Cancer antigens and methods
12263216 ยท 2025-04-01
Assignee
Inventors
- George KASSIOTIS (London, GB)
- George YOUNG (London, GB)
- Jan ATTIG (London, GB)
- Bram Snijders (London, GB)
- David PERKINS (London, GB)
- FABIO MARINO (LONDON, GB)
- Nicola Ternette (London, GB)
Cpc classification
A61K39/39
HUMAN NECESSITIES
A61K40/11
HUMAN NECESSITIES
A61K2039/55561
HUMAN NECESSITIES
C07K14/4748
CHEMISTRY; METALLURGY
C12N5/0639
CHEMISTRY; METALLURGY
A61K2039/55572
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
International classification
A61K39/00
HUMAN NECESSITIES
A61K39/39
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
Abstract
There are disclosed inter alia polypeptides and nucleic acids encoding said polypeptides which are useful in the treatment, prevention and diagnosis of cancer, particularly melanoma, especially cutaneous melanoma and uveal melanoma.
Claims
1. A composition comprising an isolated polypeptide and an immunostimulant selected from the group consisting of aluminum phosphate, saponins, immunostimulatory oligonucleotides, aminoalkyl glucosaminide 4-phosphates, lipopolysaccharides, 3-de-O-acylated monophosphoryl lipid A (3D-MPL), toll-like receptor 4 (TLR4) ligands, toll-like receptor 7 (TLR7) ligands, toll-like receptor 8 (TLR8) ligands, toll-like receptor 9 (TLR9) ligands, interleukin 12 (IL-12), and interferons, wherein: the isolated polypeptide comprises the amino acid sequence selected from the group consisting of SEQ ID NO: 1, 11-14, 55-57 and 73-74.
2. A fusion protein comprising a first polypeptide and one or more additional polypeptides, wherein the first polypeptide comprises: (i) the amino acid sequence selected from the group consisting of SEQ ID NO: 1, 11-14, 55-57 and 73-74; (ii) a melanoma associated antigen; iii) a universal CD4 helper epitope; or (iv) an immunostimulant polypeptide selected from the group consisting of IL-12, interferons, and checkpoint blockade molecules, wherein the first polypeptide and the one or more additional polypeptides are not the same.
3. A method of making the composition of claim 1, the method comprising combining the immunostimulant with the isolated polypeptide, wherein: the isolated polypeptide comprises the amino acid sequence selected from the group consisting of SEQ ID NO: 1, 11-14, 55-57 and 73-74.
Description
DESCRIPTION OF THE FIGURES
(1) For each of
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
(24)
(25)
(26)
(27)
(28)
(29)
(30) For each of
(31)
(32)
(33)
(34)
(35)
(36)
(37)
(38)
(39)
(40)
(41)
(42)
(43)
(44)
(45) Each of
(46)
(47)
(48)
(49)
(50)
(51)
(52)
(53)
(54)
(55)
(56)
(57)
(58)
(59)
(60)
(61)
(62)
DESCRIPTION OF THE SEQUENCES
(63) SEQ ID NO. 1 is the polypeptide sequence of CLT Antigen 1
(64) SEQ ID NO. 2 i is the polypeptide sequence of CLT Antigen 2
(65) SEQ ID NO. 3 is the polypeptide sequence of CLT Antigen 3
(66) SEQ ID NO. 4 is the polypeptide sequence of CLT Antigen 4
(67) SEQ ID NO. 5 is the polypeptide sequence of CLT Antigen 5
(68) SEQ ID NO. 6 is the polypeptide sequence of CLT Antigen 6
(69) SEQ ID NO. 7 is the polypeptide sequence of CLT Antigen 7
(70) SEQ ID NO. 8 is the polypeptide sequence of CLT Antigen 8
(71) SEQ ID NO. 9 is the polypeptide sequence of CLT Antigen 9
(72) SEQ ID NO. 10 is the polypeptide sequence of CLT Antigen 10
(73) SEQ ID NOs. 11-14 are peptide sequences derived from CLT Antigen 1
(74) SEQ ID NOs. 15 and 16 are peptide sequences derived from CLT Antigen 2
(75) SEQ ID NOs. 17 and 18 are peptide sequences derived from CLT Antigen 3
(76) SEQ ID NO. 19 is a peptide sequence derived from CLT Antigen 4
(77) SEQ ID NOs. 20-22 are peptide sequences derived from CLT Antigen 5
(78) SEQ ID NOs. 23 and 24 are peptide sequences derived from CLT Antigen 6
(79) SEQ ID NO. 25 is a peptide sequence derived from CLT Antigen 7
(80) SEQ ID NO. 26 is a peptide sequence derived from CLT Antigen 8
(81) SEQ ID NOs. 27-29 are peptide sequences derived from CLT Antigen 9
(82) SEQ ID NOs. 30-32 are peptide sequences derived from CLT Antigen 10
(83) SEQ ID NO. 33 is the cDNA sequence of the CLT encoding CLT Antigen 1
(84) SEQ ID NO. 34 is the cDNA sequence of the CLT encoding CLT Antigen 2
(85) SEQ ID NO. 35 is the cDNA sequence of the CLT encoding CLT Antigens 3 and 4
(86) SEQ ID NO. 36 is the cDNA sequence of the CLT encoding CLT Antigen 5
(87) SEQ ID NO. 37 is the cDNA sequence of the CLT encoding CLT Antigen 6
(88) SEQ ID NO. 38 is the cDNA sequence of the CLT encoding CLT Antigens 7 and 8
(89) SEQ ID NO. 39 is the cDNA sequence of the CLT encoding CLT Antigen 9
(90) SEQ ID NO. 40 is the cDNA sequence of the CLT encoding CLT Antigen 10
(91) SEQ ID NO. 41 is a cDNA sequence encoding CLT Antigen 1
(92) SEQ ID NO. 42 is a cDNA sequence encoding CLT Antigen 2
(93) SEQ ID NO. 43 is a cDNA sequence encoding CLT Antigen 3
(94) SEQ ID NO. 44 is a cDNA sequence encoding CLT Antigen 4
(95) SEQ ID NO. 45 is a cDNA sequence encoding CLT Antigen 5
(96) SEQ ID NO. 46 is a cDNA sequence encoding CLT Antigen 6
(97) SEQ ID NO. 47 is a cDNA sequence encoding CLT Antigen 7
(98) SEQ ID NO. 48 is a cDNA sequence encoding CLT Antigen 8
(99) SEQ ID NO. 49 is a cDNA sequence encoding CLT Antigen 9
(100) SEQ ID NO. 50 is a cDNA sequence encoding CLT Antigen 10
(101) SEQ ID NOs. 51-52 are peptide sequences derived from CLT Antigen 4
(102) SEQ ID NO. 53 is a peptide sequence derived from CLT Antigen 3
(103) SEQ ID NO. 54 is a peptide sequences derived from CLT Antigen 4
(104) SEQ ID NOs. 55-57 are peptide sequences derived from CLT Antigen 1
(105) SEQ ID NOs. 58-66 are peptide sequences derived from CLT Antigen 2
(106) SEQ ID NOs. 67-69 are peptide sequences derived from CLT Antigen 3
(107) SEQ ID NOs. 70-72 are peptide sequences derived from CLT Antigen 4
(108) SEQ ID NOs. 73-74 are peptide sequences derived from CLT Antigen 1
(109) SEQ ID NO. 75 is a peptide sequence derived from CLT Antigen 2
(110) SEQ ID NOs. 76-77 are peptide sequences derived from CLT Antigen 4
(111) SEQ ID NO. 78 is a peptide sequence derived from CLT Antigen 2
DETAILED DESCRIPTION OF THE INVENTION
(112) Polypeptides
(113) The terms protein, polypeptide and peptide are used interchangeably herein and refer to any peptide-linked chain of amino acids, regardless of length, co-translational or post-translational modification.
(114) The term amino acid refers to any one of the naturally occurring amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner which is similar to the naturally occurring amino acids. Naturally occurring amino acids are those 20 L-amino acids encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, -carboxyglutamate, and O-phosphoserine. The term amino acid analogue refers to a compound that has the same basic chemical structure as a naturally occurring amino acid, i.e., an carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group but has a modified R group or a modified peptide backbone as compared with a natural amino acid. Examples include homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium and norleucine. Amino acid mimetics refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that functions in a manner similar to a naturally occurring amino acid. Suitably an amino acid is a naturally occurring amino acid or an amino acid analogue, especially a naturally occurring amino acid and in particular one of those 20 L-amino acids encoded by the genetic code.
(115) Amino acids may be referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Nucleotides, likewise, may be referred to by their commonly accepted single-letter codes. Thus, the invention provides an isolated polypeptide comprising a sequence selected from: (a) the sequence of any one of SEQ ID NOs. 1-10; and (b) a variant of the sequences of (a); and (c) an immunogenic fragment of the sequences of (a) The invention also provides an isolated polypeptide comprising a sequence selected from: (a) the sequence of any one of SEQ ID NOs. 1-10 minus the initial methionine residue; and (b) a variant of the sequences of (a); and (c) an immunogenic fragment of the sequences of (a)
(116) In general, variants of polypeptide sequences of the invention include sequences having a high degree of sequence identity thereto. For example variants suitably have at least about 80% identity, more preferably at least about 85% identity and most preferably at least about 90% identity (such as at least about 95%, at least about 98% or at least about 99%) to the associated reference sequence over their whole length.
(117) Suitably the variant is an immunogenic variant. A variant is considered to be an immunogenic variant where it elicits a response which is at least 20%, suitably at least 50% and especially at least 75% (such as at least 90%) of the activity of the reference sequence (i.e. the sequence of which the variant is a variant) e.g., in an in vitro restimulation assay of PBMC or whole blood with the polypeptide as antigen (e.g., restimulation for a period of between several hours to up to 1 year, such as up to 6 months, 1 day to 1 month or 1 to 2 weeks), that measures the activation of the cells via lymphoproliferation (e.g., T-cell proliferation), production of cytokines (e.g., IFN-gamma) in the supernatant of culture (measured by ELISA etc.) or characterisation of T-cell responses by intra and extracellular staining (e.g., using antibodies specific to immune markers, such as CD3, CD4, CD8, IL2, TNF-alpha, IFNg, Type 1 IFN, CD40L, CD69 etc.) followed by analysis with a flow cytometer.
(118) The variant may, for example, be a conservatively modified variant. A conservatively modified variant is one where the alteration(s) results in the substitution of an amino acid with a functionally similar amino acid or the substitution/deletion/addition of residues which do not substantially impact the biological function of the variant. Typically, such biological function of the variants will be to induce an immune response against a melanoma e.g. a cutaneous melanoma cancer antigen.
(119) Conservative substitution tables providing functionally similar amino acids are well known in the art. Variants can include homologues of polypeptides found in other species.
(120) A variant of a polypeptide of the invention may contain a number of substitutions, for example, conservative substitutions (for example, 1-25, such as 1-10, in particular 1-5, and especially 1 amino acid residue(s) may be altered) when compared to the reference sequence. The number of substitutions, for example, conservative substitutions, may be up to 20% e.g., up to 10% e.g., up to 5% e.g., up to 1% of the number of residues of the reference sequence. In general, conservative substitutions will fall within one of the amino-acid groupings specified below, though in some circumstances other substitutions may be possible without substantially affecting the immunogenic properties of the antigen. The following eight groups each contain amino acids that are typically conservative substitutions for one another: 1) Alanine (A), Glycine (G); 2) Aspartic acid (D), Glutamic acid (E); 3) Asparagine (N), Glutamine (Q); 4) Arginine (R), Lysine (K); 5) Isoleucine (I), Leucine (L), Methionine (M), Valine (V); 6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W); 7) Serine (S), Threonine (T); and 8) Cysteine (C), Methionine (M) (see, e.g., Creighton, Proteins 1984).
(121) Suitably such substitutions do not alter the immunological structure of an epitope (e.g., they do not occur within the epitope region as mapped in the primary sequence), and do not therefore have a significant impact on the immunogenic properties of the antigen.
(122) Polypeptide variants also include those wherein additional amino acids are inserted compared to the reference sequence, for example, such insertions may occur at 1-10 locations (such as 1-5 locations, suitably 1 or 2 locations, in particular 1 location) and may, for example, involve the addition of 50 or fewer amino acids at each location (such as 20 or fewer, in particular 10 or fewer, especially 5 or fewer). Suitably such insertions do not occur in the region of an epitope, and do not therefore have a significant impact on the immunogenic properties of the antigen. One example of insertions includes a short stretch of histidine residues (e.g., 2-6 residues) to aid expression and/or purification of the antigen in question.
(123) Polypeptide variants include those wherein amino acids have been deleted compared to the reference sequence, for example, such deletions may occur at 1-10 locations (such as 1-5 locations, suitably 1 or 2 locations, in particular 1 location) and may, for example, involve the deletion of 50 or fewer amino acids at each location (such as 20 or fewer, in particular 10 or fewer, especially 5 or fewer). Suitably such deletions do not occur in the region of an epitope, and do not therefore have a significant impact on the immunogenic properties of the antigen.
(124) The skilled person will recognise that a particular protein variant may comprise substitutions, deletions and additions (or any combination thereof). For example, substitutions/deletions/additions might enhance (or have neutral effects) on binding to desired patient HLA molecules, potentially increasing immunogenicity (or leaving immunogenicity unchanged).
(125) Immunogenic fragments according to the present invention will typically comprise at least 9 contiguous amino acids from the full-length polypeptide sequence (e.g., at least 9 or 10), such as at least 12 contiguous amino acids (e.g., at least 15 or at least 20 contiguous amino acids), in particular at least 50 contiguous amino acids, such as at least 100 contiguous amino acids (for example at least 200 contiguous amino acids) depending on the length of the CLT antigen. Suitably the immunogenic fragments will be at least 10%, such as at least 20%, such as at least 50%, such as at least 70% or at least 80% of the length of the full-length polypeptide sequence.
(126) Immunogenic fragments typically comprise at least one epitope. Epitopes include B cell and T-cell epitopes and suitably immunogenic fragments comprise at least one T-cell epitope such as a CD4+ or a CD8+ T-cell epitope.
(127) T-cell epitopes are short contiguous stretches of amino acids which are recognised by T-cells (e.g., CD4+ or CD8+ T-cells) when bound to HLA molecules. Identification of T-cell epitopes may be achieved through epitope mapping experiments which are well known to the person skilled in the art (see, for example, Paul, Fundamental Immunology, 3rd ed., 243-247 (1993); Beibarth et al., 2005, Bioinformatics, 21(Suppl. 1):i29-i37).
(128) As a result of the crucial involvement of the T-cell response in cancer, it is readily apparent that fragments of the full-length polypeptides of SEQ ID NOs. 1-10 which contain at least one T-cell epitope may be immunogenic and may contribute to immunoprotection.
(129) It will be understood that in a diverse outbred population, such as humans, different HLA types mean that specific epitopes may not be recognised by all members of the population. Consequently, to maximise the level of recognition and scale of immune response to a polypeptide, it is generally desirable that an immunogenic fragment contains a plurality of the epitopes from the full-length sequence (suitably all epitopes within a CLT antigen).
(130) Particular fragments of the polypeptides of SEQ ID NOs. 1-10 which may be of use include those containing at least one CD8+ T-cell epitope, suitably at least two CD8+ T-cell epitopes and especially all CD8+ T-cell epitopes, particularly those associated with a plurality of HLA alleles, e.g., those associated with 2, 3, 4, 5 or more alleles). Particular fragments of the polypeptides of SEQ ID NOs. 1-10 which may be of use include those containing at least one CD4+ T-cell epitope, suitably at least two CD4+ T-cell epitopes and especially all CD4+ T-cell epitopes (particularly those associated with a plurality of HLA alleles, e.g., those associated with 2, 3, 4, 5 or more alleles). However, a person skilled in design of vaccines could combine exogenous CD4+ T-cell epitopes with CD8+ T-cells epitopes of this invention and achieve desired responses to the invention's CD8+ T-cell epitopes.
