Detecting a Therapeutic Cell
20170056534 · 2017-03-02
Inventors
- Martin Pulé (London, GB)
- Adam Badar (London, GB)
- Louise Kiru (London, GB)
- Mark Lythgoe (London, GB)
- Adrien Peters (Brighton, GB)
Cpc classification
C07K14/705
CHEMISTRY; METALLURGY
A61K51/0455
HUMAN NECESSITIES
C07K16/2809
CHEMISTRY; METALLURGY
A61K40/11
HUMAN NECESSITIES
A61K40/30
HUMAN NECESSITIES
A61K39/3955
HUMAN NECESSITIES
C07K16/2896
CHEMISTRY; METALLURGY
A61K2239/38
HUMAN NECESSITIES
International classification
C07K16/28
CHEMISTRY; METALLURGY
Abstract
The present invention relates to a method of detecting a therapeutic cell expressing a dopamine transporter (DAT) at a central nervous system (CNS) site in a subject, which comprises the administration of a DAT tracer to the subject, wherein the presence of a therapeutic cell which expresses the DAT is determined.
Claims
1. A method of detecting a therapeutic cell expressing a dopamine transporter (DAT) at a central nervous system (CNS) site in a subject, which comprises the administration of a DAT tracer to the subject, wherein the presence of a therapeutic cell which expresses the DAT is determined.
2. The method according to claim 1 which comprises the steps of; i) administering a therapeutic vector encoding a DAT or a therapeutic cell expressing a DAT to the subject; ii) administering a DAT tracer to the subject; and iii) determining the presence of a therapeutic cell expressing the DAT at a site in the CNS of the subject.
3. The method according to claim 1 wherein the DAT tracer is [.sup.123I]-FP-CIT (Ioflupane; [I-123] N--fluoropropyl-2-carbomethoxy-3-(4-iodophenyl) nortropane) or [.sup.18F]-FP-CIT ([.sup.18F] fluoropropyl-carbomethoxy-iodophenyl-nortropane).
4. The method according to claim 1 wherein the presence of a therapeutic cell expressing DAT is determined by single-photon emission computed tomography (SPECT) or positron emission tomography (PET).
5. The method according to claim 1 wherein the DAT comprises the sequence shown as SEQ ID NO: 1, 4, 5, 6, 7 or 8 or a variant thereof with at least 80% sequence identity.
6. The method according to claim 1 wherein the CNS site is in the brain of the subject.
7. The method according to claim 1 wherein the presence of a therapeutic cell expressing DAT is determined at least 72 hours after the therapeutic cell or therapeutic vector has been administered to the subject.
8. The method according to claim 1 wherein the therapeutic cell is an immune effector cell.
9. The method according to claim 8 wherein the immune effector cell expresses a chimeric antigen receptor (CAR).
10-11. (canceled)
12. A DAT which consists of the sequence shown as SEQ ID NO: 4 or 5 or a variant thereof with at least 80% sequence identity or comprises the sequence shown as SEQ ID NO: 7 or a variant thereof with at least 80% sequence identity.
13. A nucleic acid sequence encoding i) a DAT according to claim 12; or ii) a DAT and a CAR.
14. (canceled)
15. A nucleic acid sequence according to claim 13 wherein the nucleic acid sequence encodes a DAT comprising the sequence shown as SEQ ID NO: 1, 4, 5, 6, 7 or 8 or a variant thereof with at least 80% sequence identity.
16. The nucleic acid sequence according to claim 15 which has the following structure:
DAT-coexpr-CAR or CAR-coexpr-DAT in which DAT is a nucleic acid sequence encoding the DAT; CAR is a nucleic acid sequence encoding the CAR; and coexpr is a nucleic acid sequence enabling the co-expression of both the DAT and the CAR.
17. The nucleic acid sequence according to claim 16, wherein coexpr encodes a sequence comprising a self-cleaving peptide or an internal ribosome entry site (IRES).
18. The nucleic acid sequence according to claim 17 further comprising a nucleic acid sequence encoding a suicide gene.
19. A therapeutic vector comprising a nucleic acid sequence encoding a DAT comprising the sequence shown as SEQ ID NO: 1, 4, 5, 6, 7 or 8 or a variant thereof with at least 80% sequence identity and a therapeutic nucleic acid sequence.
20. (canceled)
21. The vector according to claim 19 which is a retroviral vector, a lentiviral vector, a plasmid or a transposon.
22. A therapeutic cell expressing a DAT.
23. The therapeutic cell according to claim 22 wherein the DAT comprises the sequence shown as SEQ ID NO: 1, 4, 5, 6, 7 or 8 or a variant thereof with at least 80% sequence identity.
24. The therapeutic cell according to claim 22 which is an immune effector cell.
25. The immune effector cell according to claim 24 further expressing a CAR.
26. The immune effector cell according to claim 25 which comprises a nucleic acid sequence according to claim 15.
27. A method of making a cell according to claim 22, which comprises the step of introducing: a nucleic acid sequence according to claim 13 or a vector according to claim 19 into a cell.
28-35. (canceled)
36. A pharmaceutical composition comprising a therapeutic cell according to claim 22 or a therapeutic vector according to claim 19 and a pharmaceutically acceptable excipient or carrier.
37-38. (canceled)
39. A method of treating and/or preventing a disease which comprises the step of administering a therapeutic cell according to any of claims 22 to 26, a therapeutic vector according to claim 19 or a pharmaceutical composition of claim 36 to a subject in need thereof.
Description
DESCRIPTION OF THE FIGURES
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
DETAILED DESCRIPTION
Therapeutic Cell
[0053] In a first aspect the present invention relates to a method of detecting therapeutic cells expressing DAT at a CNS site in a subject.
[0054] The term detect, as used herein, is synonymous with terms such as identify, observe and visualise. Thus the method of the present invention determines the presence of therapeutic cells expressing DAT based on the binding of a DAT tracer to those cells.
[0055] The term detect may also encompass a method of quantifying therapeutic cells. Quantifying refers to a method which enables the level or amount of therapeutic cells to be determined.
[0056] A therapeutic cell refers to a cell which provides a beneficial effect to a subject suffering from a disease, for example a cell which lessens, reduces or improves at least one symptom associated with the disease and/or slows down, reduces or blocks the progression of the disease.
[0057] The therapeutic cell may be a cell which is administered to the subject in the form of a medicament or a host cell of the subject which has been treated in vivo with a therapeutic vector in order to express a therapeutic nucleic acid sequence.
[0058] Accordingly, the therapeutic cell may be a cell which is administered to a subject in the form of a medicament, for example in the form of a pharmaceutical composition of the present invention. Such therapeutic cells are administered to a subject in order to lessen, reduce or improve at least one symptom associated with a disease and/or to slow down, reduce or block the progression of a disease.
[0059] The therapeutic cell may be an immune effector cell or a therapeutic stem cell.
[0060] In one embodiment the administration or use of a therapeutic cell refers to an immune effector cell or a therapeutic stem cell.
[0061] The therapeutic cell may be an immune effector cell.
[0062] As used herein, an immune effector cell refers to an immune cell which is capable of providing an immunological function. For example, the immune effector cell may be capable of providing an cytotoxic function.
[0063] The immune effector cell may be a T cell or a natural killer (NK cell).
[0064] T cells or T lymphocytes are a type of lymphocyte that play a central role in cell-mediated immunity. They can be distinguished from other lymphocytes, such as B cells and natural killer cells (NK cells), by the presence of a T-cell receptor (TCR) on the cell surface. The T cell or NK cell may be a cell as summarised below.
