCACTGCTTAAG-3 2LTRrv: 5-GATCTTGTCTTCGTTGGGAGTGA-3 2LTRprobe: 5-FAM-ACACTACTTGAAGCACTCAAGGCAAGCTT-TAMRA-3
[0265] The primers to detect TELO are:
TABLE-US-00006 hTelofw: 5-GGCACACGTGGCTTTTCG-3 (Follenzi,A.etal.(2002)MethodsEnzymol. 346:454-65) hTelorev: 5-GGTGAACCTCGTAAGTTTATGCAA-3 hTeloprobe: VIC-5 TCAGGACGTCGAGTGGACACGGTG-3-TAMRA
[0266] Genomic DNA Extraction and qPCR
[0267] DNA from cell cultures was extracted using a Maxwell 16 instrument (Promega) or Blood & Cell Culture DNA Micro Kit (Qiagen). To amplify the vector sequence, primers and probes complementary to the vector Rev responsive element sequence were used. Vector copy numbers and replication intermediates were normalised to genomic DNA content, which was assessed using the human TERT gene. Quantitative polymerase chain reaction (qPCR) primers and probe sequences and conditions were previously described (Santoni de Sio, F. R. et al (2006) Blood 107: 4257-65).
[0268] ELISA
[0269] To assess the secretion of human IFN upon transduction of CB-derived HSPCs in the presence of the different compounds, supernatants from transduced cells were harvested 24 hours post-transduction and the IFN concentration was assessed using the VeriKine Human IFN Alpha ELISA Kit (PBL interferon source, #41100) according to manufacturer's instructions.
[0270] Western Blot
[0271] Whole cell extracts were prepared from K562, HSPC, CD4.sup.+ T cells and MDM as previously described (Kajaste-Rudnitski, A. et al. (2011) J. Virol. 85: 5183-96; Kajaste-Rudnitski, A. et al. (2006) J. Biol. Chem. 281: 4624-37). Samples were subjected to SDS-PAGE, transferred to PVDF membrane by electroblotting, and blotted with a mouse polyclonal antibody (Ab) raised against CypA (Santa-Cruz Biotechnology). An anti-actin Ab (Sigma-Aldrich) was used as a normaliser.
[0272] Statistical Analysis
[0273] In all studies, values are expressed as meanstandard error of the mean (SEM). Statistical analyses were performed by unpaired Student's t test or ANOVA for multiple comparisons, as indicated. Percentages were converted into Log ODDs for statistical analysis. Differences were considered statistically significant at p<0.05.
[0274] Results
[0275] Cyclosporin A (CsA) increases lentiviral transduction specifically in human haematopoietic stem and progenitor cells.
[0276] In order to test how exposure of human CD34.sup.+ haematopoietic stem and progenitor cells (HSPCs) to the immunosuppressive drug cyclosporine (CsA) would impact on LV transduction, cytokine-stimulated cord-blood (CB)-derived CD34.sup.+ cells were first exposed to a VSV-g pseudotyped HIV-1-derived self-inactivating (SIN) lentiviral vector expressing GFP under the control of the PGK promoter (SINLV-GFP) at increasing multiplicities of infection (MOD, in the presence or absence of increasing concentrations of CsA. Interestingly, although the two lowest concentrations of CsA did not improve LV transduction, both 10 M and 50 M CsA lead to a significant increase in the percentage of GFP+ cells measured by FACS 5 days post-exposure (
[0277] CB and bone marrow (BM)-derived CD34.sup.+ cells were stimulated with a growth-promoting cocktail of cytokines for 24 hours prior to transduction. Cells were then exposed to the SINLV-GFP at a MOI of 1, in the presence or absence of 10 M CsA. Transduction efficiency was measured 5 days post-exposure by FACS, and vector copy numbers (VCN) were assessed at 14 days post-transduction. CsA treatment consistently led to a 3-fold increase in the percentage of GFP+ cells, both in CB and BM-derived HSPC (