(131) Where an individual fragment of the full-length polypeptide is used, such a fragment is considered to be immunogenic where it elicits a response which is at least 20%, suitably at least 50% and especially at least 75% (such as at least 90%) of the activity of the reference sequence (i.e., the sequence of which the fragment is a fragment) e.g., activity in an in vitro restimulation assay of PBMC or whole blood with the polypeptide as antigen (e.g., restimulation for a period of between several hours to up to 1 year, such as up to 6 months, 1 day to 1 month or 1 to 2 weeks,) that measures the activation of the cells via lymphoproliferation (e.g., T-cell proliferation), production of cytokines (e.g., IFN-gamma) in the supernatant of culture (measured by ELISA etc.) or characterisation of T-cell responses by intra and extracellular staining (e.g., using antibodies specific to immune markers, such as CD3, CD4, CD8, IL2, TNF-alpha, IFN-gamma, Type 1 IFN, CD4OL, CD69 etc.) followed by analysis with a flow cytometer.
(132) In some circumstances a plurality of fragments of the full-length polypeptide (which may or may not be overlapping and may or may not cover the entirety of the full-length sequence) may be used to obtain an equivalent biological response to the full-length sequence itself. For example, at least two immunogenic fragments (such as three, four or five) as described above, which in combination provide at least 50%, suitably at least 75% and especially at least 90% activity of the reference sequence in an in vitro restimulation assay of PBMC or whole blood (e.g., a T-cell proliferation and/or IFN-gamma production assay).
(133) Example immunogenic fragments of polypeptides of SEQ ID NOs. 1-10, and thus example peptides of the invention, include polypeptides which comprise or consist of the sequences of SEQ ID NOs. 11-32. Further example immunogenic fragments of polypeptides of SEQ ID NOs. 1-4, and thus example peptides of the invention, include polypeptides which comprise or consist of the sequences of SEQ ID NOs. 51-78. The sequences of SEQ ID NOs. 11-17, 19-28, 30-31 and 51-54 were identified as being bound to HLA Class I molecules from immunopeptidomic analysis (see Examples 2 and 2.1). The sequences of SEQ ID NOs. 18, 29 and 32 were identified as being bound to HLA Class II molecules from immunopeptidomic analysis (see Example 2). The sequences of SEQ ID NOs 55-78 were predicted by NetMHC software eas being bound to HLA Class I molecules and were used in immunological validation assays (see Examples 3, 4 and 5).
(134) Nucleic Acids
(135) The invention provides an isolated nucleic acid encoding a polypeptide of the invention (referred to as a nucleic acid of the invention). For example, the nucleic acid of the invention comprises or consists of a sequence selected from SEQ ID NOs. 33-40 or 41-50.
(136) The terms nucleic acid and polynucleotide are used interchangeably herein and refer to a polymeric macromolecule made from nucleotide monomers particularly deoxyribonucleotide or ribonucleotide monomers. The term encompasses nucleic acids containing known nucleotide analogs or modified backbone residues or linkages, which are naturally occurring and non-naturally occurring, which have similar properties as the reference nucleic acid, and which are intended to be metabolized in a manner similar to the reference nucleotides or are intended to have extended half-life in the system. Examples of such analogs include, without limitation, phosphorothioates, phosphoramidates, methyl phosphonates, chiral-methyl phosphonates, 2-O-methyl ribonucleotides, peptide-nucleic acids (PNAs). Suitably the term nucleic acid refers to naturally occurring polymers of deoxyribonucleotide or ribonucleotide monomers. Suitably the nucleic acid molecules of the invention are recombinant. Recombinant means that the nucleic acid molecule is the product of at least one of cloning, restriction or ligation steps, or other procedures that result in a nucleic acid molecule that is distinct from a nucleic acid molecule found in nature (e.g., in the case of cDNA). In an embodiment the nucleic acid of the invention is an artificial nucleic acid sequence (e.g., a cDNA sequence or nucleic acid sequence with non-naturally occurring codon usage). In one embodiment, the nucleic acids of the invention are DNA. Alternatively, the nucleic acids of the invention are RNA.
(137) DNA (deoxyribonucleic acid) and RNA (ribounucleic acid) refer to nucleic acid molecules having a backbone of sugar moieties which are deoxyribosyl and ribosyl moieties respectively. The sugar moieties may be linked to bases which are the 4 natural bases (adenine (A), guanine (G), cytosine (C) and thymine (T) in DNA and adenine (A), guanine (G), cytosine (C) and uracil (U) in RNA). As used herein, a corresponding RNA is an RNA having the same sequence as a reference DNA but for the substitution of thymine (T) in the DNA with uracil (U) in the RNA. The sugar moieties may also be linked to unnatural bases such as inosine, xanthosine, 7-methylguanosine, dihydrouridine and 5-methylcytidine. Natural phosphodiester linkages between sugar (deoxyribosyl/ribosyl) moieties may optionally be replaced with phosphorothioates linkages. Suitably nucleic acids of the invention consist of the natural bases attached to a deoxyribosyl or ribosyl sugar backbone with phosphodiester linkages between the sugar moieties.
(138) In an embodiment the nucleic acid of the invention is a DNA. For example the nucleic acid comprises or consists of a sequence selected from SEQ ID NOs. 33-40 or 41-50. Also provided is a nucleic acid which comprises or consists of a variant of sequence selected from SEQ ID NOs. 33-40 or 41-50 which variant encodes the same amino acid sequence but has a different nucleic acid based on the degeneracy of the genetic code.
(139) Thus, due to the degeneracy of the genetic code, a large number of different, but functionally identical nucleic acids can encode any given polypeptide. For instance, the codons GCA, GCC, GCG and GCU all encode the amino acid alanine. Thus, at every position where an alanine is specified by a codon, the codon can be altered to any of the corresponding codons described without altering the encoded polypeptide. Such nucleic acid variations lead to silent (sometimes referred to as degenerate or synonymous) variants, which are one species of conservatively modified variations. Every nucleic acid sequence disclosed herein which encodes a polypeptide also enables every possible silent variation of the nucleic acid. One of skill will recognise that each codon in a nucleic acid (except AUG, which is ordinarily the only codon for methionine, and UGG, which is ordinarily the only codon for tryptophan) can be modified to yield a functionally identical molecule. Accordingly, each silent variation of a nucleic acid that encodes a polypeptide is implicit in each described sequence and is provided as an aspect of the invention.
(140) Degenerate codon substitutions may also be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues (Batzer et al., 1991, Nucleic Acid Res. 19:5081; Ohtsuka et al., 1985, J. Biol. Chem. 260:2605-2608; Rossolini et al., 1994, Mol. Cell. Probes 8:91-98).
(141) A nucleic acid of the invention which comprises or consists of a sequence selected from SEQ ID NOs. 33-40 or 41-50 may contain a number of silent variations (for example, 1-50, such as 1-25, in particular 1-5, and especially 1 codon(s) may be altered) when compared to the reference sequence.
(142) In an embodiment the nucleic acid of the invention is an RNA. RNA sequences are provided which correspond to a DNA sequence provided herein and have a ribonucleotide backbone instead of a deoxyribonucleotide backbone and have the sidechain base uracil (U) in place of thymine (T).
(143) Thus a nucleic acid of the invention comprises or consists of the RNA equivalent of a cDNA sequence selected from SEQ ID NOs. 33-40 or 41-50 and may contain a number of silent variations (for example, 1-50, such as 1-25, in particular 1-5, and especially 1 codon(s) may be altered) when compared to the reference sequence. By RNA equivalent is meant an RNA sequence which contains the same genetic information as the reference cDNA sequence (i.e. contains the same codons with a ribonucleotide backbone instead of a deoxyribonucleotide backbone and having the sidechain base uracil (U) in place of thymine (T)).
(144) The invention also comprises sequences which are complementary to the aforementioned cDNA and RNA sequences.
(145) In an embodiment, the nucleic acids of the invention are codon optimised for expression in a human host cell.
(146) The nucleic acids of the invention are capable of being transcribed and translated into polypeptides of the invention in the case of DNA nucleic acids, and translated into polypeptides of the invention in the case of RNA nucleic acids.
(147) Polypeptides and Nucleic Acids
(148) Suitably, the polypeptides and nucleic acids used in the present invention are isolated. An isolated polypeptide or nucleic acid is one that is removed from its original environment. For example, a naturally-occurring polypeptide or nucleic acid is isolated if it is separated from some or all of the coexisting materials in the natural system. A nucleic acid is considered to be isolated if, for example, it is cloned into a vector that is not a part of its natural environment.
(149) Naturally occurring when used with reference to a polypeptide or nucleic acid sequence means a sequence found in nature and not synthetically modified.
(150) Artificial when used with reference to a polypeptide or nucleic acid sequence means a sequence not found in nature which is, for example, a synthetic modification of a natural sequence, or contains an unnatural sequence.
(151) The term heterologous when used with reference to the relationship of one nucleic acid or polypeptide to another nucleic acid or polypeptide indicates that the two or more sequences are not found in the same relationship to each other in nature. A heterologous sequence can also mean a sequence which is not isolated from, derived from, or based upon a naturally occurring nucleic acid or polypeptide sequence found in the host organism.
(152) As noted above, polypeptide variants preferably have at least about 80% identity, more preferably at least about 85% identity and most preferably at least about 90% identity (such as at least about 95%, at least about 98% or at least about 99%) to the associated reference sequence over their whole length.
(153) For the purposes of comparing two closely-related polypeptide or polynucleotide sequences, the % sequence identity between a first sequence and a second sequence may be calculated. Polypeptide sequences are said to be the same as or identical to other polypeptide sequences, if they share 100% sequence identity over their entire length. Residues in sequences are numbered from left to right, i.e. from N- to C-terminus for polypeptides. The terms identical or percentage identity, in the context of two or more polypeptide sequences, refer to two or more sequences or sub-sequences that are the same or have a specified percentage of amino acid residues that are the same (i.e., 70% identity, optionally 75%, 80%, 85%, 90%, 95%, 98% or 99% identity over a specified region), when compared and aligned for maximum correspondence over a comparison window. Suitably, the comparison is performed over a window corresponding to the entire length of the reference sequence.
(154) For sequence comparison, one sequence acts as the reference sequence, to which the test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated. The sequence comparison algorithm then calculates the percentage sequence identities for the test sequences relative to the reference sequence, based on the program parameters.
(155) A comparison window, as used herein, refers to a segment in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned. Methods of alignment of sequences for comparison are well-known in the art. Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, 1981, Adv. Appl. Math. 2:482, by the homology alignment algorithm of Needleman & Wunsch, 1970, J. Mol. Biol. 48:443, by the search for similarity method of Pearson & Lipman, 1988, Proc. Nat'l. Acad. Sci. USA 85:2444, by computerised implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, WI), or by manual alignment and visual inspection (see, e.g., Current Protocols in Molecular Biology (Ausubel et al., eds. 1995 supplement)).
(156) One example of a useful algorithm is PILEUP. PILEUP creates a multiple sequence alignment from a group of related sequences using progressive, pairwise alignments to show relationship and percent sequence identity. It also plots a tree or dendogram showing the clustering relationships used to create the alignment. PILEUP uses a simplification of the progressive alignment method of Feng & Doolittle, 1987, J. Mol. Evol. 35:351-360. The method used is similar to the method described by Higgins & Sharp, 1989, CABIOS 5:151-153. The program can align up to 300 sequences, each of a maximum length of 5,000 nucleotides or amino acids. The multiple alignment procedure begins with the pairwise alignment of the two most similar sequences, producing a cluster of two aligned sequences. This cluster is then aligned to the next most related sequence or cluster of aligned sequences. Two clusters of sequences are aligned by a simple extension of the pairwise alignment of two individual sequences. The final alignment is achieved by a series of progressive, pairwise alignments. The program is run by designating specific sequences and their amino acid coordinates for regions of sequence comparison and by designating the program parameters. Using PILEUP, a reference sequence is compared to other test sequences to determine the percent sequence identity relationship using the following parameters: default gap weight (3.00), default gap length weight (0.10), and weighted end gaps. PILEUP can be obtained from the GCG sequence analysis software package, e.g., version 7.0 (Devereaux et al., 1984, Nuc. Acids Res. 12:387-395).
(157) Another example of algorithm that is suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al., 1977, Nuc. Acids Res. 25:3389-3402 and Altschul et al., 1990, J. Mol. Biol. 215:403-410, respectively. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information (website at www.ncbi.nlm.nih.gov/). This algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence, which either match or satisfy some positive-valued threshold score T when aligned with a word of the same length in a database sequence. T is referred to as the neighbourhood word score threshold (Altschul et al., supra). These initial neighbourhood word hits act as seeds for initiating searches to find longer HSPs containing them. The word hits are extended in both directions along each sequence for as far as the cumulative alignment score can be increased. Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always >0) and N (penalty score for mismatching residues; always <0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached. For amino acid sequences, the BLASTP program uses as defaults a wordlength of 3, and expectation (E) of 10, and the BLOSUM62 scoring matrix (see Henikoff & Henikoff, 1989, Proc. Natl. Acad. Sci. USA 89:10915) alignments (B) of 50, expectation (E) of 10, M=5, N=4, and a comparison of both strands.
(158) The BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin & Altschul, 1993, Proc. Nat'l. Acad. Sci. USA 90:5873-5787). One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance.
(159) A difference between sequences refers to an insertion, deletion or substitution of a single residue in a position of the second sequence, compared to the first sequence. Two sequences can contain one, two or more such differences. Insertions, deletions or substitutions in a second sequence which is otherwise identical (100% sequence identity) to a first sequence result in reduced % sequence identity. For example, if the identical sequences are 9 residues long, one substitution in the second sequence results in a sequence identity of 88.9%. If the identical sequences are 17 amino acid residues long, two substitutions in the second sequence results in a sequence identity of 88.2%.
(160) Alternatively, for the purposes of comparing a first, reference sequence to a second, comparison sequence, the number of additions, substitutions and/or deletions made to the first sequence to produce the second sequence may be ascertained. An addition is the addition of one residue into the first sequence (including addition at either terminus of the first sequence). A substitution is the substitution of one residue in the first sequence with one different residue. A deletion is the deletion of one residue from the first sequence (including deletion at either terminus of the first sequence).
(161) Production of Polypeptides of the Invention
(162) Polypeptides of the invention can be obtained and manipulated using the techniques disclosed for example in Green and Sambrook 2012 Molecular Cloning: A Laboratory Manual 4th Edition Cold Spring Harbour Laboratory Press. In particular, artificial gene synthesis may be used to produce polynucleotides (Nambiar et al., 1984, Science, 223:1299-1301, Sakamar and Khorana, 1988, Nucl. Acids Res., 14:6361-6372, Wells et al., 1985, Gene, 34:315-323 and Grundstrom et al., 1985, Nucl. Acids Res., 13:3305-3316) followed by expression in a suitable organism to produce polypeptides. A gene encoding a polypeptide of the invention can be synthetically produced by, for example, solid-phase DNA synthesis. Entire genes may be synthesized de novo, without the need for precursor template DNA. To obtain the desired oligonucleotide, the building blocks are sequentially coupled to the growing oligonucleotide chain in the order required by the sequence of the product. Upon the completion of the chain assembly, the product is released from the solid phase to solution, deprotected, and collected. Products can be isolated by high-performance liquid chromatography (HPLC) to obtain the desired oligonucleotides in high purity (Verma and Eckstein, 1998, Annu. Rev. Biochem. 67:99-134). These relatively short segments are readily assembled by using a variety of gene amplification methods (Methods Mol Biol., 2012; 834:93-109) into longer DNA molecules, suitable for use in innumerable recombinant DNA-based expression systems. In the context of this invention one skilled in the art would understand that the polynucleotide sequences encoding the polypeptide antigens described in this invention could be readily used in a variety of vaccine production systems, including, for example, viral vectors.