[0065] Helper T helper cells (TH cells) assist other white blood cells in immunologic processes, including maturation of B cells into plasma cells and memory B cells, and activation of cytotoxic T cells and macrophages. TH cells express CD4 on their surface. TH cells become activated when they are presented with peptide antigens by MHC class II molecules on the surface of antigen presenting cells (APCs). These cells can differentiate into one of several subtypes, including TH1, TH2, TH3, TH17, Th9, or TFH, which secrete different cytokines to facilitate different types of immune responses.
[0066] Cytotoxic T cells (TC cells, or CTLs) destroy virally infected cells and tumor cells, and are also implicated in transplant rejection. CTLs express the CD8 at their surface. These cells recognize their targets by binding to antigen associated with MHC class I, which is present on the surface of all nucleated cells. Through IL-10, adenosine and other molecules secreted by regulatory T cells, the CD8+ cells can be inactivated to an anergic state, which prevent autoimmune diseases such as experimental autoimmune encephalomyelitis.
[0067] Memory T cells are a subset of antigen-specific T cells that persist long-term after an infection has resolved. They quickly expand to large numbers of effector T cells upon re-exposure to their cognate antigen, thus providing the immune system with memory against past infections. Memory T cells comprise three subtypes: central memory T cells (TCM cells) and two types of effector memory T cells (TEM cells and TEMRA cells). Memory cells may be either CD4+ or CD8+. Memory T cells typically express the cell surface protein CD45RO.
[0068] Regulatory T cells (Treg cells), formerly known as suppressor T cells, are crucial for the maintenance of immunological tolerance. Their major role is to shut down T cell-mediated immunity toward the end of an immune reaction and to suppress auto-reactive T cells that escaped the process of negative selection in the thymus.
[0069] Two major classes of CD4+ Treg cells have been describednaturally occurring Treg cells and adaptive Treg cells.
[0070] Naturally occurring Treg cells (also known as CD4+CD25+FoxP3+ Treg cells) arise in the thymus and have been linked to interactions between developing T cells with both myeloid (CD11c+) and plasmacytoid (CD123+) dendritic cells that have been activated with TSLP. Naturally occurring Treg cells can be distinguished from other T cells by the presence of an intracellular molecule called FoxP3. Mutations of the FOXP3 gene can prevent regulatory T cell development, causing the fatal autoimmune disease IPEX.
[0071] Adaptive Treg cells (also known as Tr1 cells or Th3 cells) may originate during a normal immune response.
[0072] The T cell of the invention may be any of the T cell types mentioned above, in particular a CTL.
[0073] Natural killer (NK) cells are a type of cytolytic cell which forms part of the innate immune system. NK cells provide rapid responses to innate signals from virally infected cells in an MHC independent manner
[0074] NK cells (belonging to the group of innate lymphoid cells) are defined as large granular lymphocytes (LGL) and constitute the third kind of cells differentiated from the common lymphoid progenitor generating B and T lymphocytes. NK cells are known to differentiate and mature in the bone marrow, lymph node, spleen, tonsils and thymus where they then enter into the circulation.
[0075] The therapeutic cell may be a therapeutic stem cell. The therapeutic stem cell may be a pluripotent stem cell.
[0076] The therapeutic stem cell may be a multipotent stem cell. For example, the stem cell may be a neural stem/precursor cell (NSPC). NSPCs are self-renewing, multipotent cells that generate the main phenotype of the nervous system. The use of NSPCs for the treatment of neurodegenerative disorders is described, for example, by Latchney et al. (Eur J Neurodegener Dis. 2012; 1(3): 335-351; incorporated herein by reference).
[0077] The therapeutic cell may be a CNS cell of the subject which has been treated with a therapeutic vector such that it expresses a therapeutic nucleic acid. Accordingly, the therapeutic vector comprises a nucleic acid sequence encoding a DAT protein as described herein and a therapeutic nucleic acid sequence.
[0078] The therapeutic nucleic acid sequence is not limited and may be, for example, a protein encoding nucleic acid sequence, a miRNA sequence or a long non-coding RNA.
[0079] The use of a therapeutic vector according to the present invention allows cells which have taken up the therapeutic vector, and are therefore expressing the therapeutic nucleic acid, to be detected and quantified using the method as defined in the first aspect of the present invention. This enables the effectiveness of a gene therapy method to be assessed.
Dopamine Transporter (DAT)
[0080] The dopamine transporter (also dopamine active transporter, DAT, SLC6A3) is a membrane-spanning protein that actively transports the neurotransmitter dopamine out of the synapse into cytosol. Dopamine reuptake via DAT provides the primary mechanism through which dopamine is cleared from synapses, although there may be an exception in the prefrontal cortex, where evidence points to a possible larger role of the norepinephrine transporter.
[0081] The initial determination of the membrane topology of DAT was based upon hydrophobic sequence analysis and sequence similarities with the GABA transporter. These methods predicted twelve transmembrane domains (TMD) with a large extracellular loop between the third and fourth TMDs. Further characterization of this protein used proteases, which digest proteins into smaller fragments, and glycosylation, which occurs only on extracellular loops, and largely verified the initial predictions of membrane topology. The exact structure of the transporter was elucidated in 2013 by X-ray crystallography.
[0082] The human DAT is expressed exclusively in the pre-synaptic membrane of dopaminergic neurons (see Kim et al; 2002; Nature; 418: 50-56). It is highly expressed in the substantia nigra.
[0083] As such, the therapeutic cells as described herein may naturally express DAT. Preferably, the therapeutic cells as described herein may be engineered to express a DAT protein.
[0084] An example human DAT protein (hDAT) is the human DAT protein having the UniProtKB accession number Q01959-1. This exemplified sequence is 620 amino acids in length and is shown as SEQ ID NO: 1.
TABLE-US-00001 SEQIDNO:1 MSKSKCSVGLMSSVVAPAKEPNAVGPKEVELILVKEQNGVQLTSSTL TNPRQSPVEAQDRETWGKKIDFLLSVIGFAVDLANVWRFPYLCYKNG GGAFLVPYLLFMVIAGMPLFYMELALGQFNREGAAGVWKICPILKGV GFTVILISLYVGFFYNVIIAWALHYLFSSFTTELPWIHCNNSWNSPN CSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDLGP PRWQLTACLVLVIVLLYFSLWKGVKTSGKVVWITATMPYVVLTALLL RGVTLPGAIDGIRAYLSVDFYRLCEASVWIDAATQVCFSLGVGFGVL IAFSSYNKFTNNCYRDAIVTTSINSLTSFSSGFVVFSFLGYMAQKHS VPIGDVAKDGPGLIFIIYPEAIATLPLSSAWAVVFFIMLLTLGIDSA MGGMESVITGLIDEFQLLHRHRELFTLFIVLATFLLSLFCVTNGGIY VFTLLDHFAAGTSILFGVLIEAIGVAWFYGVGQFSDDIQQMTGQRPS LYWRLCWKLVSPCFLLFVVVVSIVTFRPPHYGAYIFPDWANALGWVI ATSSMAMVPIYAAYKFCSLPGSFREKLAYAIAPEKDRELVDRGEVRQ FTLRHWLKV
[0085] An alternative human DAT protein is shown as SEQ ID NO: 6 (see
[0086] In one embodiment, the DAT protein may be a variant DAT protein. A variant DAT protein may be any DAT protein which is capable of binding a DAT tracer which binds to SEQ ID NO: 1 or 6.
[0087] The DAT variant protein may be capable of binding a DAT tracer at the same or an increased level compared to the DAT protein shown as SEQ ID NO: 1 or 6.
[0088] The variant protein may comprise mutations, deletions or additional amino acids compared to SEQ ID NO: 1 or 6 providing that the variant is capable of binding a DAT tracer which binds to SEQ ID NO: 1 or 6.