[0278] CsA, as a complex with the host immunophilin cyclophilin A (CypA), is a potent inhibitor of the Ca.sup.2+-dependent phosphatase calcineurin (Colgan, J. et al. (2005) J. lmmunol. 174: 6030-8). To understand whether the effect of CsA on LV transduction was dependent on the inhibition of calcineurin, we transduced CB and BM-derived CD34.sup.+ cells in presence of FK-506, a compound which blocks calcineurin similarly to CsA but independently of CypA (Schreiber, S. L. et al. (1992) Immunology Today 13: 136-42). FK-506 had no impact on LV transduction efficiencies in HSPCs, nor in differentiated CD4.sup. T cells and MDM, ruling out involvement of calcineurin-mediated immunosuppression in the CsA impact on transduction (
[0279] CsA Improves LV Transduction Alone and in Addition to LV Harbouring Mutant Viral Capsids (CA) in HSPC
[0280] Besides acting as an immunomodulator, CsA is also known to disrupt the interaction between the host CypA and the HIV-1 capsid (CA or p24), thereby compromising efficient infection (Towers, G. J. et al. (2003) Nat. Medicine 9: 1138-43), as observed for CD4.sup.+ T cells and MDM (
TABLE-US-00007 TABLE 2 CA Mutants Phenotypes References P90A CypA and Nup153- (Rasaiyaah, J. et al. (2013) Nature 503: independent 402-5) N74D TNPO3 and Nup153- (Zhou, L. et al. (2011) PLoS Pathog. 7: independent, CPSF6-358 e1002194; Price, A. J. et al. (2012) PLoS escape mutant, affects Pathog. 8: e1002896) CypA interaction V86M Alters CypA-CA (Veillette, M. et al. (2013) Retrovirology 10: interaction relieving hT5 25) restricted mutants A105T Relieves CypA-mediated (Qi, M. et al. (2008) J. Virol. 82: 12001-8) restriction of CsA- dependent CA mutants A92E CypA-independent, CsA- (De laco, A. et al. (2014) Retrovirology 11: dependent in some cell 11; Song, C. et al. (2007) J. Virol. 81: lines, still interacts with 11946-56; Ylinen, L. M. et al. (2009) J. CypA Virol. 83: 2044-7) A88T M B escape mutant, no (Liu, Z. et al. (2013) Cell Host Microbe 14: longer binds CypA 398-410)
[0281] All CA mutants showed impaired transduction efficiencies in CD4.sup.+ T cells, in which CypA is an LV promoting factor, despite similar infectivity as the wild-type (WT) vector in 293T cells (
[0282] Taken together, our results suggest that CsA-mediates both CA-independent and dependent increase in LV transduction and provides an additive benefit in combination with A92E and A88T mutant CA.
[0283] Combination of CsA with Rapamycin Provides a Further Increase in LV Transduction in HSPC
[0284] We compared the impact of CsA on LV transduction to that of rapamycin alone or in combination with CsA in both CB and BM-derived HSPC. We chose the 10 g/ml concentration of rapamycin for our experiments as it was associated with improved transduction efficiency over lower doses (
[0285] Similarly to human HSPC, both CsA and rapamycin, as well as their combination, significantly improved transduction also in murine Lin.sup. HSPC (
[0286] Importantly, we observed that both CsA and rapamycin, as well as their combination, yielded equally improved transduction levels in all HSPC subpopulations ranging from the more committed CD34.sup. progenitors to the most primitive CD34.sup.+CD133.sup.+CD90.sup.+ cells (
[0287] A recent report suggests that quiescent HSPC are poorly permissive to VSV-g-pseudotyped LV transduction because of low levels of expression of its receptor, the low-density lipid receptor (LDL-R). Increased permissivity to transduction upon cytokine-stimulation was shown to correlate with increased LDL-R expression. We examined whether CsA and Rapa could further increase LDL-R levels in cytokine-stimulated human HSPC. No major differences in LDL-R surface expression were observed between the different groups at 6 hours after exposure (
[0288] CsA and Rapamycin do not Alter Colony-Forming Capacity of Vital HSPC in Semi-Solid Culture while Maintaining Efficient Transduction.