(163) For the purposes of production of polypeptides of the invention in a microbiological host (e.g., bacterial or fungal), nucleic acids of the invention will comprise suitable regulatory and control sequences (including promoters, termination signals etc) and sequences to promote polypeptide secretion suitable for protein production in the host. Similarly, polypeptides of the invention could be produced by transducing cultures of eukaryotic cells (e.g., Chinese hamster ovary cells or drosophila S2 cells) with nucleic acids of the invention which have been combined with suitable regulatory and control sequences (including promoters, termination signals etc) and sequences to promote polypeptide secretion suitable for protein production in these cells.
(164) Improved isolation of the polypeptides of the invention produced by recombinant means may optionally be facilitated through the addition of a stretch of histidine residues (commonly known as a His-tag) towards one end of the polypeptide.
(165) Polypeptides may also be produced synthetically.
(166) Vectors
(167) In additional embodiments, genetic constructs comprising one or more of the nucleic acids of the invention are introduced into cells in vivo such that a polypeptide of the invention is produced in vivo eliciting an immune response. The nucleic acid (e.g., DNA) may be present within any of a variety of delivery systems known to those of ordinary skill in the art, including nucleic acid expression systems, bacteria and some viral expression systems. Numerous gene delivery techniques are well known in the art, such as those described by Rolland, 1998, Crit. Rev. Therap. Drug Carrier Systems 15:143-198, and references cited therein. Several of these approaches are outlined below for the purpose of illustration.
(168) Accordingly, there is provided a vector (also referred to herein as a DNA expression construct' or construct) comprising a nucleic acid molecule of the invention.
(169) Suitably, the vector comprises nucleic acid encoding regulatory elements (such as a suitable promoter and terminating signal) suitable for permitting transcription of a translationally active RNA molecule in a human host cell. A translationally active RNA molecule is an RNA molecule capable of being translated into a protein by a human cell's translation apparatus.
(170) Accordingly, there is provided a vector comprising a nucleic acid of the invention (herein after a vector of the invention).
(171) In particular, the vector may be a viral vector. The viral vector may be an adenovirus, adeno-associated virus (AAV) (e.g., AAV type 5 and type 2), alphavirus (e.g., Venezuelan equine encephalitis virus (VEEV), Sindbis virus (SIN), Semliki Forest virus (SFV)), herpes virus, arenavirus (e.g., lymphocytic choriomeningitis virus (LCMV)), measles virus, poxvirus (such as modified vaccinia Ankara (MVA)), paramyxovirus, lentivirus, or rhabdovirus (such as vesicular stomatitis virus (VSV)) vector i.e. the vector may be derived from any of the aforementioned viruses. Adenoviruses are particularly suitable for use as a gene transfer vector because of its mid-sized genome, ease of manipulation, high titre, wide target-cell range and high infectivity. Both ends of the viral genome contain 100-200 base pair inverted repeats (ITRs), which are cis elements necessary for viral DNA replication and packaging. The early (E) and late (L) regions of the genome contain different transcription units that are divided by the onset of viral DNA replication. The E1 region (E1A and E1B) encodes proteins responsible for the regulation of transcription of the viral genome and a few cellular genes. The expression of the E2 region (E2A and E2B) results in the synthesis of the proteins for viral DNA replication. These proteins are involved in DNA replication, late gene expression and host cell shut-off (Renan, 1990). The products of the late genes, including the majority of the viral capsid proteins, are expressed only after significant processing of a single primary transcript issued by the major late promoter (MLP). The MLP is particularly efficient during the late phase of infection, and all the mRNAs trasncribed from this promoter possess a 5-tripartite leader (TPL) sequence which makes them preferred mRNAs for translation. Replication-deficient adenovirus, which are created by from viral genomes that are deleted for one or more of the early genes are particularly useful, since they have limited replication and less possibility of pathogenic spread within a vaccinated host and to contacts of the vaccinated host.
(172) Other Polynucleotide Delivery
(173) In certain embodiments of the invention, the expression construct comprising one or more polynucleotide sequences may simply consist of naked recombinant DNA plasmids. See Ulmer et al., 1993, Science 259:1745-1749 and reviewed by Cohen, 1993, Science 259:1691-1692. Transfer of the construct may be performed, for example, by any method which physically or chemically permeabilises the cell membrane. This is particularly applicable for transfer in vitro but it may be applied to in vivo use as well. It is envisioned that DNA encoding a gene of interest may also be transferred in a similar manner in vivo and express the gene product. Multiple delivery systems have been used to deliver DNA molecules into animal models and into man. Some products based on this technology have been licensed for use in animals, and others are in phase 2 and 3 clinical trials in man.
(174) RNA delivery
(175) In other embodiments of the invention, the expression construct comprising one or more polynucleotide sequences may consist of naked, recombinant DNA-derived RNA molecules (Ulmer et al., 2012, Vaccine 30:4414-4418). As for DNA-based expression constructs, a variety of methods can be utilized to introduce RNA molecules into cells in vitro or in vivo. The RNA-based constructs can be designed to mimic simple messenger RNA (mRNA) molecules, such that the introduced biological molecule is directly translated by the host cell's translation machinery to produce its encoded polypeptide in the cells to which it has been introduced. Alternatively, RNA molecules may be designed in a manner that allows them to self-amplify within cells they are introduced into, by incorporating into their structure genes for viral RNA-dependent RNA polymerases. Thus, these types of RNA molecules, known as self-amplifying mRNA (SAM) molecules (Geall et al. 2012, PNAS, 109:14604-14609), share properties with some RNA-based viral vectors. Either mRNA-based or SAM RNAs may be further modified (e.g., by alteration of their sequences, or by use of modified nucleotides) to enhance stability and translation (Schlake et al., RNA Biology, 9: 1319-1330), and both types of RNAs may be formulated (e.g., in emulsions (Brito et al., Molecular Therapy, 2014 22:2118-2129) or lipid nanoparticles (Kranz et al., 2006, Nature, 534:396-401)) to facilitate stability and/or entry into cells in vitro or in vivo. Myriad formulations of modified (and non-modified) RNAs have been tested as vaccines in animal models and in man, and multiple RNA-based vaccines are being used in ongoing clinical trials.
(176) Pharmaceutical Compositions
(177) The polypeptides, nucleic acids and vectors of the invention may be formulated for delivery in pharmaceutical compositions such as immunogenic compositions and vaccine compositions (all hereinafter compositions of the invention). Compositions of the invention suitably comprise a polypeptide, nucleic acid or vector of the invention together with a pharmaceutically acceptable carrier.
(178) Thus, in an embodiment, there is provided an immunogenic pharmaceutical composition comprising a polypeptide, nucleic acid or vector of the invention together with a pharmaceutically acceptable carrier.
(179) In another embodiment there is provided a vaccine composition comprising a polypeptide, nucleic acid or vector of the invention together with a pharmaceutically acceptable carrier. Preparation of pharmaceutical compositions is generally described in, for example, Powell & Newman, eds., Vaccine Design (the subunit and adjuvant approach), 1995. Compositions of the invention may also contain other compounds, which may be biologically active or inactive. Suitably, the composition of the invention is a sterile composition suitable for parenteral administration.
(180) In certain preferred embodiments of the present invention, pharmaceutical compositions of the invention are provided which comprise one or more (e.g., one) polypeptides of the invention in combination with a pharmaceutically acceptable carrier.
(181) In certain preferred embodiments of the present invention, compositions of the invention are provided which comprise one or more (e.g., one) nucleic acids of the invention or one or more (e.g., one) vectors of the invention in combination with a pharmaceutically acceptable carrier.
(182) In an embodiment, the compositions of the invention may comprise one or more (e.g., one) polynucleotide and one or more (e.g., one) polypeptide components. Alternatively, the compositions may comprise one or more (e.g., one) vector and one or more (e.g., one) polypeptide components. Alternatively, the compositions may comprise one or more (e.g., one) vector and one or more (e.g., one) polynucleotide components. Such compositions may provide for an enhanced immune response.
(183) Pharmaceutically Acceptable Salts
(184) It will be apparent that a composition of the invention may contain pharmaceutically acceptable salts of the nucleic acids or polypeptides provided herein. Such salts may be prepared from pharmaceutically acceptable non-toxic bases, including organic bases (e.g., salts of primary, secondary and tertiary amines and basic amino acids) and inorganic bases (e.g., sodium, potassium, lithium, ammonium, calcium and magnesium salts).
(185) Pharmaceutically Acceptable Carriers
(186) While many pharmaceutically acceptable carriers known to those of ordinary skill in the art may be employed in the compositions of the invention, the optimal type of carrier used will vary depending on the mode of administration. Compositions of the present invention may be formulated for any appropriate manner of administration, including for example, parenteral, topical, oral, nasal, intravenous, intracranial, intraperitoneal, subcutaneous or intramuscular administration, preferably parenteral e.g., intramuscular, subcutaneous or intravenous administration. For parenteral administration, the carrier preferably comprises water and may contain buffers for pH control, stabilising agents e.g., surfactants and amino acids and tonicity modifying agents e.g., salts and sugars. If the composition is intended to be provided in lyophilised form for dilution at the point of use, the formulation may contain a lyoprotectant e.g., sugars such as trehalose. For oral administration, any of the above carriers or a solid carrier, such as mannitol, lactose, starch, magnesium stearate, sodium saccharine, talcum, cellulose, glucose, sucrose, and magnesium carbonate, may be employed.
(187) Thus, compositions of the invention may comprise buffers (e.g., neutral buffered saline or phosphate buffered saline), carbohydrates (e.g., glucose, mannose, sucrose or dextrans), mannitol, proteins, polypeptides or amino acids such as glycine, antioxidants, bacteriostats, chelating agents such as EDTA or glutathione, solutes that render the formulation isotonic, hypotonic or weakly hypertonic with the blood of a recipient, suspending agents, thickening agents and/or preservatives. Alternatively, compositions of the invention may be formulated as a lyophilizate.
(188) Immunostimulants
(189) Compositions of the invention may also comprise one or more immunostimulants. An immunostimulant may be any substance that enhances or potentiates an immune response (antibody and/or cell-mediated) to an exogenous antigen. Examples of immunostimulants, which are often referred to as adjuvants in the context of vaccine formulations, include aluminium salts such as aluminium hydroxide gel (alum) or aluminium phosphate, saponins including QS21, immunostimulatory oligonucleotides such as CPG, oil-in-water emulsion (e.g., where the oil is squalene), aminoalkyl glucosaminide 4-phosphates, lipopolysaccharide or a derivative thereof e.g., 3-de-O-acylated monophosphoryl lipid A (3D-MPL) and other TLR4 ligands, TLR7 ligands, TLR8 ligands, TLR9 ligands, IL-12 and interferons. Thus, suitably the one or more immunostimulants of the composition of the invention are selected from aluminium salts, saponins, immunostimulatory oligonucleotides, oil-in-water emulsions, aminoalkyl glucosaminide 4-phosphates, lipopolysaccharides and derivatives thereof and other TLR4 ligands, TLR7 ligands, TLR8 ligands and TLR9 ligands. Immunostimulants may also include monoclonal antibodies which specifically interact with other immune components, for example monoclonal antibodies that block the interaction of immune checkpoint receptors, including PD-1 and CTLA4.
(190) In the case of recombinant-nucleic acid methods of delivery (e.g., DNA, RNA, viral vectors), the genes encoding protein-based immunostimulants may be readily delivered along with the genes encoding the polypeptides of the invention.
(191) Sustained Release
(192) The compositions described herein may be administered as part of a sustained-release formulation (i.e., a formulation such as a capsule, sponge, patch or gel (composed of polysaccharides, for example)) that effects a slow/sustained release of compound following administration.
(193) Storage and Packaging
(194) Compositions of the invention may be presented in unit-dose or multi-dose containers, such as sealed ampoules or vials. Such containers are preferably hermetically sealed to preserve sterility of the formulation until use. In general, formulations may be stored as suspensions, solutions or emulsions in oily or aqueous vehicles. Alternatively, a composition of the invention may be stored in a freeze-dried condition requiring only the addition of a sterile liquid carrier (such as water or saline for injection) immediately prior to use.
(195) Dosage
(196) The amount of nucleic acid, polypeptide or vector in each composition of the invention may be prepared is such a way that a suitable dosage for therapeutic or prophylactic use will be obtained. Factors such as solubility, bioavailability, biological half-life, route of administration, product shelf life, as well as other pharmacological considerations will be contemplated by one skilled in the art of preparing such compositions, and as such, a variety of dosages and treatment regimens may be desirable.
(197) Typically, compositions comprising a therapeutically or prophylactically effective amount deliver about 0.1 ug to about 1000 ug of polypeptide of the invention per administration, more typically about 2.5 ug to about 100 ug of polypeptide per administration. If delivered in the form of short, synthetic long peptides, doses could range from 1 to 200ug/peptide/dose. In respect of polynucleotide compositions, these typically deliver about 10 ug to about 20 mg of the nucleic acid of the invention per administration, more typically about 0.1 mg to about 10 mg of the nucleic acid of the invention per administration.
(198) Diseases to be Treated or Prevented
(199) As noted elsewhere, SEQ ID NOs. 1-10 are polypeptide sequences corresponding to CLT antigens which are over-expressed in cutaneous melanoma.
(200) In one embodiment, the invention provides a polypeptide, nucleic acid, vector or composition of the invention for use in medicine.
(201) Further aspects of the invention relate to a method of raising an immune response in a human which comprises administering to said human the polypeptide, nucleic acid, vector or composition of the invention.
(202) The present invention also provides a polypeptide, nucleic acid, vector or composition of the invention for use in raising an immune response in a human.
(203) There is also provided a use of a polypeptide, nucleic acid, vector or composition of the invention for the manufacture of a medicament for use in raising an immune response in a human.
(204) Suitably the immune response is raised against a cancerous tumor expressing a corresponding sequence selected from SEQ ID NOs. 1-10 and variants and immunogenic fragments of any one thereof. By corresponding in this context is meant that if the tumor expresses, say, SEQ ID NO. A (A being one of SEQ ID NOs. 1-10) or a variant or immunogenic fragment thereof then the polypeptide, nucleic acid, vector or composition of the invention and medicaments involving these will be based on SEQ ID NO. A or a variant or immunogenic fragment thereof.
(205) Suitably the immune response comprises CD8+ T-cell, a CD4+ T-cell and/or an antibody response, particularly CD8+ cytolytic T-cell response and a CD4+ helper T-cell response.
(206) Suitably the immune response is raised against a tumor, particularly one expressing a sequence selected from SEQ ID NOs. 1-10 and variants thereof and immunogenic fragments thereof.
(207) In a preferred embodiment, the tumor is a melanoma tumor e.g. a cutaneous melanoma tumor.
(208) The tumor may be a primary tumor or a metastatic tumor. Further aspects of the invention relate to a method of treating a human patient suffering from cancer wherein the cells of the cancer express a sequence selected from SEQ ID NOs. 1-10 and immunogenic fragments and variants of any one thereof, or of preventing a human from suffering from cancer which cancer would express a sequence selected from SEQ ID NOs. 1-10 and immunogenic fragments and variants of any one thereof, which method comprises administering to said human a corresponding polypeptide, nucleic acid, vector or composition of the invention.