[0089] The DAT protein as described herein may comprise the sequence shown as SEQ ID NO: 1 or 6 or a variant thereof having at least 80% sequence identity which is capable of binding a DAT tracer which binds to SEQ ID NO: 1 or 6.
[0090] The variant may have at least 80, 85, 90, 95 or 99% sequence identity to SEQ ID NO: 1 or 6 and be capable of binding a DAT tracer which binds to SEQ ID NO: 1 or 6.
[0091] The present inventors have determined DAT truncation mutants which are capable of functional binding of DAT tracers.
[0092] Accordingly, the DAT protein may be a truncated DAT protein.
[0093] The truncated DAT may be a DAT which has a number of amino acids removed from either the N or C terminus in comparison to SEQ ID NO: 1.
[0094] The number of amino acids removed from the N-terminus may be less than 5, less than 10, less than 20, less than 30, less than 40 or less than 50 amino acids.
[0095] The DAT protein may lack the first 50 amino acids from the N-terminus with reference to the DAT sequence shown as SEQ ID NO: 1 or a variant thereof having at least 80% sequence identity.
[0096] An example of such a DAT protein is shown as SEQ ID NO: 4 (see
[0097] The DAT protein described herein may have a sequence as shown in SEQ ID NO: 4 or a variant thereof having at least 80% sequence identity and retaining the ability to bind a DAT tracer which binds to the wild type DAT protein.
[0098] The variant may have at least 80, 85, 90, 95 or 99% sequence identity to SEQ ID NO: 4.
[0099] The number of amino acids removed from the C-terminus may be less than 5, less than 7, less than 10, less than 14 or less than 19 amino acids.
[0100] The DAT protein may lack the final 19 amino acids from the C-terminus with reference to the DAT sequence shown as SEQ ID NO: 1 or a variant thereof having at least 80% sequence identity.
[0101] An example of such a DAT protein is shown as SEQ ID NO: 5 (see
[0102] The DAT protein described herein may have a sequence as shown in SEQ ID NO: 5 or a variant thereof having at least 80% sequence identity and retaining the ability to bind a DAT tracer which binds to the wild type DAT protein.
[0103] The variant may have at least 80, 85, 90, 95 or 99% sequence identity to SEQ ID NO: 5.
[0104] The truncated DAT may be a DAT which has a number of amino acids removed from the N and C terminus in comparison to SEQ ID NO: 1.
[0105] The number of amino acids removed from the N-terminus may be less than 5, less than 10, less than 20, less than 30, less than 40 or less than 50 amino acids.
[0106] The number of amino acids removed from the C-terminus may be less than 5, less than 7, less than 10, less than 14 or less than 19 amino acids.
[0107] The truncated DAT may lack the first 50 amino acids from the N terminus in comparison to SEQ ID NO: 1 and the final 19amino acids from the C terminus in comparison to SEQ ID NO: 1.
[0108] A number of DAT mutations which increase the relative binding of dopamine to DAT have been described.
[0109] The DAT protein described herein may therefore include a mutation which maintains or increases the binding of dopamine or a DAT tracer to DAT compared to SEQ ID NO: 1 or 6. By way of example, the DAT protein may comprise a D313N and/or W84L mutation with reference to the DAT sequence shown as SEQ ID NO: 1 or a variant thereof having at least 80% sequence identity.
[0110] An example of such a DAT protein is shown as SEQ ID NO: 8 (see
[0111] The DAT protein may comprise a D313N mutation with reference to the DAT sequence shown as SEQ ID NO: 1 or a variant thereof having at least 80% sequence identity. The variant may have at least 80, 85, 90, 95 or 99% sequence identity to SEQ ID NO: 1.
[0112] For example the DAT protein may comprise the sequence shown as any of SEQ ID NO: 1, 4, 5, 6, 7 or 8 and further include a D313N and/or W84L mutation with reference to the DAT sequence shown as SEQ ID NO: 1 or a variant thereof having at least 80% sequence identity.
[0113] The DAT protein may comprise the sequence shown as any of SEQ ID NO: 1, 4, 5, 6 or 7 and further include a D313N mutation with reference to the DAT sequence shown as SEQ ID NO: 1 or a variant thereof having at least 80% sequence identity.
[0114] The DAT protein may comprise the sequence shown as any of SEQ ID NO: 1, 4, 5, 6, 7 or 8 and further include a D313N mutation with reference to the DAT sequence shown as SEQ ID NO: 1 or a variant thereof having at least 80% sequence identity.
[0115] The variant may have at least 80, 85, 90, 95 or 99% sequence identity to SEQ ID NO: 1 and further include a D313N and/or W84L mutation with reference to the DAT sequence shown as SEQ ID NO: 1.
[0116] The variant may have at least 80, 85, 90, 95 or 99% sequence identity to SEQ ID NO: 4 and further include a D313N and/or W84L mutation with reference to the DAT sequence shown as SEQ ID NO: 1.
[0117] The variant may have at least 80, 85, 90, 95 or 99% sequence identity to SEQ ID NO: 5 and further include a D313N and/or W84L mutation with reference to the DAT sequence shown as SEQ ID NO: 1.
[0118] The variant may have at least 80, 85, 90, 95 or 99% sequence identity to SEQ ID NO: 6 and further include a D313N and/or W84L mutation with reference to the DAT sequence shown as SEQ ID NO: 1.
[0119] The variant may have at least 80, 85, 90, 95 or 99% sequence identity to SEQ ID NO: 7 and further include a D313N and/or W84L mutation with reference to the DAT sequence shown as SEQ ID NO: 1.
[0120] The variant may have at least 80, 85, 90, 95 or 99% sequence identity to SEQ ID NO: 8 and further include W84L mutation with reference to the DAT sequence shown as SEQ ID NO: 1.
[0121] In one embodiment, the DAT protein does not include a deletion from amino acids 519 to 620 with reference to the DAT sequence shown as SEQ ID NO: 1.
[0122] The DAT protein or nucleic acid sequence encoding the DAT protein may comprise, consist essentially of or consist of a DAT protein or nucleic acid sequence as described herein.
DAT Tracer
[0123] As used herein a DAT tracer refers to an entity which binds DAT and can be detected using, for example, an imaging technique.
[0124] Such tracers are typically radiotracers. Suitable DAT tracers are known in the art. By way of example, we refer to Piccini (Movement Disorders; 2003; vol 18:7; pp S3-8) and Shen et al. (Journal of Biomedicine and Biotechnology; 2012; Article ID 259349)both of which are incorporated herein by reference.
[0125] Known DAT radiotracers include, but are not limited to, .sup.11C-CFT, .sup.18F-CFT, .sup.11C-PE2I, .sup.123I--CIT, [.sup.123I]-FP-CIT (Ioflupane; [I-123] N--fluoropropyl-2-carbomethoxy-3-(4-iodophenyl) nortropane) and [.sup.18F]-FP-CIT ([.sup.18F] fluoropropyl-carbomethoxy-iodophenyl-nortropane).
[0126] Ioflupane is also known as DaTSCAN.
[0127] Radiotracers may be detected using imaging techniques which are known in the art, for example single-photon emission computed tomography (SPECT) or positron emission tomography (PET).
[0128] The method according to the first aspect of the present invention may comprise the steps of; [0129] i) administering a therapeutic vector encoding a DAT or a therapeutic cell expressing a DAT to the subject; [0130] ii) administering a DAT tracer to the subject; and [0131] iii) determining the presence of a therapeutic cell expressing the DAT in the CNS of the subject.