[0289] With the perspective of improving LV transduction efficiencies in a clinical setting, we addressed whether CsA and rapamycin are able to improve LV transduction in clonogenic progenitors without hampering their colony-forming capacity. For this purpose, CB-derived CD34.sup.+ HSPC were transduced with the GFP-expressing LV at a MOI of 10, in the presence or absence of CsA/rapamycin, followed by plating of vital cells the day after in semi-solid methylcellulose. No significant differences were observed between the different treatments in the number of total, colony-forming unit-granulocyte/macrophage (CFU-GM) (myeloid) and burst-forming unit erythroid (BFU-E) (erythroid) colonies deriving from CB CD34.sup.+ cells, although a trend towards lower CFU counts was seen for the combination CsA+rapannycin (
[0290] CsA and Rapamycin Improve Transduction Efficiency of Long-Term Repopulating HSPC without Affecting their Engraftment and Repopulation Capacity
[0291] In order to assess the impact of the two immunosuppressive compounds on LV transduction, engraftment and repopulation capacity of long-term repopulating HSPC, CB-derived CD34.sup.+ cells were transduced in the presence or absence of CsA/rapamycin and transplanted the day after in 10 week-old NSG mice (130,000 cells per mouse). FACS analysis of the peripheral blood of mice at 11 weeks after transplant showed similar engraftment levels of human CD45.sup.+ cells (40%) in all treatment groups (
[0292] The engraftment levels of human CD45.sup.+ cells in the BM of mice at 20 weeks post-transplant were comparable among the DMSO, CsA, and CsA+rapamycin-treatment groups (465%), while the rapamycin-treatment group showed a statistically significant increase in the levels of engraftment with respect to controls (p<0.047 v. DMSO) (
[0293] In the spleen of the transplanted mice, the levels of total human CD45.sup.+ cells and of the different haematopoietic lineages (B, T and myeloid cells) were comparable among the different groups (
[0294] Overall, these results indicate that both CsA and rapamycin treatments improve LV-mediated gene transfer in CB-derived CD34.sup.+ without altering their short-term and long-term repopulating ability.
[0295] Both CsA and Rapamycin Improve Transduction Efficiency of Clinical Grade LV
[0296] We also tested the capacity of both CsA and rapamycin to improve transduction efficiency of a clinical grade SINLV. For this purpose, cytokine-stimulated CB-derived CD34.sup.+ cells were transduced with increasing MOIs of a PGK-GFP SINLV produced by Molmed SpA utilising the same large-scale setting and downstream processing that has been applied in the context of recent clinical trials conducted at our institute using SINLVs as delivery vehicles of the therapeutic gene (Biffi, A. et al. (2013) Science 341: 1233158; Aiuti, A. et al. (2013) Science 341: 1233151). These procedures efficiently remove as much of the contaminant by-products, such as plasmid DNA and cell debris, as possible but render the vector preparations less infectious than the standard laboratory-grade stocks (Merten, O. W. et al. (2011) Human Gene Ther. 22: 343-56). Importantly, we observed that both CsA and rapamycin yielded increased transduction efficiencies also in this context reaching up to 60% of GFP+ cells in rapamycin-treated, 70% of GFP+ cells in CsA-treated and 78% of GFP+ cells in CsA+rapamycin treated HSPC at a MOI of 10 (
[0297] The Effects of CsA and Rapamycin are LV-Specific and Impact on Separate Steps of the Viral Life Cycle
[0298] In order to better understand the host and viral partners potentially involved in CsA/rapamycin-mediated improvement of transduction in HSPC, we first tested whether these compounds could also increase y-retroviral gene transfer in HSPC. For this purpose both CB and BM-derived CD34.sup.+ cells were transduced with a GFP-expressing -retroviral SIN vector (SINRV) at a MOI of 10, in the presence or absence of CsA/rapamycin. Interestingly, neither compound was able to significantly increase the percentage of GFP+ cells in either CB or BM-derived HSPC (
[0299] These results suggest that rapamycin improves LV transduction during the early phases of the viral life cycle while CsA seems to act only after nuclear entry of the pre-integration complex.
[0300] Discussion
[0301] Two immunosuppressive compounds, cyclosporin A (CsA) and rapamycin (Rapa), significantly improve LV transduction efficiency in human HSPC, acting on distinct steps of the LV life cycle. Interestingly, the effects of CsA were HSPC-specific and opposite to that occurring in differentiated haematopoietic cell lines and primary cells.