(209) The present invention also provides a polypeptide, nucleic acid, vector or composition of the invention for use in treating or preventing cancer in a human, wherein the cells of the cancer express a corresponding sequence selected from SEQ ID NOs. 1-10 and immunogenic fragments of any one thereof.
(210) Transcripts corresponding to SEQ ID NOs. 33, 35, 36 and 40 were also overexpressed in uveal melanoma. Consequently, in an alternative embodiment, the tumor is a uveal melanoma tumor and/or the tumor expresses a sequence selected from SEQ ID NOs. 1, 3, 4, 5 and 10.
(211) Thus, the invention provides a method or a polypeptide, nucleic acid, vector or composition for use according to the invention wherein the polypeptide comprises a sequence selected from: (a) the sequence of any one of SEQ ID NOs. 1, 3, 4, 5 and 10; and (b) a variant of the sequences of (a); and (c) an immunogenic fragment of the sequences of (a). and for example the polypeptide comprises or consists of a sequence selected from any one of SEQ ID NOs. 11-14, 17-18, 19, 20-22, 30-32, 51-57, 67-74 and 76-77 and for example the nucleic acid comprises or consists of a sequence selected from any one of SEQ ID NOs. 33, 35, 36 or 40 or selected from any one of 41, 43, 44, 45 and 50; and wherein the cancer is uveal melanoma.
(212) The words prevention and prophylaxis are used interchangeably herein.
(213) Treatment and Vaccination Regimes
(214) A therapeutic regimen may involve either simultaneous (such as co-administration) or sequential (such as a prime-boost) delivery of (i) a polypeptide, nucleic acid or vector of the invention with (ii) one or more further polypeptides, nucleic acids or vectors of the invention and/or (iii) a further component such as a variety of other therapeutically useful compounds or molecules such as antigenic proteins optionally simultaneously administered with adjuvant. Examples of co-administration include homo-lateral co-administration and contra-lateral co-administration. Simultaneous administration suitably refers to all components being delivered during the same round of treatment. Suitably all components are administered at the same time (such as simultaneous administration of both DNA and protein), however, one component could be administered within a few minutes (for example, at the same medical appointment or doctor's visit) or within a few hours.
(215) In some embodiments, a priming or first administration of a polypeptide, nucleic acid or vector of the invention, is followed by one or more boosting or subsequent administrations of a polypeptide, nucleic acid or vector of the invention (prime and boost method). In one embodiment the polypeptide, nucleic acid or vector of the invention is used in a prime-boost vaccination regimen. In an embodiment both the prime and boost are of a polypeptide of the invention, the same polypeptide of the invention in each case. In an embodiment both the prime and boost are of a nucleic acid or vector of the invention, the same nucleic acid or vector of the invention in each case. Alternatively, the prime may be performed using a nucleic acid or vector of the invention and the boost performed using a polypeptide of the invention or the prime may be performed using a polypeptide of the invention and the boost performed using a nucleic acid or vector of the invention. Usually the first or priming administration and the second or boosting administration are given about 1-12 weeks later, or up to 4-6 months later. Subsequent booster administrations may be given as frequently as every 1-6 weeks or may be given much later (up to years later).
(216) Antigen Combinations
(217) The polypeptides, nucleic acids or vectors of the invention can be used in combination with one or more other polypeptides or nucleic acids, vectors of the invention and/or with other antigenic polypeptides (or polynucleotides or vectors encoding them) which cause an immune response to be raised against melanoma e.g. cutaneous or uveal melanoma. These other antigenic polypeptides could be derived from diverse sources, they could include well-described melanoma-associated antigens, such as GPR143, PRAME, MAGE-A3 or pMel (gp100). Alternatively they could include other types of melanoma antigens, including patient-specific neoantigens (Lauss et al. (2017). Nature Communications, 8(1), 1738. http://doi.org/10.1038/s41467-017-01460-0), retained-intron neoantigens (Smart et al. (2018). Nature Biotechnology. http://doi.org/10.1038/nbt.4239), spliced variant neoantigens (Hoyos et al., Cancer Cell, 34(2), 181-183. http://doi.org/10.1016/j.cell.2018.07.008; Kahles et al. (2018). Cancer Cell, 34(2), 211-224. e6. http://doi.org/10.1016/j.ccell.2018.07.001), melanoma antigens that fit within the category known as antigens encoding T-cell epitopes associated with impaired peptide processing (TIEPPs; Gigoux, M., & Wolchok, J. (2018). JEM, 215, 2233, Marijt et al. (2018). JEM 215, 2325), or to-be discovered neoantigens (including CLT antigens). In addition, the antigenic peptides from these various sources could also be combined with (i) non-specific immunostimulant/adjuvant species and/or (ii) an antigen, e.g. comprising universal CD4 helper epitopes, known to elicit strong CD4 helper T-cells (delivered as a polypeptides, or as polynucleotides or vectors encoding these CD4 antigens), to amplify the anti-melanoma-specific responses elicited by co-administered antigens.
(218) Different polypeptides, nucleic acids or vectors may be formulated in the same formulation or in separate formulations. Alternatively, polypeptides may be provided as fusion proteins in which a polypeptide of the invention is fused to a second or further polypeptide (see below).
(219) Nucleic acids may be provided which encode the aforementioned fusion proteins.
(220) More generally, when two or more components are utilised in combination, the components could be presented, for example: (1) as two or more individual antigenic polypeptide components; (2) as a fusion protein comprising both (or further) polypeptide components; (3) as one or more polypeptide and one or more polynucleotide component; (4) as two or more individual polynucleotide components; (5) as a single polynucleotide encoding two or more individual polypeptide components; or (6) as a single polynucleotide encoding a fusion protein comprising both (or further) polypeptide components.
(221) For convenience, it is often desirable that when a number of components are present they are contained within a single fusion protein or a polynucleotide encoding a single fusion protein (see below). In one embodiment of the invention all components are provided as polypeptides (e.g., within a single fusion protein). In an alternative embodiment of the invention all components are provided as polynucleotides (e.g., a single polynucleotide, such as one encoding a single fusion protein).
(222) Fusion Proteins (Fusion Polypeptides)
(223) As an embodiment of the above discussion of antigen combinations, the invention also provides an isolated polypeptide according to the invention fused to a second or further polypeptide of the invention (herein after a combination polypeptide of the invention), by creating nucleic acid constructs that fuse together the sequences encoding the individual antigens. Combination polypeptides of the invention are expected to have the utilities described herein for polypeptides of the invention, and may have the advantage of superior immunogenic or vaccine activity or prophylactic or therapeutic effect (including increasing the breadth and depth of responses), and may be especially valuable in an outbred population. Fusions of polypeptides of the invention may also provide the benefit of increasing the efficiency of construction and manufacture of vaccine antigens and/or vectored vaccines (including nucleic acid vaccines).
(224) As described above in the Antigen Combinations section, polypeptides of the invention and combination polypeptides of the invention may also be fused to polypeptide sequences which are not polypeptides of the invention, including one or more of: (a) other polypeptides which are melanoma associated antigens and thus potentially useful as immunogenic sequences in a vaccine (e.g., GPR143, PRAME, MAGE-A3 and pMel (gp100) referred to supra); and (b) polypeptide sequences which are capable of enhancing an immune response (i.e. immunostimulant sequences). (c) Polypeptide sequences, e.g. comprising universal CD4 helper epitopes, which are capable of providing strong CD4+ help to increase CD8+ T-cell responses to CLT antigen epitopes.
(225) Exemplary fusion polypeptides comprises two or more (e.g. two, three or four) sequences selected from the sequences of SEQ ID NOs. 1, 2, 3 and 4; or, in respect of each of the said sequences, a variant of the sequence or an immunogenic fragment of the sequence.
(226) An exemplary fusion polypeptide comprises: (i) a sequence selected from: (a) the sequence of SEQ ID NO. 1; and (b) a variant of the sequence of (a); and (c) an immunogenic fragment of the sequence of (a) e.g. selected from SEQ ID NOs. 11-14, 55-57 and 73-74; and (ii) a sequence selected from: (a) the sequence of SEQ ID NO. 2; and (b) a variant of the sequence of (a); and (c) an immunogenic fragment of the sequence of (a) e.g. selected from SEQ ID NOs. 15-16, 58-66, 75 and 78; and (iii) a sequence selected from: (a) the sequence of SEQ ID NO. 3; and (b) a variant of the sequence of (a); and (c) an immunogenic fragment of the sequence of (a) e.g. selected from SEQ ID NOs. 17-18, 53 and 67-69; and (iv) a sequence selected from: (a) the sequence of SEQ ID NO. 4; and (b) a variant of the sequence of (a); and (c) an immunogenic fragment of the sequence of (a) e.g. selected from SEQ ID NOs. 19, 51-52, 54, 70-72 and 76-77.
(227) For example the fusion polypeptide comprises the sequences of SEQ ID NOs. 1, 2, 3 and 4.
(228) Another exemplary fusion polypeptide comprises: (i) a sequence selected from: (a) the sequence of SEQ ID NO. 1; and (b) a variant of the sequence of (a); and (c) an immunogenic fragment of the sequence of (a) e.g. selected from SEQ ID NOs. 11-14, 55-57 and 73-74; and (ii) a sequence selected from: (a) the sequence of SEQ ID NO. 2; and (b) a variant of the sequence of (a); and (c) an immunogenic fragment of the sequence of (a) e.g. selected from SEQ ID NOs. 15-16, 58-66, 75 and 78; and (iii) a sequence selected from: (a) the sequence of SEQ ID NO. 4; and (b) a variant of the sequence of (a); and (c) an immunogenic fragment of the sequence of (a) e.g. selected from SEQ ID NOs. 19, 51-52, 54, 70-72 and 76-77.
(229) For example the fusion polypeptide comprises the sequences of SEQ ID NOs. 1, 2 and 4.
(230) The invention also provides nucleic acids encoding the aforementioned fusion polypeptides and other aspects of the invention (vectors, compositions, cells etc) mutatis mutandis as for the polypeptides of the invention.
(231) CLT Antigen-binding Polypeptides
(232) Antigen-binding polypeptides which are immunospecific for tumor-expressed antigens (polypeptides of the invention) may be designed to recruit cytolytic cells to antigen-decorated tumor cells, mediating their destruction. One such mechanism of recruitment of cytolytic cells by antigen-binding polypeptides is known as antibody-dependent cell-mediated cytotoxicity (ADCC). Thus the invention provides an antigen-binding polypeptide which is immunospecific for a polypeptide of the invention. Antigen-binding polypeptides including antibodies such as monoclonal antibodies and fragments thereof e.g., domain antibodies, Fab fragments, Fv fragments, and VHH fragments which may produced in a non-human animal species (e.g., rodent or camelid) and humanised or may be produced in a non-human species (e.g., rodent genetically modified to have a human immune system).
(233) Antigen-binding polypeptides may be produced by methods well known to a skilled person. For example, monoclonal antibodies can be produced using hybridoma technology, by fusing a specific antibody-producing B cell with a myeloma (B cell cancer) cell that is selected for its ability to grow in tissue culture and for an absence of antibody chain synthesis (Khler and Milstein, 1975, Nature 256(5517): 495-497 and Nelson et al., 2000 (Jun), Mol Pathol. 53(3):111-7 herein incorporated by reference in their entirety).
(234) A monoclonal antibody directed against a determined antigen can, for example, be obtained by: a) immortalizing lymphocytes obtained from the peripheral blood of an animal (including a human) previously immunized/exposed with a determined antigen, with an immortal cell and preferably with myeloma cells, in order to form a hybridoma, b) culturing the immortalized cells (hybridoma) formed and recovering the cells producing the antibodies having the desired specificity.
(235) Monoclonal antibodies can be obtained by a process comprising the steps of: a) cloning into vectors, especially into phages and more particularly filamentous bacteriophages, DNA or cDNA sequences obtained from lymphocytes especially peripheral blood lymphocytes of an animal (suitably previously immunized with determined antigens), b) transforming prokaryotic cells with the above vectors in conditions allowing the production of the antibodies, c) selecting the antibodies by subjecting them to antigen-affinity selection, d) recovering the antibodies having the desired specificity e) expressing antibody-encoding nucleic acid molecules obtained from B cells of patients exposed to antigens, or animals experimentally immunized with antigens.
(236) The selected antibodies may then be produced using conventional recombinant protein production technology (e.g., from genetically engineered CHO cells).
(237) The invention provides an isolated antigen-binding polypeptide which is immunospecific for a polypeptide of the invention. Suitably, the antigen-binding polypeptide is a monoclonal antibody or a fragment thereof.
(238) In certain embodiments, the antigen-binding polypeptide is coupled to a cytotoxic moiety. Example cytotoxic moieties include the Fc domain of an antibody, which will recruit Fc receptor-bearing cells facilitating ADCC. Alternatively, the antigen-binding polypeptide may be linked to a biological toxin, or a cytotoxic chemical.
(239) Another important class of antigen-binding polypeptides include T-cell receptor (TCR)-derived molecules that bind to HLA-displayed fragments of the antigens of this invention. In this embodiment, TCR-based biologicals (including TCRs derived directly from patients, or specifically manipulated, high-affinity TCRs) that recognize CLT antigens (or derivatives thereof) on the surface of tumor cells may also include a targeting moiety which recognizes a component on a T-cell (or another class of immune cell) that attract these immune cells to tumors, providing therapeutic benefit. In some embodiments, the targeting moiety may also stimulate beneficial activities (including cytolytic activities) of the redirected immune cells.
(240) Thus, in an embodiment, the antigen-binding polypeptide is immunospecific for an HLA-bound polypeptide that is or is part of a polypeptide of the invention. For example, the antigen-binding polypeptide is a T-cell receptor.
(241) In an embodiment, an antigen-binding polypeptide of the invention may be coupled to another polypeptide that is capable of binding to cytotoxic cells or other immune components in a subject.
(242) In an embodiment, the antigen-binding polypeptide is for use in medicine.
(243) In an embodiment, there is provided a pharmaceutical composition comprising an antigen-binding polypeptide of the invention together with a pharmaceutically acceptable carrier. Such a composition may be a sterile composition suitable for parenteral administration. See e.g., disclosure of pharmaceutical compositions supra.
(244) There is provided by the invention a method of treating a human suffering from cancer wherein the cells of the cancer express a sequence selected from SEQ ID NOs. 1-10 and immunogenic fragments and variants of any one thereof, or of preventing a human from suffering from cancer wherein the cells of the cancer would express a sequence selected from SEQ ID NOs. 1-10 and immunogenic fragments and variants of any one thereof, which comprises administering to said human an antigen-binding polypeptide or composition comprising said antigen-binding polypeptide of the invention.
(245) In an embodiment, there is provided an antigen-binding polypeptide of the invention, which may be coupled to a cytotoxic moiety, or composition comprising said antigen-binding polypeptide of the invention for use in treating or preventing cancer in a human, wherein the cells of the cancer express a corresponding sequence selected from SEQ ID NOs. 1-10 and immunogenic fragments of any one thereof.
(246) Suitably in any of the above embodiments, the cancer is melanoma particularly cutaneous melanoma.
(247) In an embodiment, there is provided a method or an antigen-binding polypeptide or composition for use according to the invention wherein the polypeptide comprises a sequence selected from: (a) the sequence of any one of SEQ ID NOs. 1, 3, 4, 5 and 10; and (b) a variant of the sequences of (a); and (c) an immunogenic fragment of the sequences of (a). and for example the polypeptide comprises or consists of a sequence selected from any one of SEQ ID NOs. 11-14, 17-18, 19, 20-22, 30-32, 51-57, 67-74 and 76-77 and for example the nucleic acid comprises or consists of a sequence selected from any one of SEQ ID NOs. 33, 35, 36 or 40 or selected from any one of 41, 43, 44, 45 and 50; and wherein the cancer is uveal melanoma.