[0132] A therapeutic cell or a therapeutic vector may be administered to the subject in the form of a pharmaceutically acceptable composition, for example a pharmaceutical composition as described herein.
[0133] The therapeutic cell or therapeutic vector may be administered by any suitable route of administration.
[0134] By way of example, a therapeutic cell or therapeutic vector may be administered by intravenous administration or by Ommaya reservoir catheterisation.
[0135] A DAT tracer may be administered by methods which are known in the art. For example, the tracer may be administered by oral (e.g. to be swallowed or inhaled as a gas) or by intravenous administration. Typically, when used for imaging in the CNS, the tracer will be administered intravenously.
[0136] Determining the presence of a therapeutic cell expressing the DAT may be performed using techniques and methods which are known in the art. Imaging techniques which are suitable for detecting a therapeutic cell expressing DAT in the CNS of a subject include, but are not limited to, single-photon emission computed tomography (SPECT) or positron emission tomography (PET).
[0137] By way of example, the DAT radiotracer [.sup.123I]-FP-CIT may be detected using SPECT and the DAT radiotracer [.sup.18F]-FP-CIT may be detected using PET.
Central Nervous System (CNS)
[0138] As used herein, CNS refers to the part of the nervous system consisting of the brain and spinal cord.
[0139] The CNS site may be in the brain of the subject. In one embodiment, the CNS site is not in the striatum of the brain.
Subject
[0140] The subject may be a human or animal subject. The subject may be a mammalian subject. The subject may have or be at risk of a disease as described herein.
Time Period
[0141] The method of the present invention may be used to determine the longevity of a therapeutic cell at a site in the CNS.
[0142] Accordingly, the presence of therapeutic cells expressing DAT may be determined following administration of a therapeutic cell expressing DAT or a therapeutic vector encoding DAT to a subject.
[0143] The presence of therapeutic cells expressing DAT may be determined from 4 hours after the therapeutic vector or therapeutic cell has been administered to the subject. The presence of therapeutic cells expressing DAT may be determined from 4 hours to at least 120 days after the therapeutic vector or therapeutic cell has been administered to the subject.
[0144] The presence of therapeutic cells expressing DAT may be determined at least 72 hours, at least 96 hours or at least 120 hours after the therapeutic vector or therapeutic cell has been administered to the subject.
[0145] The presence of therapeutic cells expressing DAT may be determined at least 7, 10, 15, 20, 25, 50, 100, or 150 days after the therapeutic vector or therapeutic cells have been administered to the subject.
Chimeric Antigen Receptor (CAR)
[0146] An immune effector cell may express a chimeric antigen receptor (CAR) in addition to the DAT.
[0147] CARs are chimeric type I trans-membrane proteins which connect an extracellular antigen-recognizing domain (binder) to an intracellular signalling domain (endodomain). The binder is typically a single-chain variable fragment (scFv) derived from a monoclonal antibody (mAb), but it can be based on other formats which comprise an antibody-like antigen binding site. A spacer domain is usually necessary to isolate the binder from the membrane and to allow it a suitable orientation. A common spacer domain used is the Fc of IgG1. More compact spacers can suffice e.g. the stalk from CD8 and even just the IgG1 hinge alone, depending on the antigen. A trans-membrane domain anchors the protein in the cell membrane and connects the spacer to the endodomain.
[0148] Early CAR designs had endodomains derived from the intracellular parts of either the chain of the FcR1 or CD3. Consequently, these first generation receptors transmitted immunological signal 1, which was sufficient to trigger T-cell killing of cognate target cells but failed to fully activate the T-cell to proliferate and survive. To overcome this limitation, compound endodomains have been constructed: fusion of the intracellular part of a T-cell co-stimulatory molecule to that of CD3 results in second generation receptors which can transmit an activating and co-stimulatory signal simultaneously after antigen recognition. The co-stimulatory domain most commonly used is that of CD28. This supplies the most potent co-stimulatory signalnamely immunological signal 2, which triggers T-cell proliferation. Some receptors have also been described which include TNF receptor family endodomains, such as the closely related OX40 and 41BB which transmit survival signals. Even more potent third generation CARs have now been described which have endodomains capable of transmitting activation, proliferation and survival signals.
[0149] CAR-encoding nucleic acids may be transferred to cells (such a T cells) using, for example, retroviral or lentiviral vectors. In this way, a large number of cancer-specific T cells can be generated for adoptive cell transfer. When the CAR binds the target-antigen, this results in the transmission of an activating signal to the T-cell it is expressed on. Thus the CAR directs the specificity and cytotoxicity of the T cell towards tumour cells expressing the targeted antigen.
Transmembrane Domain
[0150] The CAR may comprise a transmembrane domain which spans the membrane. It may comprise a hydrophobic alpha helix. The transmembrane domain may be derived from CD8, CD28 or human IgG.
[0151] The transmembrane domain may be derived from any type I transmembrane protein. The transmembrane domain may be a synthetic sequence predicted to form a hydrophobic helix.
[0152] The transmembrane domain may comprise the sequence shown as SEQ ID NO: 9.
TABLE-US-00002 (CD28transmembranedomain) SEQIDNO:9 FWVLVVVGGVLACYSLLVTVAFIIFWV
Intracellular Signalling Domain (Endodomain)
[0153] The endodomain is the signal-transmission portion of a CAR. After antigen recognition, receptors cluster and a signal is transmitted to the cell. The most commonly used endodomain component is that of CD3-zeta which contains 3 ITAMs. This transmits an activation signal to the T cell after antigen is bound. CD3-zeta may not provide a fully competent activation signal and additional co-stimulatory signaling may be needed. For example, chimeric CD28 and OX40 can be used with CD3-Zeta to transmit a proliferative/survival signal, or all three can be used together.
[0154] The endodomain of a CAR may comprise the CD28 endodomain and OX40 and CD3-Zeta endodomain.
[0155] The transmembrane and intracellular T-cell signalling domain (endodomain) of the may comprise the sequence shown as SEQ ID NO: 10 to 14.
TABLE-US-00003 (CD28endodomain) SEQIDNO:10 RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAY (OX40endodomain) SEQIDNO:11 RSRDQRLPPDAHKPPGGGSFRTPIQEEQADAHSTLAKI (CD3zetaendodomain) SEQIDNO:12 RSRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEM GGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQG LSTATKDTYDALHMQALPPR (CD28Z) SEQIDNO:13 RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSR SADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKN PQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDT YDALHMQALPPR (CD28OXZ) SEQIDNO:14 RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRDQRLP PDAHKPPGGGSFRTPIQEEQADAHSTLAKIRVKFSRSADAPAYQQGQ NQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQK DKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPP R
Spacer
[0156] The CAR may comprise a spacer sequence to connect the antigen-binding domain with the transmembrane domain and spatially separate the antigen-binding domain from the endodomain. A flexible spacer allows the antigen-binding domain to orient in different directions to enable antigen binding.
[0157] The spacer sequence may, for example, comprise an IgG1 Fc region, an IgG1 hinge or a CD8 stalk, or a combination thereof. The spacer may alternatively comprise an alternative sequence which has similar length and/or domain spacing properties as an IgG1 Fc region, an IgG1 hinge or a CD8 stalk.
[0158] A human IgG1 spacer may be altered to remove Fc binding motifs.