[0302] CsA has revolutionised human organ transplantation due to its ability to block the activation of lymphocytes and other immune cells. Besides its immunomodulatory capacity, CsA is also well known in the field of HIV-1 research as a compound interfering with the early steps of the lentiviral life cycle in human cells due to its capacity to disrupt the interaction between the host chaperone cyclophilin A (CypA) and the viral capsid (CA) (Sokolskaja, E. et al. (2006) Curr. Opin. Microbiol. 9: 404-8; Towers, G. J. (2007) Retrovirology 4: 40).
[0303] Interestingly, we observed that CsA is able to improve LV transduction at concentrations above 1 M, in a range required to disrupt CypA-CA interaction (Luban, J. et al. (1993) Cell 73: 1067-78) rather than to act as an immunosuppressor (Colgan, J. et al. (2005) J. Immunol. 174: 6030-8). Indeed, the calcineurin-mediated immunomodulatory signal transduction is unlikely to be involved in the effects of CsA on LV transduction in HSPC, as FK506, another compound inhibiting the same pathway, did not affect LV gene transfer in these cells.
[0304] The disruption of the CypA-CA interaction by CsA is thought to lead to premature uncoating of the viral core and inhibition of infection, as we also observed in differentiated CD4.sup.+ T cells and MDM, although the exact mechanisms remain unclear. Remarkably, we have observed exactly the opposite effect of CsA in the HSPC compartment in which, instead of abrogating transduction, CsA leads to a consistent 3-fold increase in the efficiency of LV gene transfer. Interestingly, this type of CsA-mediated benefit is usually observed in the context of cross-species infection due to disruption of the interaction of the lentiviral core with the host restriction factor TRIM5 (Strebel, K. et al. (2009) BMC Medicine 7: 48). However, human TRIM5 notoriously has very poor HIV-1 restrictive capacity (Towers, G. J. (2007) Retrovirology 4: 40), although a very recent report suggests that variable levels of TRIM5 expression in human HSPCs could correlate with donor-dependent variability in permissivity to LV transduction (Evans, M. E. et al. (2013) TRIM5alpha Variations Influence Transduction Efficiency With Lentiviral Vectors in Both Human and Rhesus CD34 Cells In Vitro and In Vivo, Molecular therapy:The Journal of the American Society of Gene Therapy). In this regard, we should point out that the CB-derived HSPC tested for CsA and rapamycin-mediated effects on transduction were donor-matched with the CD4.sup.+ T cells and MDM, in which the two compounds had very opposite effects, rendering it difficult to reconcile our observations with a donor-dependent TRIM5 restriction block in HSPC.
[0305] To investigate potential involvement of the LV capsid in CsA-mediated effects, we generated a series of packaging constructs each harbouring a specific CA point-mutation with known properties regarding its capacity to bind to CypA, interact with the nuclear pore complex, depend on CsA (Schaller, T. et al. (2011) PLoS Pathog. 7: e1002439) or escape TRIM5-mediated restriction (Veillette, M. et al. (2013) Retrovirology 10: 25). The chosen point-mutants had never been tested in HSPC to the best of our knowledge, although efforts to manipulate the LV core with the aim of improving transduction have been reported in the past (Kahl, C. A. et al. (2008) Gene Therapy 15: 1079-89; Uchida, N. et al. (2013) Exp. Hematol. 41: 779-88 e771). Although cell-type dependent effects of CsA have been reported (De laco, A. et al. (2014) Retrovirology 11: 11; Sokolskaja, E. et al. (2004) J. Virol. 78: 12800-8; Song, C. et al. (2007) J. Virol. 81: 11946-56; Takeuchi, H. et al. (2012) Retrovirology 9: 3) the only settings in which CsA-treatment has been previously shown to promote HIV-1 replication or transduction have regarded either SIV infection in the context of human cells (Hatziioannou, T. et al. (2004) Proc. Natl. Acad. Sci. USA 101: 10774-9; Ylinen, L. M. et al. (2005) J. Virol. 79: 11580-7), HIV infection in the context of simian cells (Stremlau, M. et al. (2004) Nature 427: 848-53) or specific HIV-1 CA mutants in human cell lines (De laco, A. et al. (2014) Retrovirology 11: 11; Song, C. et al. (2007) J. Virol. 81: 11946-56), as we observed for the P90A and A92E CA mutant in CsA-exposed CD4.sup.+ T cells. In CD34.sup.+ cells, all tested CA mutants remained sensitive to CsA-mediated effects, suggesting that CsA mediates CA independent relief of LV restriction in human HSPCs. In agreement with this observation, a previous study has shown that proteasomal inhibition increases LV transduction efficiencies in human and murine HSPCs independently of the CypA-CA interaction as the CypA-independent G89V CA mutant (Keckesova, Z. et al. (2006) J. Virol. 80: 4683-90) remains sensitive to proteasomal inhibition-mediated improvement of transduction (Santoni de Sio, F. R. et al. (2008) Stem Cells 26: 2142-52). Interestingly however, we observed that mutating the CypA binding pocket of the LV CA did alter the impact of CsA on the viral replication intermediates in human HSPC and the A88T capsid mutant performed better than the WT vector in presence of CsA. These data suggest that also the CA-CypA interaction may be involved in LV restriction in HSPC.