(248) Antigen-binding polypeptides (such as antibodies or fragments thereof may be administered at a dose of e.g. 5-1000 mg e.g. 25-500 mg e.g. 100-300 mg e.g. ca. 200 mg.
(249) Cell Therapies to Facilitate Antigen Presentation In Vivo
(250) Any of a variety of cellular delivery vehicles may be employed within pharmaceutical compositions to facilitate production of an antigen-specific immune response. Thus the invention provides a cell which is an isolated antigen presenting cell modified by ex vivo loading with a polypeptide of the invention or genetically engineered to express the polypeptide of the invention (herein after referred to as a APC of the invention). Antigen presenting cells (APCs), such as dendritic cells, macrophages, B cells, monocytes and other cells that may be engineered to be efficient APCs. Such cells may, but need not, be genetically modified to increase the capacity for presenting the antigen, to improve activation and/or maintenance of the T-cell response and/or to be immunologically compatible with the receiver (i.e., matched HLA haplotype). APCs may generally be isolated from any of a variety of biological fluids and organs, and may be autologous, allogeneic, syngeneic or xenogeneic cells.
(251) Certain preferred embodiments of the present invention use dendritic cells or progenitors thereof as APCs. Thus, in an embodiment, the APC of the invention is a dendritic cell. Dendritic cells are highly potent APCs (Banchereau & Steinman, 1998, Nature, 392:245-251) and have been shown to be effective as a physiological adjuvant for eliciting prophylactic or therapeutic immunity (see Timmerman & Levy, 1999, Ann. Rev. Med. 50:507-529). In general, dendritic cells may be identified based on their typical shape (stellate in situ, with marked cytoplasmic processes (dendrites) visible in vitro), their ability to take up, process and present antigens with high efficiency and their ability to activate nave T-cell responses. Dendritic cells may, of course be engineered to express specific cell-surface receptors or ligands that are not commonly found on dendritic cells in vivo or ex vivo, and such modified dendritic cells are contemplated by the present invention. As an alternative to dendritic cells, antigen-loaded secreted vesicles (called exosomes) may be used within an immunogenic composition (see Zitvogel et al., 1998, Nature Med. 4:594-600). Thus, in an embodiment, there is provided an exosome loaded with a polypeptide of the invention.
(252) Dendritic cells and progenitors may be obtained from peripheral blood, bone marrow, lymph nodes, spleen, skin, umbilical cord blood or any other suitable tissue or fluid. For example, dendritic cells may be differentiated ex vivo by adding a combination of cytokines such as GM-CSF, IL-4, IL-13 and/or TNF to cultures of monocytes harvested from peripheral blood. Alternatively, CD34-positive cells harvested from peripheral blood, umbilical cord blood or bone marrow may be differentiated into dendritic cells by adding to the culture medium combinations of GM-CSF, IL-3, TNF, CD40 ligand, LPS, flt3 ligand and/or other compound(s) that induce differentiation, maturation and proliferation of dendritic cells.
(253) Dendritic cells are conveniently categorised as immature and mature cells, which allows a simple way to discriminate between two well-characterised phenotypes. However, this nomenclature should not be construed to exclude all possible intermediate stages of differentiation. Immature dendritic cells are characterised as APCs with a high capacity for antigen uptake and processing, which correlates with the high expression of Fc receptor and mannose receptor. The mature phenotype is typically characterized by a lower expression of these markers, but a high expression of cell surface molecules responsible for T-cell activation such as class I and class II MHC, adhesion molecules (e.g., CD54 and CD11) and costimulatory molecules (e.g., CD40, CD80, CD86 and 4-1 BB).
(254) APCs may also be genetically engineered e.g., transfected with a polynucleotide encoding a protein (or portion or other variant thereof) such that the polypeptide is expressed on the cell surface. Such transfection may take place ex vivo, and a pharmaceutical composition comprising such transfected cells may then be used, as described herein. Alternatively, a gene delivery vehicle that targets a dendritic or other antigen presenting cell may be administered to a patient, resulting in transfection that occurs in vivo. In vivo and ex vivo transfection of dendritic cells, for example, may generally be performed using any methods known in the art, such as those described in WO 97/24447, or the gene gun approach described by Mahvi et al., 1997, Immunology and Cell Biology 75:456-460. Antigen loading of dendritic cells may be achieved by incubating dendritic cells or progenitor cells with the polypeptide, DNA (e.g., a plasmid vector) or RNA; or with antigen-expressing recombinant bacteria or viruses (e.g., an adenovirus, adeno-associated virus (AAV) (e.g., AAV type 5 and type 2), alphavirus (e.g., Venezuelan equine encephalitis virus (VEEV), Sindbis virus (SIN), Semliki Forest virus (SFV), herpes virus, arenavirus (e.g., lymphocytic choriomeningitis virus (LCMV)), measles virus, poxvirus (such as modified vaccinia Ankara (MVA) or fowlpox), paramyxovirus, lentivirus, or rhabdovirus (such as vesicular stomatitis virus (VSV)). Prior to polypeptide loading, the polypeptides may be covalently conjugated to an immunological partner that provides T-cell help (e.g., a carrier molecule). Alternatively, a dendritic cell may be pulsed with a non-conjugated immunological partner, separately or in the presence of the polypeptide or vector.
(255) The invention provides for delivery of specifically designed short, chemically synthesized epitope-encoded fragments of polypeptide antigens to antigen presenting cells. Those skilled in the art will realize that these types of molecules, also known as synthetic long peptides (SLPs) provide a therapeutic platform for using the antigenic polypeptides of this invention to stimulate (or load) cells in vitro (Gornati et al., 2018, Front. Imm, 9:1484), or as a method of introducing polypeptide antigen into antigen-presenting cells in vivo (Melief & van der Burg, 2008, Nat Rev Cancer, 8:351-60).
(256) In an embodiment, there is provided a pharmaceutical composition comprising an antigen-presenting cell of the invention, which is suitably a dendritic cell, together with a pharmaceutically acceptable carrier. Such a composition may be a sterile composition suitable for parenteral administration. See e.g., disclosure of pharmaceutical compositions supra.
(257) In an embodiment, there is provided an antigen-presenting cell of the invention, which is suitably a dendritic cell, for use in medicine.
(258) There is also provided a method of treating a human suffering from cancer wherein the cells of the cancer express a sequence selected from SEQ ID NOs. 1-10 and immunogenic fragments and variants of any one thereof, or of preventing a human from suffering from cancer wherein the cells of the cancer would express a sequence selected from SEQ ID NOs. 1-10 and immunogenic fragments and variants of any one thereof, which comprises administering to said human said antigen presenting cell of the invention, which is suitably a dendritic cell, or composition comprising said antigen presenting cell of the invention.
(259) In an embodiment, there is provided an antigen presenting cell of the invention, which is suitably a dendritic cell, or composition comprising said antigen presenting cell of the invention for use in treating or preventing cancer in a human, wherein the cells of the cancer express a corresponding sequence selected from SEQ ID NOs. 1-10 and immunogenic fragments of any one thereof.
(260) In an embodiment, there is provided a pharmaceutical composition comprising an exosome of the invention together with a pharmaceutically acceptable carrier. Such a composition may be a sterile composition suitable for parenteral administration. See e.g., disclosure of pharmaceutical compositions supra. Compositions may optionally comprise immunostimulantssee disclosure of immunostimulants supra.
(261) In an embodiment, there is provided an exosome of the invention for use in medicine.
(262) There is also provided a method of treating a human suffering from cancer wherein the cells of the cancer express a sequence selected from SEQ ID NOs. 1-10 and immunogenic fragments and variants of any one thereof, or of preventing a human from suffering from cancer wherein the cells of the cancer would express a sequence selected from SEQ ID NOs. 1-10 and immunogenic fragments and variants of any one thereof, which comprises administering to said human said exosome if the invention or composition comprising said exosome of the invention.
(263) In an embodiment, there is provided an exosome of the invention or composition comprising said exosome of the invention for use in treating or preventing cancer in a human, wherein the cells of the cancer express a corresponding sequence selected from SEQ ID NOs. 1-10 and immunogenic fragments of any one thereof. In any one of the above embodiments, suitably the cancer is melanoma particularly cutaneous melanoma.
(264) Stimulated T-cell Therapies
(265) In addition to in vivo or ex vivo APC-mediated production of T-cells immunospecific for polypeptides of the invention, autologous or non-autologous T-cells may be isolated from a subject, e.g., from peripheral blood, umbilical cord blood and/or by apheresis, and stimulated in the presence of a tumor-associated antigens which are loaded onto MHC molecules (signal 1) of APC cells, to induce proliferation of T-cells with a TCR immunospecific for this antigen.
(266) Successful T-cell activation requires the binding of the costimulatory surface molecules B7 and CD28 on antigen-presenting cells and T-cells, respectively (signal 2). To achieve optimal T-cell activation, both signals 1 and 2 are required. Conversely, antigenic peptide stimulation (signal 1) in the absence of costimulation (signal 2) cannot induce full T-cell activation, and may result in T-cell tolerance. In addition to costimulatory molecules, there are also inhibitory molecules, such as CTLA-4 and PD-1, which induce signals to prevent T-cell activation.
(267) Autologous or non-autologous T-cells may therefore be stimulated in the presence of a polypeptide of the invention, and expanded and transferred back to the patient at risk of or suffering from cancer whose cancer cells express a corresponding polypeptide of the invention provided that the antigen-specific TCRs will recognize the antigen presented by the patient's MHC, where they will target and induce the killing of cells of said cancer which express said corresponding polypeptide.
(268) In an embodiment, there is provided a polypeptide, nucleic acid, vector or composition of the invention for use in the ex vivo stimulation and/or amplification of T-cells derived from a human suffering from cancer, for subsequent reintroduction of said stimulated and/or amplified T-cells into the said human for the treatment of the said cancer in the said human.
(269) The invention provides a method of treatment of cancer in a human, wherein the cells of the cancer express a sequence selected from SEQ ID NOs. 1-10 and immunogenic fragments and variants of any one thereof, which comprises taking from said human a population of white blood cells comprising at least T-cells optionally with antigen-presenting cells, stimulating and/or amplifying said T-cells in the presence of a corresponding polypeptide, nucleic acid, vector or composition of the invention, and reintroducing some or all of said white blood cells comprising at least stimulated and/or amplified T-cells into the human.
(270) In any one of the above embodiments, suitably the cancer is melanoma particularly cutaneous melanoma.
(271) In an embodiment, there is provided a process for preparing a T-cell population which is cytotoxic for cancer cells which express a sequence selected from SEQ ID NOs. 1-10 and immunogenic fragments and variants of any one thereof which comprises (a) obtaining T-cells and antigen-presenting cells from a cancer patient and (ii) stimulating and amplifying the T-cell population ex vivo with a corresponding polypeptide, nucleic acid, vector or composition of the invention.
(272) By corresponding in this context is meant that if the cancer cells express, say, SEQ ID NO. A (A being one of SEQ ID NOs. 1-10) or a variant or immunogenic fragment thereof then the T-cell population is stimulated and amplified ex vivo with SEQ ID NO. A or a variant or immunogenic fragment thereof in the form of a polypeptide, nucleic acid or vector, or a composition containing one of the foregoing.
(273) For example, in such processes, the culturing and expanding is performed in the presence of dendritic cells. The dendritic cells may be transfected with a nucleic acid molecule or with a vector of the invention and express a polypeptide of the invention.
(274) The invention provides a T-cell population obtainable by any of the aforementioned processes (hereinafter a T-cell population of the invention).
(275) In an embodiment, there is provided a cell which is a T-cell which has been stimulated with a polypeptide, nucleic acid, vector or composition of the invention (hereinafter a T-cell of the invention).
(276) In an embodiment, there is provided a pharmaceutical composition comprising a T-cell population or a T-cell of the invention together with a pharmaceutically acceptable carrier. Such a composition may, for example, be a sterile composition suitable for parenteral administration.
(277) In an embodiment, there is provided a T-cell population or T-cell of the invention for use in medicine.
(278) There is also provided a method of treating a human suffering from cancer wherein the cells of the cancer express a sequence selected from SEQ ID NOs. 1-10 and immunogenic fragments and variants of any one thereof, or of preventing a human from suffering from cancer wherein the cells of the cancer would express a sequence selected from SEQ ID NOs. 1-10 and immunogenic fragments and variants of any one thereof, which comprises administering to said human said T-cell population or T-cell of the invention or composition comprising said T-cell population or T-cell of the invention.
(279) In an embodiment, there is provided a T-cell population of the invention, T-cell of the invention or composition comprising said T-cell population or T-cell of the invention for use in treating or preventing cancer in a human, wherein the cells of the cancer express a corresponding sequence selected from SEQ ID NOs. 1-10 and immunogenic fragments of any one thereof. In any one of the above embodiments, suitably the cancer is melanoma particularly cutaneous melanoma.
(280) In an embodiment, there is provided a process, a method or a T-cell population, T-cell, antigen presenting cell, exosome or composition for use according to the invention wherein the polypeptide comprises a sequence selected from: (a) the sequence of any one of SEQ ID NOs. 1, 3, 4, 5 and 10; and (b) a variant of the sequences of (a); and (c) an immunogenic fragment of the sequences of (a). and for example the polypeptide comprises or consists of a sequence selected from any one of SEQ ID NOs. 11-14, 17-18, 19, 20-22, 30-32, 51-57, 67-74 and 76-77 and for example the nucleic acid comprises or consists of a sequence selected from any one of SEQ ID NOs. 33, 35, 36 or 40 or selected from any one of 41, 43, 44, 45 and 50; and wherein the cancer is uveal melanoma.
Engineered Immune Cell Therapies
(281) Derivatives of all types of CLT antigen-binding polypeptides described above, including TCRs or TCR mimetics (see Dubrovsky et al., 2016, Oncoimmunology) that recognize CLT antigen-derived peptides complexed to human HLA molecules, may be engineered to be expressed on the surface of T-cells (autologous or non-autologous), which can then be administered as adoptive T-cell therapies to treat cancer.
(282) These derivatives fit within the category of chimeric antigen receptors (CARs), which, as used herein, may refer to artificial T-cell receptors, chimeric T-cell receptors, or chimeric immunoreceptors, for example, and encompass engineered receptors that graft an artificial specificity onto a particular immune effector cell. CARs may be employed to impart the specificity of a monoclonal antibody onto a T-cell, thereby allowing a large number of specific T-cells to be generated, for example, for use in adoptive cell therapy. CARs may direct specificity of the cell to a tumor associated antigen, a polypeptide of the invention, wherein the polypeptide is HLA-bound.
(283) Another approach to treating cancer in a patient is to genetically modify T-cells to target antigens expressed on tumor cells, via the expression of chimeric antigen receptors (CARs). This technology is reviewed in Wendell & June, 2017, Cell, 168: 724-740 (incorporated by reference in its entirety).
(284) Such CAR T-cells may be produced by the method of obtaining a sample of cells from the subject, e.g., from peripheral blood, umbilical cord blood and/or by apheresis, wherein said sample comprises T-cells or T-cell progenitors, and transfecting said cells with a nucleic acid encoding a chimeric T-cell receptor (CAR) which is immunospecific for the polypeptide of the invention, wherein the polypeptide is HLA-bound. Such nucleic acid will be capable of integration into the genome of the cells, and the cells may be administered in an effective amount the subject to provide a T-cell response against cells expressing a polypeptide of the invention. For example, the sample of cells from the subject may be collected.
(285) It is understood that cells used to produce said CAR-expressing T-cells may be autologous or non-autologous.