[0159] Examples of amino acid sequences for these spacers are given below:
TABLE-US-00004 (hinge-CH2CH3ofhumanIgG1) SEQIDNO:15 AEPKSPDKTHTCPPCPAPPVAGPSVFLFPPKPKDTLMIARTPEVTCV VVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVL HQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGS FFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKKD SEQIDNO:16(humanCD8stalk): TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDI SEQIDNO:17(humanIgG1hinge): AEPKSPDKTHTCPPCPKDPK (IgG1Hinge-Fc) SEQIDNO:18 AEPKSPDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTC VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTV LHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR DELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG SFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKKD PK (IgG1Hinge-FcmodifiedtoremoveFcreceptor recognitionmotifs) SEQIDNO:19 AEPKSPDKTHTCPPCPAPPVA*GPSVFLFPPKPKDTLMIARTPEVTC VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTV LHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR DELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG SFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKKD PK
[0160] Modified residues are underlined; * denotes a deletion.
Nucleic Acid Sequence
[0161] Nucleic acid sequences which encode a DAT protein are described herein.
[0162] Examples of nucleic acid sequences encoding a DAT protein as described herein as shown as SEQ ID NO: 23 to 29.
[0163] Any nucleic acid sequence as described herein may be in the form of a nucleic acid construct. In other words, the nucleic acid sequence may be an artificially constructed segment of nucleic acid.
[0164] The nucleic acid sequence encoding a DAT and a CAR may have the following structure:
DAT-coexpr-CAR or CAR-coexpr-DAT;
in which DAT is a nucleic acid sequence encoding the DAT; CAR is a nucleic acid sequence encoding the CAR; and coexpr is a nucleic acid sequence enabling the co-expression of both the DAT and the CAR.
[0165] In other words, the nucleic acid sequence may comprise a first nucleic acid sequence encoding a DAT and a second nucleic acid sequence encoding a CAR, in which the first and second nucleic acid sequences are separated by a third nucleic acid sequence enabling the co-expression of both the DAT and the CAR.
[0166] The structure of the nucleic acid may be such that either the DAT or the CAR encoding nucleic acid sequence is located at the 5 or 3 position of the coexpr nucleic acid sequence.
Co-Expression Site
[0167] The nucleic acid may produce a polypeptide which comprises a DAT and a CAR joined by a cleavage site. The cleavage site may be self-cleaving, such that when the polypeptide is produced, it is immediately cleaved into the DAT and the CAR without the need for any external cleavage activity.
[0168] Various self-cleaving sites are known, including the Foot-and-Mouth disease virus (FMDV) 2A peptide and similar sequence (Donnelly et al, Journal of General Virology (2001), 82, 1027-1041), for instance like the 2A-like sequence from Thosea asigna virus which has the sequence shown as SEQ ID NO: 20: RAEGRGSLLTCGDVEENPGP
[0169] The co-expressing sequence may be an internal ribosome entry sequence (IRES). The co-expressing sequence may be an internal promoter
Suicide Gene
[0170] Since therapeutic cells engraft and are autonomous, a means of selectively deleting the cells in recipients is desirable. This is particularly the case for immune effector cells expressing a CAR.
[0171] Suicide genes are genetically encodable mechanisms which result in selective destruction of infused cells in the face of unacceptable toxicity. The earliest clinical experience with suicide genes is with the Herpes Virus Thymidine Kinase (HSV-TK) which renders cells susceptible to Ganciclovir. HSV-TK is a highly effective suicide gene. However, pre-formed immune responses may restrict its use to clinical settings of considerable immunosuppression such as haploidentical stem cell transplantation. Inducible Caspase 9 (iCasp9) is a suicide gene constructed by replacing the activating domain of Caspase 9 with a modified FKBP12. iCasp9 is activated by an otherwise inert small molecular chemical inducer of dimerization (CID). iCasp9 has been recently tested in the setting of haploidentical HSCT and can abort GvHD. The biggest limitation of iCasp9 is dependence on availability of clinical grade proprietary CID. Both iCasp9 and HSV-TK are intracellular proteins, so when used as the sole transgene, they have been co-expressed with a marker gene to allow selection of transduced cells.
[0172] The therapeutic cell or therapeutic vector may comprise a suicide gene, for example an iCasp9 or RQR8 molecule.
[0173] An iCasp9 may comprise the sequence shown as SEQ ID NO: 21 or a variant thereof having at least 80, 90, 95 or 98% sequence identity.
TABLE-US-00005 SEQIDNO:21 MLEGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKVDSSRDRNK PFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGII PPHATLVFDVELLKLESGGGSGVDGFGDVGALESLRGNADLAYILSM EPCGHCLIINNVNFCRESGLRTRTGSNIDCEKLRRRFSSLHFMVEVK GDLTAKKMVLALLELAQQDHGALDCCVVVILSHGCQASHLQFPGAVY GTDGCPVSVEKIVNIFNGTSCPSLGGKPKLFFIQACGGEQKDHGFEV ASTSPEDESPGSNPEPDATPFQEGLRTFDQLDAISSLPTPSDIFVSY STFPGFVSWRDPKSGSWYVETLDDIFEQWAHSEDLQSLLLRVANAVS VKGIYKQMPGCFNFLRKKLFFKTSAS
[0174] A recently described marker/suicide gene is RQR8 which can be detected with the antibody QBEnd10 and expressing cells lysed with the therapeutic antibody Rituximab.
[0175] An RQR8 may comprise the sequence shown as SEQ ID NO: 22 or a variant thereof having at least 80, 90, 95 or 98% sequence identity.
TABLE-US-00006 SEQIDNO:22 MGTSLLCWMALCLLGADHADACPYSNPSLCSGGGGSELPTQGTFSNV STNVSPAKPTTTACPYSNPSLCSGGGGSPAPRPPTPAPTIASQPLSL RPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYC NHRNRRRVCKCPRPVV
[0176] The marker/suicide gene may be expressed as a single polypeptide with a CAR or DAT as described herein, for example by using a self-cleaving peptide between the two sequences.
[0177] The marker/suicide gene may be expressed as a dipeptide with the DAT. By way of example, the DAT may comprise the sequence shown as SEQ ID NO: 7 (see
[0178] The DAT protein described herein may have a sequence as shown in SEQ ID NO: 7 or a variant thereof having at least 80% sequence identity and retaining the ability to bind a DAT tracer which binds to the wild type DAT protein.
[0179] The variant may have at least 80, 85, 90, 95 or 99% sequence identity to SEQ ID NO: 7.
Vector
[0180] The present invention also provides a vector which comprises a nucleic acid sequence as described herein. Such a vector may be used to introduce the nucleic acid sequence into a cell so that it expresses and produces a DAT and/or CAR as described herein.
[0181] The present invention also provides a therapeutic vector comprising a nucleic acid sequence encoding a DAT comprising the sequence shown as SEQ ID NO: 1, 4, 5, 6, 7 or 8 or a variant thereof with at least 80% sequence identity and a therapeutic nucleic acid sequence.
[0182] The therapeutic nucleic acid sequence is not limited and may be, for example, a protein encoding nucleic acid sequence, a miRNA sequence or a long non-coding RNA.
[0183] The vector may, for example, be a plasmid or a viral vector, such as a retroviral vector or a lentiviral vector or an adenoviral vector.
[0184] The vector may be capable of transfecting or transducing a T cell. The vector may be capable of transfecting or transducing a cell of the CNS, such as a neuron or a glial cell.
[0185] The vector may also comprise a nucleic acid sequence encoding a suicide gene, such as iCasp9 or RQR8.
Method
[0186] DAT-expressing cells may be generated by introducing DNA or RNA coding for DAT by one of many means including transduction with a viral vector, transfection with DNA or RNA.
[0187] The present invention also provide a cell composition comprising DAT-expressing therapeutic cells, such as CAR-expressing immune effector cells, according to the present invention. The cell composition may be made by transducing a sample ex vivo with a nucleic acid construct or vector as described herein.