[0306] Nevertheless, two point mutations within the CypA binding pocket of the LV CA provided a two-fold advantage compared to WT LV alone and in addition to CsA in HSPC. This increase in transduction is likely due to escape from an early block as A92E LV showed increased late-RT products as compared to WT LV. Lack of increase in 2LTR circles despite increased VCN could be due to more efficient integration kinetics. Unlike for WT LV, CsA increased both late-RT products as well as nuclear import for A92E.
[0307] Although several forms of experimental evidence suggest that CypA protects HIV-1 from an unknown antiviral activity in human cells (Sokolskaja, E. et al. (2006) Curr. Opin. Microbiol. 9: 404-8; Li, Y. et al. (2009) J. Virol. 83: 10951-62), it is tempting to speculate based on our observations that in the context of human HSPC, CypA could actually mediate restriction towards LV or that human CD34.sup.+ cells express a yet unidentified restriction factor binding the viral CA. Nevertheless, the specific involvement of CypA remains to be addressed as also do other host immunophilins which have been shown to bind to CsA (Luban, J. et al. (1993) Cell 73: 1067-78; Frausto, S. D. et al. (2013) Viruses 5: 1684-701; Nagy, P. D. et al. (2011) Virology 411: 374-82). Noteworthy, previous efforts to improve LV transduction efficiency in human HSPC through modulation of the viral CA-CypA interaction have shown a negative impact of CsA on transduction efficiencies on these cells (Kahl, C. A. et al. (2008) Gene Therapy 15: 1079-89; Uchida, N. et al. (2013) Exp. Hematol. 41: 779-88 e771). Interestingly, the effects of CsA were HSPC-specific and opposite to what occurs in differentiated hematopoietic cells. We observed that CsA was able to improve LV transduction only at high concentrations required to disrupt CypA-CA interaction (Luban, J. et al. (1993) Cell 73: 1067-78) but not in its nanomolar immunosuppressive range (Colgan, J. et al, (2005) J. Immunol. 174: 6030-8). This concentration-dependent impact of CsA on LV transduction could explain, at least in part, why in previous studies it did not improve LV transduction in HSPC, as low concentrations were used (Kahl, C. A. et al. (2008) Gene Therapy 15: 1079-89; and Uchida, N. et al. (2013) Exp. Hematol. 41: 779-88 e771).
[0308] Interestingly, CsA did not impact on late-RT nor 2LTR circle formation during WT LV transduction, while an increase was observed in integrated proviral copies. In this regard, recent reports describe how the IFN-induced human MB protein is able to potently reduce the permissiveness of cells lines to HIV-1 (Goujon, C. et al. (2013) Nature 502: 559-62; Kane, M. et al. (2013) Nature 502: 563-6; Liu, Z. et al. (2013) Cell Host Microbe 14: 398-410). In one study, reverse transcription of the HIV-1 RNA within incoming particles to cDNA occurred normally, whereas integration of HIV-1 proviruses into the host cell genome was markedly diminished in MB-expressing cells. However, an MB-dependent reduction of 2LTR circles was also observed in two other studies (Goujon, C. et al. (2013) Nature 502: 559-62; Kane, M. et al. (2013) Nature 502: 563-6). These results place the anti-HIV activity of MB in the post-entry phase of HIV-1 infection after cDNA synthesis, possibly involving nuclear import, nuclear stability and/or integration of the viral cDNA. The viral capsid was shown to govern HIV-1 sensitivity to MB as the A88T CA mutant escaped MB restriction (Goujon, C. et al. (2013) Nature 502: 559-62; Kane, M. et al. (2013) Nature 502: 563-6; Liu, Z. et al. (2013) Cell Host Microbe 14: 398-410) and the action of MB might be associated with that of CypA, as silencing of CypA expression or disruption of the CA-CypA interaction by addition CsA abrogated the anti-HIV activity of MB (Liu, Z. et al. (2013) Cell Host Microbe 14: 398-410).