(286) Transgenic CAR-expressing T-cells may have expression of an endogenous T-cell receptor and/or endogenous HLA inactivated. For example, the cells may be engineered to eliminate expression of endogenous alpha/beta T-cell receptor (TCR).
(287) Methods of transfecting of cells are well known in the art, but highly efficient transfection methods such as electroporation may be employed. For example, nucleic acids or vectors of the invention expressing the CAR constructs may be introduced into cells using a nucleofection apparatus.
(288) The cell population for CAR-expressing T-cells may be enriched after transfection of the cells. For example, the cells expressing the CAR may be sorted from those which do not (e.g., via FACS) by use of an antigen bound by the CAR or a CAR-binding antibody. Alternatively, the enrichment step comprises depletion of the non T-cells or depletion of cells that lack CAR expression. For example, CD56+ cells can be depleted from a culture population.
(289) The population of transgenic CAR-expressing cells may be cultured ex vivo in a medium that selectively enhances proliferation of CAR-expressing T-cells. Therefore, the CAR-expressing T-cell may be expanded ex vivo.
(290) A sample of CAR cells may be preserved (or maintained in culture). For example, a sample may be cryopreserved for later expansion or analysis.
(291) CAR-expressing T-cells may be employed in combination with other therapeutics, for example checkpoint inhibitors including PD-L1 antagonists.
(292) In an embodiment, there is provided a cytotoxic cell that has been engineered to express any of the above antigen-binding polypeptides on its surface. Suitably, the cytotoxic cell is a T-cell.
(293) In an embodiment, there is provided a cytotoxic cell, which is suitably a T-cell, engineered to express any of the above antigen-binding polypeptides on its surface, for use in medicine
(294) The invention provides a pharmaceutical composition comprising a cytotoxic cell of the invention, which is suitably a T-cell.
(295) There is provided a method of treating a human patient suffering from cancer wherein the cells of the cancer express a sequence selected from SEQ ID NOs. 1-10 and immunogenic fragments and variants of any one thereof, or of preventing a human from suffering from cancer which cancer would express a sequence selected from SEQ ID NOs. 1-10 and immunogenic fragments and variants of any one thereof, which method comprises administering to said human a cytotoxic cell of the invention, which is suitably a T-cell.
(296) In an embodiment the cytotoxic cell of the invention, which is suitably a T-cell, is for use in treating or preventing cancer in a human, wherein the cells of the cancer express a corresponding sequence selected from SEQ ID NOs. 1-10 and immunogenic fragments of any one thereof.
(297) Combination Therapies
(298) Methods of treating cancer according to the invention may be performed in combination with other therapies, especially checkpoint inhibitors and interferons.
(299) The polypeptides, nucleic acids, vectors, antigen-binding polypeptide and adoptive cell therapies (APC and T-cell-based) can be used in combination with other components designed to enhance their immunogenicity, for example, to improve the magnitude and/or breadth of the elicited immune response, or provide other activities (e.g., activation of other aspects of the innate or adaptive immune response, or destruction of tumor cells).
(300) Accordingly, the invention provides a composition of the invention (i.e. an immunogenic, vaccine or pharmaceutical composition) or a kit of several such compositions comprising a polypeptide, nucleic acid or vector of the invention together with a pharmaceutically acceptable carrier; and (i) one or more further immunogenic or immunostimulant polypeptides (e.g., interferons, IL-12, checkpoint blockade molecules or nucleic acids encoding such, or vectors comprising such nucleic acids), (ii) small molecules (e.g., HDAC inhibitors or other drugs that modify the epigenetic profile of cancer cells) or biologicals (delivered as polypeptides or nucleic acids encoding such, or vectors comprising such nucleic acids) that will enhance the translation and/or presentation of the polypeptide products that are the subject of this invention.
(301) Checkpoint inhibitors, which block normal proteins on cancer cells, or the proteins on the T-cells that respond to them, may be a particularly important class of drugs to combine with CLT-antigen based therapies, since these inhibitors seek to overcome one of cancer's main defences against an immune system attack.
(302) Thus, an aspect of the invention includes administering a polypeptide, nucleic acid, vector, antigen-binding polypeptide, composition, T-cell, T-cell population, or antigen presenting cell of the present invention in combination with a checkpoint inhibitor. Example check point inhibitors are selected from PD-1 inhibitors, such as pembrolizumab, (Keytruda) and nivolumab (Opdivo), PD-L1 inhibitors, such as atezolizumab (Tecentriq), avelumab (Bavencio) and durvalumab (Imfinzi) and CTLA-4 inhibitors such as ipilimumab (Yervoy).
(303) Interferons (e.g., alpha, beta and gamma) are a family of proteins the body makes in very small amounts. Interferons may slow down or stop the cancer cells dividing, reduce the ability of the cancer cells to protect themselves from the immune system and/or enhance multiple aspects of the adaptive immune system. Interferons are typically administered as a subcutaneous injection in, for example the thigh or abdomen.
(304) Thus, an aspect of the invention includes administering a polypeptide, nucleic acid, vector, antigen-binding polypeptide or composition of the present invention in combination with interferon e.g., interferon alpha.
(305) Different modes of the invention may also be combined, for example polypeptides, nucleic acids and vectors of the invention may be combined with an APC, a T-cell or a T-cell population of the invention (discussed infra).
(306) One or more modes of the invention may also be combined with conventional anti-cancer chemotherapy and/or radiation.
(307) Diagnostics
(308) In another aspect, the invention provides methods for using one or more of the polypeptides or nucleic acid of the invention to diagnose cancer, particularly melanoma e.g. cutaneous melanoma, or to diagnose human subjects suitable for treatment by polypeptides, nucleic acids, vectors, antigen-binding polypeptides, adoptive cell therapies, or compositions of the invention.
(309) Thus the invention provides a method of diagnosing that a human suffering from cancer, comprising the steps of: determining if the cells of said cancer express a polypeptide sequence selected from SEQ ID NOs. 1-10 and immunogenic fragments or variants of any one thereof (e.g. selected from the sequences of SEQ ID NOs. 11-32 and 51-78); or a nucleic acid encoding said polypeptide sequence (e.g. selected from the sequences of SEQ ID NOs. 33-40 and SEQ ID NOs. 41-50), and diagnosing said human as suffering from cancer if said polypeptide or corresponding nucleic acid is overexpressed in said cancer cells.
(310) The invention provides a method of diagnosing that a human suffering from cancer which is cutaneous melanoma, comprising the steps of: determining if the cells of said cancer express a polypeptide sequence selected from SEQ ID NO. 2, 6, 7, 8 and 9 and immunogenic fragments or variants thereof; or a nucleic acid encoding said polypeptide sequence, and diagnosing said human as suffering from cancer which is cutaneous melanoma if said polypeptide or corresponding nucleic acid is overexpressed in said cancer cells.
(311) As used herein, overexpressed in cancer cells means that the level of expression in cancer cells is higher than in normal cells.
(312) The invention provides a method of diagnosing that a human suffering from cancer which is cutaneous melanoma or uveal melanoma, comprising the steps of: determining if the cells of said cancer express a polypeptide sequence selected from SEQ ID Nos. 1, 3, 4, 5 and 10 and immunogenic fragments or variants of any one thereof; or a nucleic acid encoding said polypeptide sequence, and diagnosing said human as suffering from cancer which is cutaneous melanoma or uveal melanoma if said polypeptide or corresponding nucleic acid is overexpressed in said cancer cells.
(313) The overexpression can be determined by reference to the level of the nucleic acid or polypeptide of the invention in a control human subject known not to have the cancer. Thus overexpression indicates that the nucleic acid or polypeptide of the invention is detected at a significantly higher level (e.g., a level which is 30%, 50%, 100% or 500% higher) in the test subject than in the control subject. In case the control human subject has an undetectable level of the nucleic acid or polypeptide of the invention, then the diagnosis can be arrived at by detecting the nucleic acid or polypeptide of the invention.
(314) The invention also provides a method of treating a human suffering from cancer, comprising the steps of: (a) determining if the cells of said cancer express a polypeptide sequence selected from SEQ ID NOs. 1-10 and immunogenic fragments or variants of any one thereof (e.g. selected from the sequences of SEQ ID NOs. 11-32 and 51-78) or a nucleic acid encoding said polypeptide (e.g. selected from the sequences of SEQ ID NOs. 33-40 and 41-50); and if so administering to said human a corresponding polypeptide, nucleic acid, vector, composition, T-cell population, T-cell, antigen presenting cell, antigen-binding polypeptide or cytotoxic cell of the invention.
(315) There is also provided use of a polypeptide comprising a sequence selected from: (a) the sequence of any one of SEQ ID NOs. 1-10; or (b) a variant of the sequences of (a); and (c) an immunogenic fragment of the sequences of (a) isolated from the tumor of a human suffering from cancer, or use of a nucleic acid encoding said polypeptide, as a biomarker for the determination of whether said human would be suitable for treatment by a vaccine comprising a corresponding polypeptide, nucleic acid, vector, composition, T-cell population, T-cell, antigen presenting cell, antigen-binding polypeptide or cytotoxic cell of the invention.
(316) Suitably, the cancer is melanoma particularly cutaneous melanoma.
(317) The invention also provides a method or use according to the invention wherein the polypeptide comprises a sequence selected from: (a) the sequence of any one of SEQ ID NOs. 1, 3, 4, 5 and 10; and (b) a variant of the sequences of (a); and (c) an immunogenic fragment of the sequences of (a). and for example the polypeptide comprises or consists of a sequence selected from any one of SEQ ID NOs. 11-14, 17-18, 19, 20-22, 30-32, 51-57, 67-74 and 76-77 and for example the nucleic acid comprises or consists of a sequence selected from any one of SEQ ID NOs. 33, 35, 36 or 40 or selected from any one of 41, 43, 44, 45 and 50; and wherein the cancer is uveal melanoma.
(318) Suitably the polypeptide of the invention has a sequence selected from SEQ Id NOs. 1-10 or a fragment thereof, such as an immunogenic fragment thereof (e.g. selected from the sequences of SEQ ID NOs. 11-32 and 51-78).
(319) Suitably the nucleic acid of the invention has or comprises a sequence selected from any one of SEQ ID NOs.33-40 or 41-50 or a fragment thereof, such as an immunogenic fragment thereof.
(320) Kits for detecting the presence of nucleic acids are well known. For example, kits comprising at least two oligonucleotides which hybridise to a polynucleotide may be used within a real-time PCR (RT-PCR) reaction to allow the detection and semi-quantification of specific nucleic acids. Such kits may allow the detection of PCR products by the generation of a fluorescent signal as a result of Forster Resonance Energy Transfer (FRET) (for example TaqMan kits), or upon binding of double stranded DNA (for example, SYBR Green kits). Some kits (for example, those containing TaqMan probes which span the exons of the target DNA) allow the detection and quantification of mRNA, for example transcripts encoding nucleic acids of the invention. Assays using certain kits may be set up in a multiplex format to detect multiple nucleic acids simultaneously within a reaction. Kits for the detection of active DNA (namely DNA that carries specific epigenetic signatures indicative of expression) may also be used. Additional components that may be present within such kits include a diagnostic reagent or reporter to facilitate the detection of a nucleic acid of the invention.
(321) Nucleic acids of the invention may also be detected via liquid biopsy, using a sample of blood from a patient. Such a procedure provides a non-invasive alternative to surgical biopsies. Plasma from such blood samples may be isolated and analysed for the presence of nucleic acids of the invention.
(322) Polypeptides of the invention may be detected by means of antigen-specific antibodies in an ELISA type assay to detect polypeptides of the invention in homogenized preparations of patient tumor samples. Alternatively, polypeptides of the invention may be detected by means of immunohistochemical analyses, which identify the presence of the polypeptide antigens by using light microscopy to inspect sections of patient tumor samples that have been stained by using appropriately labeled antibody preparations. As a further alternative, polypeptides of the invention may be detected by means of immunohistochemical analyses, which identify the presence of the polypeptide antigens by using light microscopy to inspect sections of patient tumor samples that have been stained by using appropriately labeled antibody preparations.
(323) Polypeptides of the invention may also be detected by determining whether they are capable of stimulating T-cells raised against the said polypeptide.
(324) Cells of the cancer or tumor e.g., the melanoma e.g. cutaneous melanoma may for example be obtained from a biopsy of the cancer e.g., the melanoma e.g. cutaneous melanoma.
(325) A method of treatment of cancer, particularly melanoma e.g. cutaneous melanoma, in a human comprises (i) detecting the presence of a nucleic acid or polypeptide according to the invention and (ii) administering to the subject a nucleic acid, polypeptide, vector, cell, T-cell or T-cell population or composition according to the invention (and preferably administering the same nucleic acid or polypeptide or fragment thereof that has been detected).
(326) A method of treatment of cancer, particularly melanoma e.g. cutaneous melanoma, in a human also comprises administering to the subject a nucleic acid, polypeptide, vector, cell, T-cell or T-cell population or composition according to the invention, in which subject the presence of a (and preferably the same) nucleic acid or polypeptide according to the invention has been detected.
(327) In particular, the cancer to be diagnosed and if appropriate treated is melanoma e.g. cutaneous melanoma.
(328) Where a polypeptide of the invention of SEQ ID NOs. 1, 3, 4, 5 or 10 or a fragment thereof is detected then the cancer might be cutaneous melanoma or uveal melanoma.
Specific Embodiments
(329) In an embodiment, the CLT antigen polypeptide comprises or consists of SEQ ID NO. 1. Exemplary fragments comprise or consist of any one of SEQ ID NOs. 11-14. Further exemplary fragments comprise two, three or four of SEQ ID NOs. 11-14. Further exemplary fragments comprise or consist of any one of SEQ ID NOs. 55-57 or 73-74. Further exemplary fragments comprise all of SEQ ID NOs. 11-14, 55-57 and 73-74 (allowance being taken for possible sequence overlap so that any overlapping sequence does not need to be present more than once). Exemplary nucleic acids encoding said polypeptide sequence comprise or consists of SEQ ID NO 33 or SEQ ID NO. 41. Corresponding nucleic acids (e.g., DNA or RNA), T-cells, T-cell populations, cytocotic cells, antigen-binding polypeptides, antigen presenting cells and exosomes as described supra are provided. Said nucleic acids (e.g., DNA or RNA), T-cells, T-cell populations, cytotoxic cells, antigen-binding polypeptides, antigen presenting cells and exosomes may be used in the treatment of cancer especially melanoma e.g. cutaneous melanoma or uveal melanoma. Related methods of diagnosis are also provided.
(330) In an embodiment, the CLT antigen polypeptide comprises or consists of SEQ ID NO. 2. Exemplary fragments comprise or consist of SEQ ID NO. 15 or SEQ ID NO. 16. Further exemplary fragments comprise SEQ ID NO. 15 and SEQ ID NO. 16. Further exemplary fragments comprise or consist of any one of SEQ ID NOs. 58-66, 75 and 78. Further exemplary fragments comprise all of SEQ ID NOs. 15-16, 58-66, 75 and 78 (allowance being taken for possible sequence overlap so that any overlapping sequence does not need to be present more than once). Exemplary nucleic acids encoding said polypeptide sequence comprise or consists of SEQ ID NO. 34 or SEQ ID NO. 42. Corresponding nucleic acids (e.g., DNA or RNA), T-cells, T-cell populations, cytocotic cells, antigen-binding polypeptides, antigen presenting cells and exosomes as described supra are provided. Said nucleic acids (e.g., DNA or RNA), T-cells, T-cell populations, cytotoxic cells, antigen-binding polypeptides, antigen presenting cells and exosomes may be used in the treatment of cancer especially melanoma e.g. cutaneous melanoma. Related methods of diagnosis are also provided.