[0188] Alternatively, DAT-expressing cells may be derived from ex vivo differentiation of inducible progenitor cells or embryonic progenitor cells to the relevant cell type, such as T cells.
[0189] Alternatively, an immortalized cell line such as a T-cell line which retains its lytic function and could act as a therapeutic may be used.
[0190] A therapeutic cell of the invention may therefore be made by: [0191] (i) isolation of a cell-containing sample from a subject or other sources described above; and [0192] (ii) transduction or transfection of the cells with a nucleic acid or vector as described.
[0193] Immune effector cells of the present invention may either be created ex vivo either from a subject's own peripheral blood (1st party), or in the setting of a haematopoietic stem cell transplant from donor peripheral blood (2nd party), or peripheral blood from an unconnected donor (3rd party).
[0194] A DAT-expressing immune effector cell of the invention may be an ex vivo T cell from a subject. The T cell may be from a peripheral blood mononuclear cell (PBMC) sample. T cells may be activated and/or expanded prior to being transduced with a nucleic acid or vector as described herein, for example by treatment with an anti-CD3 monoclonal antibody.
[0195] An immune effector cell of the invention may be made by: [0196] (i) isolation of an immune effector cell-containing sample from a subject or other sources described above; and [0197] (ii) transduction or transfection of the cells with a nucleic acid or vector as described herein.
[0198] The therapeutic cells, for example the immune effector cells, may then be purified, for example, by selection on the basis of expression of DAT or the co-expression of DAT and a CAR.
Pharmaceutical Composition
[0199] The present invention also relates to a pharmaceutical composition containing a therapeutic cell or a therapeutic vector according to the present invention. The pharmaceutical composition comprises a pharmaceutically acceptable carrier, diluent or excipient. The pharmaceutical composition may optionally comprise one or more further pharmaceutically active polypeptides and/or compounds. Such a formulation may, for example, be in a form suitable for intravenous infusion or Ommaya reservoir catheterisation.
[0200] In one embodiment the pharmaceutical composition comprises an immune effector cell or a therapeutic stem cell.
Use
[0201] The present invention also relates to the use of a nucleic acid or a vector of the present invention for the preparation of a therapeutic cell. The present invention also provides a nucleic acid or a vector of the present invention for use in the preparation of a therapeutic cell.
[0202] The preparation of a therapeutic cell refers to the generation of a therapeutic cell which expresses DAT. By way of example, such a therapeutic cell may be generated by the methods as described herein.
[0203] The present invention further provides a pharmaceutical composition of the present invention for use in treating and/or preventing a disease. In a further aspect the present invention relates to the use of a therapeutic cell or a therapeutic vector of the present invention in the manufacture of a medicament for treating and/or preventing a disease.
[0204] The invention further provides a method of treating and/or preventing a disease which comprises the step of administering a pharmaceutical composition of the present invention to a subject in need thereof.
[0205] To treat means to administer the pharmaceutical composition to a subject having an existing disease in order to lessen, reduce or improve at least one symptom associated with the disease and/or to slow down, reduce or block the progression of the disease.
[0206] To prevent means to administer the pharmaceutical composition to a subject who has not yet contracted the disease and/or who is not showing any symptoms of the disease to prevent or impair the cause of the disease (e.g. infection) or to reduce or prevent development of at least one symptom associated with the disease.
[0207] The above methods and uses involve the administration of an effective amount of the pharmaceutical composition to the subject. An effective amount refers to an amount which is capable of, for example, lessening, reducing or improving at least one symptom associated with the disease and/or slowing down, reducing or blocking the progression of the disease.
[0208] The disease may be any disease of the CNS.
[0209] The disease may be a cancer of the CNS. For example the disease may be a tumour of the brain, meninges or spinal cord.
[0210] Such diseases include gliomas, lymphomas of the CNS and medulloblastomas.
[0211] Treatment of gliomas using, for example, an immune effector cell of the present invention, may involve targeting tumour-associated antigens such as epidermal growth factor receptor (EGFR), the variant 3 of EGFR (EGFRvIII), Vimentin, Tenascin, MRP3 or IL13Ralpha.
[0212] Treatment of lymphomas of the CNS using, for example, an immune effector cell of the present invention, may involve targeting tumour-associated antigens such as CD19, CD20 and CD22.
[0213] Treatment of medullobastomas using, for example, an immune effector cell of the present invention, may involve targeting tumour-associated antigens such as diasialoganglioside or HER2.
[0214] The disease may be stroke or a neurodegenerative disorder. Examples of neurodegenerative disorders include, but are not limited to, Amyotrophic lateral sclerosis (ALS), Parkinson's, Alzheimer's, and Huntington's.
[0215] The invention will now be further described by way of Examples, which are meant to serve to assist one of ordinary skill in the art in carrying out the invention and are not intended in any way to limit the scope of the invention.
EXAMPLES
Example 1
Functional Expression and Binding of Dopamine Active Transporter (DAT) in T-Cells
[0216] To determine the potential for utilising a human DAT (hDAT) reporter to image T-cells using [.sup.123I]-FP-CIT, a retroviral vector (SFG.hDAT.I.CD34) encoding both hDAT and CD34 genes was constructed (
[0217] Binding of [.sup.123I]-FP-CIT (
Example 2
T Cells Expressing hDAT Retain Proliferative and IFN- Release Ability
[0218] Primary T cells, EBV-specific CTLs were engineered with hDAT to study any effect the reporter may have on the proliferation and cytokine release. EBV-CTLs were transduced with hDAT (EBV-CTL/SFG.hDAT.I.CD34) or a control vector encoding a HA1 T cell receptor (EBV-CTL/SFG.V5-HA1-TCR_opt.I.CD34) and the proliferative and IFN- release ability was compared to non-transduced EBV-CTLs (NT/EBV CTLs). The transduction efficiency was 39.4% in EBV-CTL/SFG.hDAT.I.CD34 (
Example 3
In Vivo Evaluation of the hDAT/[.SUP.123.I]-FP-CIT Reporter System
[0219] Immunocompromised mice (n=4) were stereotactically injected with SupT1/SFG.hDAT.I.CD34 cells co-transduced with FLuc above the right basal ganglia. Sequential bioluminescence, MRI and SPECT images were acquired at day 25 post cell inoculation. Bioluminescence and MR images were acquired prior to [.sup.123I]-FP-CIT imaging. Cell viability was confirmed using bioluminescence (
[0220] The co-registered SPECT-MR-CT images displayed good co-localisation of the MR contrast and SPECT signal at the site of injection (
[0221] Image guided [.sup.123I]-FP-CIT time-activity curves were generated by automatic segmentation of ROIs using an inviCRO mouse brain atlas for the striatum and cerebellum (
[0222] hDAT positive cells could also be detected using .sup.18F-FP-CIT i.v. and PET/CT image acquisition (see
Example 4
Generation of Variant hDATs
[0223] The inventors generated a range of constructs expressing hDAT and hDAT variant proteins. Assessment of the binding capabilities of the hDAT and variant hDAT proteins demonstrated that a hDAT protein in which the last two transmembrane domains had been deleted was unable to bind [123I]-FP-CIT (
[0224] In contrast truncated hDAT proteins lacking either the 49 N-terminal amino acids or the 18 C-terminal amino acids compared to wild-type hDAT were able to bind [.sup.123I]-FP-CIT (
[0225] In addition hDAT tagged with RQR8 and hDAT including a D313N mutation were able to bind increased levels of [.sup.123I]-FP-CIT compare to wild-type hDAT (
Example 5
Functional Co-Expression of a CD19 CAR-hDAT Construct
[0226] The inventors generated a construct which co-expressed a CD19 CAR and hDAT (see
[0227] These analyses demonstrated that it was possible to provide functional co-expression of a CAR and a DAT protein from the same construct. In particular, the CD19 CAR expressed from the construct was able to able to bind to CD19 (see
Example 6
Bioluminescence Imaging Demonstrates that Systemically Administered T Cells Track to the Brain
[0228] Homing of anti-CD19 CAR T cells to CNS lymphoma post systemic administration was demonstrated by bioluminescence imaging and histology (see
Materials and Methods
Molecular Cloning
[0229] Bene-synthesis using PCR assembly of overlapping oligos generated all constructs unless otherwise specified. Oligonucleotides obtained from IDTDNA, quick ligase, phusion polymerase and NEB5 (New England Biolabs) were used for molecular cloning. The splicing oncoretroviral SFG vector.sup.1 and an ECMV IRES.sup.2 sequence fused expression vector encoding the hDAT reporter gene and CD34 (SFG.hDAT.I.CD34) was used.