[0309] Based on our observations that CsA most likely affects post-nuclear entry steps of the WT LV life cycle, host factors potentially directly impairing the HIV-1 integration process could be involved. In this regard, it has recently been demonstrated that the host factor TRIM28 (also known as KAP-1), previously discovered to be involved in the transcriptional silencing of endogenous retroviruses and MLV in murine embryonic stem cells (Rowe, H. M. et al. (2010) Nature 463: 237-40; Wolf, D. et al. (2007) Cell 131: 46-57), inhibits HIV-1 integration through acetylation of the viral integrase in HeLa cells and primary CD4.sup.+ T cells (Allouch, A. et al. (2011) Cell Host Microbe 9: 484-95). Similar mechanisms, whether KAP-1 mediated or not, could be involved in limiting the LV integration in HSPC.
[0310] The rapamycin-associated host immunophilin FKBP12 is unlikely to be involved in rapamycin-mediated effects on LV transduction in HSPC, as another inhibitor of this PPlase, FK506, did not lead to improved transduction. Interestingly, rapamycin has been shown to abrogate the ability of TLR7 and TLR9 agonists to induce IFN/ in plasmacytoid dendritic cells (pDCs) through mTOR inhibition and consequent disruption of the MyD88-TLR complex (Cao, W. et al. (2008) Nat. Immunol. 9: 1157-64; Colina, R. et al. (2008) Nature 452: 323-8). In this regard, recent reports indicate that LVs activate myeloid dendritic cells (DC) through TLR 3 and 7 (Breckpot, K. et al. (2010) J. Virol. 84: 5627-36) and trigger TLR-dependent and independent innate signalling in murine hepatocytes, leading to decreased transduction (Agudo, J. et al. (2012) A TLR and Non-TLR Mediated Innate Response to Lentiviruses Restricts Hepatocyte Entry and Can be Ameliorated by Pharmacological Blockade. Molecular therapy: The Journal of the American Society of Gene Therapy). Along these lines, inhibition of TLR signalling in human Natural Killer (NK) cells can lead to improved transduction (Sutlu, T. et al. (2012) Inhibition of Intracellular Antiviral Defense Mechanisms Augments Lentiviral Transduction of Human Natural Killer Cells: Implications for Gene Therapy. Human Gene Therapy). Noteworthy, TLRs are present on the surface of haematopoietic progenitors and actively signal upon stimulation (Nagai, Y. et al. (2006) Immunity 24: 801-12; Esplin, B. L. et al. (2011) J. Immunol. 186: 5367-75). Moreover, HIV-1 infection has been shown to be blocked after efficient entry but prior to reverse transcription in TLR-ligand activated primary human macrophages (Wang, X. et al. (2011) PLoS One 6: e24193). In this regard, we observed that rapamycin acts on the early phases of the lentiviral transduction based on an observed increase in late-RT products. Although no reports regarding LV-mediated signal transduction in human HSPCs is currently available, it is possible to envision that rapamycin could prevent TLR-mediated activation of innate immune responses in human HSPCs leading to improved transduction efficiency.