(331) In an embodiment, the CLT antigen polypeptide comprises or consists of SEQ ID NO. 3. Exemplary fragments comprise or consist of SEQ ID NO. 17 or SEQ ID NO. 18. Further exemplary fragments comprise SEQ ID NO. 17 and SEQ ID NO. 18. Further exemplary fragments comprise or consist of any one of SEQ ID NOs. 53 and 67-69. Further exemplary fragments comprise SEQ ID NO. 17, SEQ ID NO. 18 and SEQ ID NO. 53. Further exemplary fragments comprise all of SEQ ID NOs. 17-18, 53 and 67-69 (allowance being taken for possible sequence overlap so that any overlapping sequence does not need to be present more than once). Exemplary nucleic acids encoding said polypeptide sequence comprise or consists of SEQ ID NO. 35 or SEQ ID NO. 43. Corresponding nucleic acids (e.g., DNA or RNA), T-cells, T-cell populations, cytocotic cells, antigen-binding polypeptides, antigen presenting cells and exosomes as described supra are provided. Said nucleic acids (e.g., DNA or RNA), T-cells, T-cell populations, cytotoxic cells, antigen-binding polypeptides, antigen presenting cells and exosomes may be used in the treatment of cancer especially melanoma e.g. cutaneous melanoma or uveal melanoma. Related methods of diagnosis are also provided.
(332) In an embodiment, the CLT antigen polypeptide comprises or consists of SEQ ID NO. 4. Exemplary fragments comprise or consist of SEQ ID NO. 19. Further exemplary fragments comprise or consist of SEQ ID NO. 51 or SEQ ID NO. 52. Further exemplary fragments comprise or consist of SEQ ID NO. 54. Further exemplary fragments comprise or consist of any one of SEQ ID NOs. 70-72 and 76-77. Further exemplary fragments comprise SEQ ID NO. 19 and either SEQ ID NO. 51 or SEQ ID NO. 52. Further exemplary fragments comprise SEQ ID NO. 54 and either SEQ ID NO. 51 or SEQ ID NO. 52. Further exemplary fragments comprise all of SEQ ID NOs. 19, 51-52, 54, 70-72 and 76-77(allowance being taken for possible sequence overlap so that any overlapping sequence does not need to be present more than once). Exemplary nucleic acids encoding said polypeptide sequence comprise or consists of SEQ ID NO. 35 or SEQ ID NO. 44. Corresponding nucleic acids (e.g., DNA or RNA), T-cells, T-cell populations, cytocotic cells, antigen-binding polypeptides, antigen presenting cells and exosomes as described supra are provided. Said nucleic acids (e.g., DNA or RNA), T-cells, T-cell populations, cytotoxic cells, antigen-binding polypeptides, antigen presenting cells and exosomes may be used in the treatment of cancer especially melanoma e.g. cutaneous melanoma or uveal melanoma. Related methods of diagnosis are also provided.
(333) In an embodiment, the CLT antigen polypeptide comprises or consists of SEQ ID NO. 5. Exemplary fragments comprise or consist of any one of SEQ ID NOs. 20-22. Exemplary nucleic acids encoding said polypeptide sequence comprise or consists of SEQ ID NO. 36 or SEQ ID NO. 45. Corresponding nucleic acids (e.g., DNA or RNA), T-cells, T-cell populations, cytocotic cells, antigen-binding polypeptides, antigen presenting cells and exosomes as described supra are provided. Said nucleic acids (e.g., DNA or RNA), T-cells, T-cell populations, cytotoxic cells, antigen-binding polypeptides, antigen presenting cells and exosomes may be used in the treatment of cancer especially melanoma e.g. cutaneous melanoma or uveal melanoma. Related methods of diagnosis are also provided.
(334) In an embodiment, the CLT antigen polypeptide comprises or consists of SEQ ID NO. 6. Exemplary fragments comprise or consist of SEQ ID NO. 23 or SEQ ID NO. 24. Exemplary nucleic acids encoding said polypeptide sequence comprise or consists of SEQ ID NO. 37 or SEQ ID NO. 46. Corresponding nucleic acids (e.g., DNA or RNA), T-cells, T-cell populations, cytocotic cells, antigen-binding polypeptides, antigen presenting cells and exosomes as described supra are provided. Said nucleic acids (e.g., DNA or RNA), T-cells, T-cell populations, cytotoxic cells, antigen-binding polypeptides, antigen presenting cells and exosomes may be used in the treatment of cancer especially melanoma e.g. cutaneous melanoma. Related methods of diagnosis are also provided.
(335) In an embodiment, the CLT antigen polypeptide comprises or consists of SEQ ID NO. 7. Exemplary fragments comprise or consist of SEQ ID NO. 25. Exemplary nucleic acids encoding said polypeptide sequence comprise or consists of SEQ ID NO. 38 or SEQ ID NO. 47. Corresponding nucleic acids (e.g., DNA or RNA), T-cells, T-cell populations, cytocotic cells, antigen-binding polypeptides, antigen presenting cells and exosomes as described supra are provided. Said nucleic acids (e.g., DNA or RNA), T-cells, T-cell populations, cytotoxic cells, antigen-binding polypeptides, antigen presenting cells and exosomes may be used in the treatment of cancer especially melanoma e.g. cutaneous melanoma. Related methods of diagnosis are also provided.
(336) In an embodiment, the CLT antigen polypeptide comprises or consists of SEQ ID NO. 8. Exemplary fragments comprise or consist of SEQ ID NO. 26. Exemplary nucleic acids encoding said polypeptide sequence comprise or consists of SEQ ID NO. 38 or SEQ ID NO. 48. Corresponding nucleic acids (e.g., DNA or RNA), T-cells, T-cell populations, cytocotic cells, antigen-binding polypeptides, antigen presenting cells and exosomes as described supra are provided. Said nucleic acids (e.g., DNA or RNA), T-cells, T-cell populations, cytotoxic cells, antigen-binding polypeptides, antigen presenting cells and exosomes may be used in the treatment of cancer especially melanoma e.g. cutaneous melanoma. Related methods of diagnosis are also provided.
(337) In an embodiment, the CLT antigen polypeptide comprises or consists of SEQ ID NO. 9. Exemplary fragments comprise or consist of any one of SEQ ID NOs. 27-29. Exemplary nucleic acids encoding said polypeptide sequence comprise or consists of SEQ ID NO. 39 or SEQ ID NO. 49. Corresponding nucleic acids (e.g., DNA or RNA), T-cells, T-cell populations, cytotoxic cells, antigen-binding polypeptides, antigen presenting cells and exosomes as described supra are provided. Said nucleic acids (e.g., DNA or RNA), T-cells, T-cell populations, cytotoxic cells, antigen-binding polypeptides, antigen presenting cells and exosomes may be used in the treatment of cancer especially melanoma e.g. cutaneous melanoma. Related methods of diagnosis are also provided.
(338) In an embodiment, the CLT antigen polypeptide comprises or consists of SEQ ID NO. 10. Exemplary fragments comprise or consist of any one of SEQ ID NOs. 30-32. Exemplary nucleic acids encoding said polypeptide sequence comprise or consists of SEQ ID NO. 40 or SEQ ID NO. 50. Corresponding nucleic acids (e.g., DNA or RNA), T-cells, T-cell populations, cytocotic cells, antigen-binding polypeptides, antigen presenting cells and exosomes as described supra are provided. Said nucleic acids (e.g., DNA or RNA), T-cells, T-cell populations, cytotoxic cells, antigen-binding polypeptides, antigen presenting cells and exosomes may be used in the treatment of cancer especially melanoma e.g. cutaneous melanoma or uveal melanoma. Related methods of diagnosis are also provided.
EXAMPLES
Example 1CLT Identification
(339) The objective was to identify cancer-specific transcripts that entirely or partially consist of LTR elements.
(340) As a first step, we de novo assembled a comprehensive pan-cancer transcriptome. To achieve this, RNA-sequencing reads from 768 patient samples, obtained from The Cancer Genome Atlas (TCGA) consortium and representing a wide variety of cancer types (24 gender-balanced samples from each of 32 cancer types (31 primary and 1 metastatic melanoma); Table S1), were used for genome-guided assembly. The gender-balanced samples (excluding gender-specific tissues) were adapter and quality (Q20) trimmed and length filtered (both reads of the pair 35 nucleotides) using cutadapt (v1.13) (Marcel M., 2011, EMBnet J., 17:3) and kmer-normalized (k=20) using khmer (v2.0) (Crusoe et al., 2015, F1000Res., 4:900) for maximum and minimum depths of 200 and 3, respectively. Reads were mapped to GRCh38 using STAR (2.5.2b) with settings identical to those used across TCGA and passed to Trinity (v2.2.0) (Trinity, Grabherr, M. G., et al., 2011, Nat. Biotechnol., 29:644-52) for a genome-guided assembly with inbuilt in silico depth normalization disabled. The majority of assembly processes were completed within 256 GB RAM on 32-core HPC nodes, with failed processes re-run using 1.5 TB RAM nodes. Resulting contigs were poly(A)-trimmed (trimpoly within SeqClean v110222) and entropy-filtered (0.7) to remove low-quality and artefactual contigs (bbduk within BBMap v36.2). Per cancer type, the original 24 samples were quasi-mapped to the cleaned assembly using Salmon (v0.8.2 or v0.9.2) (Patro, R., et al., 2017, Nat. Methods, 14:417-419), with contigs found expressed at <0.1 transcripts per million (TPM) being removed. Those remaining were mapped to GRCh38 using GMAP (v161107) (Wu et al., 2005, Bioinf., 21:1859-1875), and contigs not aligning with 85% identity over 85% of their length were removed from the assembly. Finally, assemblies for all cancer types together were flattened and merged into the longest continuous transcripts using gffread (Cufflinks v2.2.1) (Trapnell et al., 2010, Nat. Biotech., 28:511-515). As this assembly process was specifically designed to enable assessment of repetitive elements, monoexonic transcripts were retained, but flagged. Transcript assembly completeness and quality was assessed by comparison with GENCODE v24basic and MiTranscriptome1 (Iyer et al. 2015, Nat. Genet., 47: 199-208). We compiled the list of unique splice sites represented within GENCODE and tested if the splice site was present within the transcriptome assembly within a 2-nucleotide grace window. This process resulted in the identification of 1,001,931 transcripts, 771,006 of which were spliced and 230,925 monoexonic.
(341) Separately, the assembled contigs were overlaid with a genomic repeat sequence annotation to identify transcripts that contain an LTR element. LTR and non-LTR elements were annotated as previously described (Attig et al., 2017, Front. In Microbiol., 8:2489). Briefly, hidden Markov models (HMMs) representing known Human repeat families (Dfam 2.0 library v150923) were used to annotate GRCh38 using RepeatMasker Open-3.0 (Smit, A., R. Hubley, and P. Green, http://www.repeatmasker.org, 1996-2010), configured with nhmmer (Wheeler et al., 2013, Bioinform., 29:2487-2489). HMM-based scanning increases the accuracy of annotation in comparison with BLAST-based methods (Hubley et al., 2016, Nuc. Acid. Res., 44:81-89). RepeatMasker annotates LTR and internal regions separately, thus tabular outputs were parsed to merge adjacent annotations for the same element. This process yielded 181,967 transcripts that contained one or more, complete or partial LTR element.
(342) Transcripts per million (TPM) were estimated for all transcripts using Salmon and expression within each cancer type was compared with expression across 811 healthy tissue samples (healthy tissue-matched controls for all cancer types, where available, from TCGA and, separately from, GTEx (The Genotype-Tissue Expression Consortium, 2015, Science, 348:648-60). Transcripts were considered expressed specifically in cancer if detected at more than 1 TPM in any sample and as cancer-specific if the following criteria were fulfilled: i, expressed in of the 24 samples of each cancer type; ii, expressed at <10 TPM in 90% of all healthy tissue samples; iii, expressed in the cancer type of interest 3 the median expression in any control tissue type; and iv, expressed in the cancer type of interest 3 the 90th percentile of the respective healthy tissue, where available. In addition to these expression thresholds, transcript selection was based on manual inspection, excluding potentially misassembled contigs or transcripts with LTR elements in their 3 untranslated regions (UTRs). Where the direction of transcription could not be unambiguously assigned, transcripts corresponding to both strands were considered.
(343) The list of cancer-specific transcripts was then intersected with the list of transcripts containing complete or partial LTR elements to produce a list of 5,923 transcripts that fulfilled both criteria (referred to as CLTs for Cancer-specific LTR element-spanning Transcripts).
(344) To identify CLTs with protein-coding potential, we run an ORF prediction algorithm, based on length and suitability of dicodon (hexamer) scores. A HMM was trained on hexamers derived from Ensembl CDS sequences and ORFs 300 nucleotides were taken forward, where their sense hexamer score exceeded the anti-sense score. This filter identified 885 CLTs potentially encoding a protein of at least 99 amino acids length.
(345) To identify unique protein sequences potentially encoded by CLTs, sequences translated from the largest ORF of selected CLTs were queried against those translated from all ORFs 210 nucleotides from the entire transcript assembly using tblastn (BLAST.sub.+v2.3.0) without soft-maskin. Only CLTs with no hits or with hits with an E-value >10.sup.5 were retained.
(346) To further ensure the specificity of cancer-specific antigens encoded by CLTs, we examined their potential cross-reactivity with other proteins that might be expressed in healthy tissue. To this end, translated ORFs with <85% amino acid sequence identity (over the entire length of the protein) with any other predicted protein were retained. For those CLT-encoded proteins showing >85% sequence identity with one or more predicted proteins, we interrogated the expression pattern of transcripts encoding the similar proteins. Where these additional transcripts were also expressed in a cancer-specific manner (based on the criteria listed above), the respective CLT was retained in the list of selected candidates. Where the additional transcripts were also expressed in healthy tissue, the respective CLT was discarded. The combination of these selection criteria yielded a final list of 139 CLTs with the potential to encode proteins with sufficiently unique amino acid sequence.
(347) Of these 139 CLTs, 14 were specific to cutaneous melanoma (i.e. they were found to be upregulated specifically in cutaneous melanoma samples in the TGCA according to the above metholology) and 7 were specific to cutaneous melanoma and uveal melanoma (i.e. they were found to be upregulated specifically in cutaneous melanoma and uveal melanoma samples in TGCA according to the above methodology). Four of these cutaneous melanoma specific CLTs are identified herein as having SEQ ID NO. 34, 37, 38 and 39. Four of these cutaneous melanoma and uveal melanoma specific CLTs are identified herein as having SEQ ID NOs. 33, 35, 36 and 40.
Example 2Immunopeptidomic Analysis
(348) Immunopeptidomic analysis is a powerful technology that allows the direct detection of specific peptides associated with HLA molecules in cells or tissues. The technique consists of affinity purification of HLA molecules from biological samples, and then elution of bound peptides from the HLA molecules and evaluation of the peptides by nano-ultra performance liquid chromatography mass spectrometry (nUPLC-M5.sup.2) (Freudenmann et al., 2018, Immunology 154(3):331-345). The mass spectrometry (MS) spectra produced by this method can be used to precisely identify the short peptides that are bound to HLA Class I and HLA Class II molecules. The software used for spectral interpretation and sequence identification rely on availability of a pre-defined list of protein sequences for spectral matching. Although it is possible to search MS data by using pre-defined lists corresponding to all open reading frames (ORFs) derived from the known transcriptome or even the entire genome (Nesvizhskii et al., 2014, Nat. Methods 11:1114-1125), interrogating these very large sequence databases leads to very high false discovery rates that limit the identification of presented peptides. Further technical issues (e.g., mass of leucine=mass of isoleucine), and theoretical issues (e.g., peptide splicing (Liepe, et al., 2016, Science 354(6310): 354-358)) increase the limitations associated with use of very large databases, such as those produced from the known transcriptome or entire genome. Thus, in practice, it is exceptionally difficult to perform immunopeptidoimc analyses to identify novel antigens without reference to a well-defined set of potential polypeptide sequences.