[0230] To generate the CD19/hDAT co-expression construct an in-house algorithm was used for codon optimization of hDAT. Cryptic splicing, hairpins, cis-acting sequences and literal repeats were eliminated with GC content was maintained at 70%. The tricistronic construct (RQR8.2A.aCD19.2A.hDAT_opt) consisted of a 2A peptide linkage of the RQR8 cell marker gene, anti-CD19 CAR fused with the codon optimised hDAT (huDATopt).
Generation of hDAT Expressing T-Lymphocyte Cell Lines
[0231] All cell culture medium and supplements were obtained from Lonza BioWhittaker unless otherwise stated. RD114 pseudotyped supernatant generated from transfection of HEK-293T cells with the expression plasmids supplying Gagpol, RD114 envelope PeqPam-env and hDAT. SupT1 cells obtained from the American Type Culture Collection (ATCC) were transduced and cultured in RPMI media supplemented with 10% fetal bovine serum (FBS) and GlutaMAX (Gibco), 10 mM HEPES, 0.1 M 2-mercaptoethanol. Cell lines were maintained at 37 C. in a humidified 5% CO.sub.2 atmosphere. SupT1 cell lines were engineered with SFG.hDAT.I.CD34 (SupT1/hDAT.I.CD34). SupT1/hDAT.I.CD34 cells were cotransduced with red shifted codon optimized Firefly Luciferase (FLuc; SFG.FLuc_tisix5_2A_Gluc_exo_mycx5) for bioluminescence (BLI) imaging.
hDAT Expressing EBV Specific CTLs
[0232] PBMCs isolated from three donors were stimulated as previously described.sup.3 with EBV pepmix at 1 g/mL in X-Vivo15+2% human AB serum. EBV-CTL cell were transduced with the hDAT vector (EBV-CTL/hDAT.I.CD34) or the control vector (EBV-CTL/V5-HA1-TCR_opt.I.CD34). Cell lines were expanded in culture for two weeks and stimulated with autologous, irradiated B-LCLs for 4 days. Proliferation was tested by H.sup.3-thymidine uptake for 21 h and IFN- secretion was assessed by ELISA 24 h after stimulation.
Flow Cytometry and Cell Sorting
[0233] The hDAT vector expression was determined by CD34-eBFP staining for the SupT1/hDAT.I.CD34 cells and CD34-APC staining for transduced EBV-CTLs. The brightest 5% of SupT1/hDAT.I.CD34 cells were isolated by fluorescence activated cell sorting (FACs). Beckman-Coulter Cyan BD LSRII Fortessa instrument was used for flow cytometry and the Beckman-Coulter MoFlo-XDP sorter for flow sorting.
[0234] To determine functional CD19 binding by the CD19 CAR co-expressed with hDAT, transduction efficiency was determined by QBEND10 staining for the PBMC's/RQR8.2A.aCD19.2A.hDAT_opt cells and aCD19 CAR expression in PBMC's/RQR8.2A.aCD19.2A.hDAT_opt cells was assessed using a method previously described.sup.9 with the following modifications; A K562 cell line which secretes a truncated version of CD19.sup.10 fused to the rabbit Ig constant domain was generated. Target cells were stained using a crude cellular supernatant (CD19-rFc) followed by an anti-rabbit Fc antibody (FITC) to confirm the presence of the CAR mediated binding. Fluoresence activated cell sorting was used to isolate the brightest 5% of SupT1/hDAT.I.CD34 cells. Beckman-Coulter Cyan BD LSRII Fortessa instrument was used for flow cytometry and the Beckman-Coulter MoFlo-XDP sorter for flow sorting.
In Vitro Radiosubstrate Binding Assays
[0235] Reporter protein binding capabilities was assessed in a method previously described. Briefly, 110.sup.6 all hDAT expressing T-cells and the non-transduced control cells were incubated at 37 C. with 7.4 kBq .sup.123I-FP-CIT (GE, Healthcare) for 30 mins. At each time point, cells were rapidly washed twice with 500 L ice-cold PBS and the supernatant collected. Cell pellets were re-suspended in 1 mL PBS. .sup.123I-FP-CIT binding in cells and medium was measured using a gamma counter (WIZARD.sup.2, PerkinElmer, UK). To determine the non-specific binding of the .sup.123I-FP-CIT in hDAT (+) cells, transduced cells and non-transduced cells were incubated with 50 M of -CIT-FP (ABX) for 5 min. .sup.123I-FP-CIT cells were subsequently prepared for gamma counting as mentioned above. All experiments were performed in triplicates and repeated twice. All results are given as meanstandard deviation of the mean (SD). The data was analysed using one way analysis of variance (ANOVA) followed by the Tukey's HSD test with the IBM SPSS software.
Mouse Brain Xenograft Models
[0236] All animal procedures were carried out in accordance with the UK Animals (Scientific Procedures) 1986 Act and institutional ethics regulation. NSG mice were bred in-house and kept according to institutional guidelines. Male mice 6-10 weeks old were injected with 2 mg/kg body weight of 5% carprofen (Norbrook) and anaesthetised with 3-5% Isoflurane (ABBOTT, UK) in an induction chamber. Animals were placed in a stereotactic frame (David Kopf Instruments) with an anaesthesia head holder to deliver 3% isoflurane. A sagittal incision over the parieto-occipital bone using a sterile scalpel (Swann Morton Ltd) was made and a blunt ended Hamilton (75N, 26s/2/25 ul) syringe with SupT1/hDAT.I.CD34 was placed 1.5 mm lateral and 1 mm anterior of bregma. The needle was lowered 4 mm in the brain through a burr hole and retracted 1 mm to create a small reservoir where the cells (110.sup.4 in a 3 l volume) were injected.
In Vivo Bioluminescence and MR Imaging
[0237] Bioluminescence imaging was performed every 7 days following inoculation. Images were acquired 15 min. post intraperitoneal (i.p.) administration of 200 L of D-Luciferin (10 mg/mL) and 1 min acquisition time. Images were acquired using a Biospace photon imager Optima system and analysed using the Biospace M3 Vision software.
[0238] Magnetic resonance images were acquired on the same day as the SPECT/CT images for accurate coregistration of the MRI and SPECT data.sup.5. Images were acquired on a small animal 1T ICON MRI (Bruker, Rimpar, Germany) scanner with a 26 mm diameter mouse head coil. Images were acquired using a T.sub.2weighted sequence (TR=3201.5 ms, TE=85 ms, flip angle=90, 2020 mm.sup.2 field of view=2 cm, 9696 matrix, slice thickness=0.5 mm, 30 averages were acquired with an acquisition time of 13 min). Mice bearing SupT1/hDAT.I.CD34 cells were imaged at three weeks post cell inoculation.