[0311] Rapamycin induces autophagy in a variety of cell types (Sabers, C. J. et al. (1995) J. Biol. Chem. 270: 815-22; Sarkar, S. et al. (2008) Molecular bioSystems 4: 895-901). Interestingly, CsA and proteasomal inhibition (previously shown to increase LV transduction efficiency in human HSPC (Santoni de Sio, F. R. et al. (2008) Stem Cells 26: 2142-52; Leuci, V. et al, (2011) J. Biotechnol. 156: 218-26) have also been shown to increase autophagy (Werneck, M. B. et al. (2012) Cell Cycle 11: 3997-4008; Zhu, K. et al. (2010) Oncogene 29: 451-62). Therefore, it was tempting to speculate that autophagy could somehow be the common denominator behind these different treatments, all yielding more efficient gene transfer in human HSPCs. In this setting, the use of an autophagy inhibitor could have been expected to impair rapamycin and CsA-mediated increase in LV transduction in HSPC. However, we saw quite the opposite as combination of the autophagy inhibitor 3-methyladenine (3-MA) together with either rapamycin or CsA actually further improved gene transfer efficiency, despite some toxicity. As autophagy-inducing agents have been shown to inhibit HIV replication in primary human MDM (Rubinsztein, D. C. et al. (2012) Nat. Rev. Drug Discovery 11: 709-30; Campbell, G. R. et al. (2011) J. Biol. Chem. 286: 18890-902), it is therefore reasonable to think that rapamycin/CsA-mediated increase in autophagy could be deleterious for LV transduction, despite an overall improved gene transfer yield, and that blocking it will further improved transduction efficiency. However, no increase with 3-MA alone was observed suggesting that basal levels of autophagy are not sufficient per se to impact on LV transduction in HSPC, although autophagy has been shown to be essential for the life-long maintenance of the haematopoietic stem cell compartment and for supporting an old, failing blood system (Warr, M. R. et al. (2013) Nature 494: 323-7).
[0312] The CD34.sup.+ HSPC population is in reality comprised of only a minority of true stem cells endowed with self-renewal and repopulating capacity (Doulatov, S. et al. (2012) Cell Stem Cell 10: 120-36). The vast majority of the cells are more committed progenitors that will be lost after initial engraftment and will not contribute to sustained haematopoiesis in a transplanted individual. Based on these considerations, our observation that CsA and rapamycin release LV restriction not only in a fraction of the bulk CD34.sup.+ HSPC but in all subpopulations, including the most primitive CD34.sup.+CD133.sup.+CD90.sup.+ is of importance in view of potential applications of CsA/rapamycin in clinical gene therapy settings. Along these lines, no differences in transduction efficiencies were measured among all human peripheral blood subsets monitored in transplanted NSG mice, indicating overall improved gene transfer in the entire haematopoietic compartment in vivo. Improved gene transfer efficiency was obtained also with a SINLV that had been processed with the same downstream protocols as vectors used in current clinical trials (Biffi, A. et al. (2013) Science 341: 1233158; Aiuti, A. et al. (2013) Science 341: 1233151), reaching a robust 70% of transduction efficiency at the low MOI of 10. This observation is of particular value keeping in mind that clinical-grade vectors usually suffer from lower infectivity as compared to laboratory-grade preparations (Merten, O. W. et al. (2011) Human Gene Therapy 22: 343-56). Importantly, increased transduction efficiencies were maintained long-term in vivo and no effects on HSPC engraftment or repopulation capacities were observed among the different treatment groups, except for the rapamycin-treated cells. Indeed, in line with previous reports (Rohrabaugh, S. L. et al. (2011) Blood Cells, Molecules & Diseases 46: 318-20; Huang, J. et al. (2012) Nat. Medicine 18: 1778-85), we saw a modest but statistically significant increase in HSPC engraftment in NSG mice in the rapamycin-treated group, that could be of further benefit in clinical settings in which engraftment kinetics are crucial for successful gene therapy outcome (Naldini, L. (2011) Nat. Rev. Genetics 12: 301-15).
[0313] Overall, our results provide an important step forward in the development of more efficient LV gene therapy protocols and bring insight into the LV restriction bottlenecks hampering lentiviral gene transfer in human HSPCs.
[0314] All publications mentioned in the above specification are herein incorporated by reference. Various modifications and variations of the described uses and methods of the present invention will be apparent to those skilled in the art without departing from the scope and spirit of the present invention. Although the present invention has been described in connection with specific preferred embodiments, it should be understood that the invention as claimed should not be unduly limited to such specific embodiments. Indeed, various modifications of the described modes for carrying out the invention, which are obvious to those skilled in biochemistry and biotechnology or related fields, are intended to be within the scope of the following claims.