SPECT/CT Image Acquisition and Processing
[0239] Animals were administered with 1.5 mmol/kg of the thyroid blocking agent potassium perchlorate (Sigma Aldrich, USA) intraperitoneally one hour prior to imaging. Animals were imaged with a NanoSPECT/CT small animal in vivo scanner (Mediso, Hungary) consisting of a rotating double headed camera (company, country). 1.2 mm pinhole mouse apertures were used. Imaging was performed under isoflurane (1.5-2%) and the body temperature was maintained at 37 C. using a heated animal bed (Minerve, France). For the kinetic study, animals were administered with an average of 17.251.22 MBq of .sup.123I-FP-CIT i.v. and 15 min. brain scans were acquired day 25 post tumour inoculation at 15 min. 2 h, 4 h, 6 h and 8 h. Images were reconstructed using HiSPECT software (InviCRO, USA) and image processing analysis was performed (VivoQuant Software; InviCRO, USA).
Kinetic Study Data Analysis
[0240] Time activity profiles were generated evaluate the hDAT reporter system in vivo. Regions of interest (ROIs) for the hDAT expressing xenografts, cerebellum (chose background region) and striatum were drawn on the SPECT/MR/CT coregistered data. The percentage in injected dose per mm.sup.3 (% ID/mm.sup.3) was calculated by; injected dose (MBq)/counts in the whole body (MBq)/volume of the ROI (mm.sup.3) to determine the peak uptake time and the optimum imaging window. A method based on the striatal binding ratio was utilised to determine specific-to-nondisplaceable binding ratios previously described as indicative of the binding potential at the time of binding equilibrium.sup.6,7. The binding ratios were calculated by determining the mean counts per pixel in the specific region (hDAT expressing xenograft for the hDAT: cerebellum and hDAT: striatum ratios) divided by the mean counts per pixel in the nonspecific region.
Histopathology
[0241] Brain slices were stained with hematoxylin and eosin (H&E) and immunohistochemistry against CD34 was performed on alternate slices. Paraffin-embedded 2 m brain slices were dewaxed and rehydrated. Endogenous H.sub.2O.sub.2 blocking was performed with a protease-blocking reagent (DakoCytomation, Denmark). Slides were incubated at room temperature for 30 min. with the following anti-human mouse monoclonal antibodies: CD34 (Leica Microsystems, UK) for the T-cells. Images were obtained using a NanoZoomer Digital Pathology System (Hamamatsu, Japan).
PET/CT Image Acquisition and Processing
[0242] Animals were administered with 1.5 mmol/kg of the thyroid blocking agent potassium perchlorate (Sigma Aldrich, USA) intraperitoneally one hour prior to imaging. Animals were imaged with a PET/CT small animal in vivo scanner (Mediso, Hungary). Imaging was performed under isoflurane (1.5-2%) and the body temperature was maintained at 37 C. using a heated animal bed (Minerve, France). Four weeks post tumour inoculation, animals were administered with 5 MBq of .sup.18F-FP-CIT i.v. and brain scans were acquired 30 min post injection. A high-resolution CT was acquired immediately following SPECT imaging. Images were reconstructed using HiSPECT software (InviCRO, USA) and image processing analysis was performed (VivoQuant Software; InviCRO, USA).
In Vivo Bioluminescence Imaging
[0243] Bioluminescence imaging was performed every 7 days following inoculation. Images were acquired 15 min. post intraperitoneal (i.p.) administration of 200 L of D-Luciferin (10 mg/mL) and 1 min acquisition time. Images were acquired using a Biospace photon imager Optima system and analysed using the Biospace M3 Vision software. Animals underwent further MRI, SPECT/CT imaging depending on the photon counts.
In Vivo MRI
[0244] Magnetic resonance images were acquired on the same day as the SPECT/CT images for accurate coregistration of the MRI and SPECT data. Images were acquired on a small animal 1T ICON MRI (Bruker, Rimpar, Germany) scanner with a 26 mm diameter mouse head coil. Images were acquired using a T.sub.2weighted sequence (TR=3201.5 ms, TE=85 ms, flip angle=90, 2020 mm.sup.2 field of view=2 cm, 9696 matrix, slice thickness=0.5 mm, 30 averages were acquired with an acquisition time of 13 min). For the CAR-T cells trafficking study, animals bearing Raji tumours were imaged at pre CAR T cell injection (day 11 post Raji tumour) to determine the tumour size prior to anti and day 7 post intravenous administration of 110.sup.7 aCD19 CAR T cells.
CNS Lymphoma Model
[0245] PBMCs co-transduced with anti-CD19 CAR and FLuc were injected via tail vein at two weeks post intracranial injection of lymphoma. Tumour progression was assessed by MRI and T cell distribution visualised by bioluminescence imaging (
REFERENCES
[0246] 1. Riviere I, Brose K, Mulligan R C. Effects of retroviral vector design on expression of human adenosine deaminase in murine bone marrow transplant recipients engrafted with genetically modified cells. Proc Natl Acad Sci USA 1995; 92:6733-7. [0247] 2. Bochkov Y A, Palmenberg A C. Translational efficiency of EMCV IRES in bicistronic vectors is dependent upon IRES sequence and gene location. Biotechniques 2006; 41:283-+. [0248] 3. Moosmann A, Bigalke I, Tischer J, et al. Effective and long-term control of EBV PTLD after transfer of peptide-selected T cells. Blood 2010; 115:2960-70. [0249] 4. Badar A, Kiru L, Kalber T L, et al. Fluorescence-guided development of a tricistronic vector encoding bimodal optical and nuclear genetic reporters for in vivo cellular imaging. EJNMMI Res 2015; 5:18. [0250] 5. Andringa G, Drukarch B, Bol J G, et al. Pinhole SPECT imaging of dopamine transporters correlates with dopamine transporter immunohistochemical analysis in the MPTP mouse model of Parkinson's disease. NeuroImage 2005; 26:1150-8. [0251] 6. Laruelle M, Wallace E, Seibyl J P, et al. Graphical, kinetic, and equilibrium analyses of in vivo [123I] beta-CIT binding to dopamine transporters in healthy human subjects. Journal of cerebral blood flow and metabolism: official journal of the International Society of Cerebral Blood Flow and Metabolism 1994; 14:982-94. [0252] 7. van Dyck C H, Seibyl J P, Malison R T, et al. Age-related decline in striatal dopamine transporter binding with iodine-123-beta-CITSPECT. J Nucl Med 1995; 36:1175-81. [0253] 8. Hiasa A, Hirayama M, Nishikawa H, et al. Long-term phenotypic, functional and genetic stability of cancer-specific T-cell receptor (TCR) alphabeta genes transduced to CD8+ T cells. Gene Ther 2008; 15:695-9. [0254] 9. Philip B, Kokalaki E, Mekkaoui L, et al. A highly compact epitope-based marker/suicide gene for easier and safer T-cell therapy. Blood 2014; 124:1277-87. [0255] 10. Bradbury L E, Goldmacher V S, Tedder T F. The CD19 signal transduction complex of B lymphocytes. Deletion of the CD19 cytoplasmic domain alters signal transduction but not complex formation with TAPA-1 and Leu 13. J Immunol 1993; 151:2915-27.
[0256] All publications mentioned in the above specification are herein incorporated by reference. Various modifications and variations of the described methods and system of the invention will be apparent to those skilled in the art without departing from the scope and spirit of the invention. Although the invention has been described in connection with specific preferred embodiments, it should be understood that the invention as claimed should not be unduly limited to such specific embodiments. Indeed, various modifications of the described modes for carrying out the invention which are obvious to those skilled in the art are intended to be within the scope of the following claims.