(349) Bassani-Sternberg et al. (Bassani-Sternberg et al., 2016, Nature Commun., 7: 13404) interrogated MS data collected from HLA-bound peptide samples derived from 25 cutaneous melanoma patients against the polypeptides reported for the entire human proteome. These analyses revealed hundreds of thousands of peptides that matched to known human proteins. As expected, these peptides included peptides found within multiple tumor-associated antigens (TAA), including PRAME, MAGEA3, and TRPM1 (melastatin). In addition, the MS data from 5 of these patients were interrogated with a polypeptide list created from patient-specific mutated protein sequences detected by genomic analyses of these 5 patients, revealing patient-specific neoantigens presented on the HLA Class I and HLA Class II molecules of these patients.
(350) Many of the predicted polypeptide sequences (ORFs) derived from the 139 CLTs referred to in Example 1 are not contained within the human proteome. By applying detailed knowledge of immunopeptidomic evaluation, the inventors interrogated the RAW data files of Bassani-Sternberg et al. (database link: https://www.ebi.ac.uk/pride/archive/projects/PXD004894) with this set of novel potential CLT antigen sequences.
(351) To accomplish this analysis, the peptide sequences from all possible ORFs encoded by each CLT were concatenated into a single peptide file for each CLT, or not, and these concatenated files (analysis A) or single peptide files (analysis B) were used to interrogate the raw spectra in the PXD004894 dataset, alongside all polypeptides found in the human proteome (UniProt (analysis A) or UniProt and masDB (analysis B)), by using the Peaks software (analysis A) or the Mascot software (analysis B).
(352) In analysis A, the results of these studies identified 14 peptides that were associated with the HLA Class I molecules immunoprecipitated from tumor samples from the 25 patients examined by Bassani-Sternberg et al., which can be attributed to 8 ORFs that were not found in the reported proteome (see Table 1). In analysis B, the results of these studies identified 14 peptides that were associated with the HLA Class I molecules or HLA Class II molecules immunoprecipitated from tumor samples from the 25 patients examined by Bassani-Sternberg et al., which can be attributed to 7 ORFs that were not found in the reported proteome (see Table 2). The detection of these peptides associated with the HLA Class I and HLA Class II molecules from the cited patients confirms that the 10 ORFs from which they were derived (Tables 1 and 2, SEQ ID NOs. 1-10) were translated in melanoma tissue and presented to the immune system complexed with HLA Class I or HLA Class II molecules. On this basis, the polypeptides encoded by these ORFs were defined as CLT antigens. Tables 1 and 2 show the properties of the peptides found in the CLT antigens that were not in the UniProt database.
(353) A number of the peptides detected in association with HLA Class I from Tables 1 and 2 were assessed to determine the predicted strength of binding to HLA Class I supertypes. Specifically, all HLA Class I-associated peptides referenced in Table 3 that were 9 amino acids or longer were interrogated by using the NetMHC 4.0 prediction software (http://www.cbs.dtu.dk/services/NetMHC/) to predict their binding to HLA Class I type A and B supertypes. The results of these prediction studies showed that all 11 peptides (or 9-mers derived from them) were predicted to bind to at least one of the supertypes tested (see Table 3). Amongst these, many of sequences were predicted to bind with high confidence (low % rank scores) to specific types within the HLA Class I supertypes examined.
(354) Taken together, the data shown in Tables 1-3 and
(355) In summary: the identification of immunopeptidomic peptides derived from the predicted ORFs, demonstrates that these CLTs are translated into polypeptides (SEQ ID NOs. 1-10; referred to as CLT antigens) in tumor tissue. These are then processed by the immune surveillance apparatus of the cells, and loaded onto HLA Class I or HLA Class II molecules, enabling the cell to be targeted for cytolysis by T-cells that recognize the resulting peptide/HLA Class I or peptide/HLA Class II complexes. Thus, these CLT antigens and fragments of them are expected to be useful in a variety of therapeutic modalities for the treatment of melanoma in patients whose tumors express these antigens.
(356) TABLE-US-00001 TABLE1 Listofpeptidesidentifiedbyimmunopeptidomicanalyses(analysisA)ofSKCMtumor samples,alongwithCLTantigennameandcrossreferencetoSEQIDNOs. CLT Peptide CLT Antigen Peptide SEQID Antigen SEQID Patient Peptide Peptide #of sequence.sup.1 No. No. NO. #.sup.2 mass.sup.3 length Area.sup.4 spectra.sup.5 Ppm.sup.6 VQQGWFF SEQID 1 SEQID Mel-3 1163.59 9 350000 1 9.4 PR NO.11 NO.1 VVRGGAG SEQID 1 SEQID Mel-3 1059.59 11 3970000 8 5.1 FAAR NO.12 NO.1 HLADRKLS SEQID 1 SEQID Mel-5 1051.61 9 125000000 2 1.1 L NO.13 NO.1 HLADRKLS SEQID 1 SEQID Mel-16 1051.61 9 3290000 30 5.1 L NO.13 NO.1 ADSLILDF SEQID 2 SEQID Mel-26 892.45 8 83300 1 0.9 NO.15 NO.2 SSFSTLAS SEQID 2 SEQID Mel-20 1154.58 11 860000 2 6.7 LDK NO.16 NO.2 NTPNIVSL SEQID 3 SEQID Mel-35 1012.57 9 4690000 2 3.8 R NO.17 NO.3 KTKGSLSV SEQID 4 SEQID Mel-3 1121.66 10 1200000 3 4.8 FR NO.19 NO.4 AAFDRAV SEQID 4 SEQID Mel-40 1032.51 9 227000 1 0.3 HF NO.51 NO.4 AAFDRAV SEQID 4 SEQID Mel-41 1032.514 9 8700000 3 7.8 HF NO.51 NO.4 AFDRAVH SEQID 4 SEQID Mel-27 961.4769 8 1240000 3 7.9 F NO.52 NO.4 AFDRAVH SEQID 4 SEQID Mel-39 961.47 8 1940000 3 2.6 F NO.52 NO.4 DIPIKPW SEQID 5 SEQID Mel-5 867.49 7 1280000 5 5.3 NO.21 NO.5 DIPIKPW SEQID 5 SEQID Mel-27 867.49 7 1790000 6 9.1 NO.21 NO.5 RVADIPIK SEQID 5 SEQID Mel-5 1193.69 10 8710000 4 4.7 PW NO.20 NO.5 RVADIPIK SEQID 5 SEQID Mel-27 1193.69 10 82000000 6 9.8 PW NO.20 NO.5 RVADIPIK SEQID 5 SEQID Mel-27 1007.61 9 30300000 6 8 P NO.22 NO.5 RSRDNFA SEQID 6 SEQID Mel-21 1149.57 9 21900000 4 8.5 VW NO.23 NO.6 RSRDNFA SEQID 6 SEQID Mel-27 1149.57 9 19800000 6 7.8 VW NO.23 NO.6 RSRDNFA SEQID 6 SEQID Mel-21 864.42 7 41000000 3 8.8 NO.24 NO.6 RSRDNFA SEQID 6 SEQID Mel-27 864.42 7 2550000 3 7.9 NO.24 NO.6 SPGISLVF SEQID 7 SEQID Mel-16 818.45 8 546000 1 8.3 NO.25 NO.7 SSDSTILV SEQID 8 SEQID Mel-41 933.50 9 63600 1 13.1 L NO.26 NO.8 .sup.1Peptide identified by mass spectrometry. All peptides are HLA Class I peptides. .sup.2Bassani-Sternberg et al, 2016, Nature Comm., 7: 13404 .sup.3Calculated peptide mass. .sup.4Peaks program Area from mass spectrum; selected Area values are shown for peptides for which more than one spectrum was obtained. .sup.5Number of spectra in which peptide was detected. .sup.6Deviation between observed mass and calculated mass; selected ppm values are shown for peptides for which more than one spectrum was obtained.
(357) TABLE-US-00002 TABLE2 Listofpeptidesidentifiedbyimmunopeptidomicanalyses(analysisB)ofSKCMtumor samples,alongwithCLTantigennameandcrossreferencetoSEQIDNOs. CLT Peptide CLT Antigen Peptide SEQID Antigen SEQID Patient Peptide Peptide #of Mass sequence.sup.1 No. No. NO. #.sup.2 mass.sup.3 length spectra.sup.4 Delta.sup.5 HLADRKLS SEQID 1 SEQID Mel-16 1051.61 9 3 0.01015 L NO.13 NO.1 VVRGGAG SEQID 1 SEQID Mel-3 1059.59 11 1 0.001564 FAAR NO.12 NO.1 ARLQGSV SEQID 1 SEQID Mel-5 985.56 9 1 0.007816 TL NO.14 NO.1 SSFSTLAS SEQID 2 SEQID Mel-20 1154.58 11 2 0.004607 LDK NO.16 NO.2 QPEVGIIP SEQID 3 SEQID Mel-18 1743.90 15 1 0.052238 SVLLMRP* NO.18 NO.3 KTKGSLSV SEQID 4 SEQID Mel-3 1121.66 10 2 0.005258 FR NO.19 NO.4 RVADIPIK SEQID 5 SEQID Mel-4 1193.69 10 1 0.009444 PW NO.20 NO.5 RVADIPIK SEQID 5 SEQID Mel-5 1193.69 10 1 0.00549 PW NO.20 NO.5 DIPIKPW SEQID 5 SEQID Mel-4 867.49 7 1 0.008214 NO.21 NO.5 AGRMSKS SEQID 9 SEQID Mel-15 1188.70 11 3 0.000087 LVIK NO.27 NO.9 PQSAGRM SEQID 9 SEQID Mel-6 745.35 7 1 0.007525 NO.28 NO.9 AGSQSSS SEQID 9 SEQID Mel-10 1875.83 18 1 0.04998 FTRGHTG NO.29 NO9 ETPQ* RSNLSIFL SEQID 10 SEQID Mel-4 990.55 8 2 0.005184 NO.30 NO.10 FSLCLFTL SEQID 10 SEQID Mel-18 942.49 8 1 0.000214 NO.31 NO.10 FSLCLFTL SEQID 10 SEQID Mel-15 942.49 8 13 0.0026 NO.31 NO.10 SRRVFSR SEQID 10 SEQID Mel-7 3370.48 24 1 0.006099 FSYMTFY NO.32 NO.10 SFRSYIKV FV* .sup.1Peptide identified by mass spectrometry. All peptides are HLA Class I peptides unless indicated with a * (which ones are HLA Class II) .sup.2Bassani-Sternberg et al, 2016, Nature Comm., 7: 13404 .sup.3Calculated peptide mass. .sup.4Number of spectra in which peptide was detected. .sup.5Difference between observed mass and calculated mass; selected Mass Delta values are shown for peptides for which more than one spectrum was obtained. *indicates a HLA Class II peptide
(358) TABLE-US-00003 TABLE3 PredictedNetMHC4.0bindingofMassSpectrometry-identifiedpeptides(length9 residues)to12HLAClassISupertypeAlleles(HLA-A0101,HLA-A0201,HLA-A0301,HLA- A2402,HLA-A2601,HLA-B0702,HLA-B0801,HLA-B1501,HLA-B2705,HLA-B3901,HLA- B4001,HLA-B5801),alongwithCLTantigennameandcrossreferencetoSEQIDNOs. Number predictedto Number of bind12 ofalleles alleles human witha witha HLAClass rank rank CLT IA&B scoreof scoreof Peptide Antigen Patient supertypes.sup.1 Peptidesequence <5.1%.sup.2 <2.1%.sup.3 SEQIDNO. No. #.sup.4 YES VQQGWFFPR 2/12 1/12 SEQIDNO. 1 Mel-3 11 YES VVRGGFAGFAAR 3/12 0 SEQIDNO. 1 Mel-3 12 YES HLADRKLSL 6/12 3/12 SEQIDNO. 1 Mel- 13 5/Mel- 16 YES ARLQGSVTL 7/12 3/12 SEQIDNO. 1 Mel-5 14 YES SSFSTLASLDK 7/12 3/12 SEQIDNO. 2 Mel-20 16 YES NTPNIVSLR 1/12 1/12 SEQIDNO. 3 Mel-35 17 YES KTKGSLSVFR 4/12 2/12 SEQIDNO. 4 Mel-3 19 YES AAFDRAVHF 12/12 6/12 SEQIDNO. 4 Mel- 51 40/Mel- 41 YES RVADIPIKPW 1/12 1/12 SEQID 5 Mel- NO.20 4/Mel- 5/Mel- 27 YES RVADIPIKP 0/12 0/12 SEQIDNO. 5 Mel-27 22 YES RSRDNFAVW 3/12 1/12 SEQIDNO. 6 Mel- 23 21/Mel- 27 YES SSDSTILVL 2/12 1/12 SEQIDNO. 8 Mel-41 26 YES AGRMSKSLVIK 4/12 4/12 SEQIDNO. 9 Mel-15 27 .sup.1Predicted binding to interrogated HLA Class I supertypes at any Rank score. .sup.2Fraction of HLA Class I supertypes that were predicted to bind with a rank score of <5.1% (weak binding). .sup.3Fraction of HLA Class I supertypes that were predicted to bind with a rank score of <2.1% (stronger binding). .sup.4Bassani-Sternberg et al, 2016, Nature Comm., 7: 13404
Example 2.1Additional Immunopeptidomic Analysis
(359) In addition to the analyses described in Example 2, the inventors have also identified peptides derived from the predicted ORFs through new immunopeptidomic studies. This additional work, described below, further demonstrates that these CLTs are translated into CLT Antigen polypeptides in tumor tissue.
(360) The inventors procured frozen tumor tissue from 10 patients diagnosed with melanoma. Samples between 0.05-1 g were homogenized, the lysate was centrifugate at high speed and the cleared lysate was mixed with protein A (ProA) beads covalently linked to an anti-human HLA class I monoclonal antibody (W6/32). The mixture was incubated overnight at 4 C. to improve HLA Class I molecule binding to antibody (Ternette et al., 2018 Proteomics 18, 1700465). The HLA Class I-bound peptides were eluted from the antibody by using 10% acetic acid, and the peptides were then separated from other high molecular mass components using reversed-phase column chromatography (Ternette et al., 2018). The purified, eluted peptides were subjected to nUPLC-MS, and specific peptides of defined charge-to-mass ratio (m/z) were selected within the mass spectrometer, isolated, fragmented, and subjected to MS/MS to reveal the m/z of the resulting fragment ions (Ternette et al., 2018), producing an MS/MS dataset corresponding to the immunopeptidome for each of these tumor samples.
(361) By applying detailed knowledge of immunopeptidomics evaluation, the inventors interrogated the spectra of the HLA-Class I dataset for the 10 melanoma tumors prepared by the inventors with the CLT antigens no.1,2,3 and 4 (Table 4; SEQ ID NOs. 1-4), which were searched (for each CLT) alongside all polypeptide sequences found in the human proteome (UniProt) using PEAKS software (v8.5 and vX, Bioinformatics Solutions Inc). Since the majority of Class I HLA-bound peptides found in cells are derived from constitutively expressed proteins, the simultaneous interrogation of these databases with the UniProt proteome helps to ensure that assignments of our CLT ORF sequences to MS/MS spectra are correct.
(362) The results of these studies identified 8 individual peptides (Table 4; SEQ ID NOs. 1-4) that were associated with the HLA Class I molecules immunoprecipitated from tumor samples from the 10 melanoma patient samples procured by the inventors. These peptides corresponded to the amino acid sequence of CLT-derived ORFs, and did not correspond to polypeptide sequences present within the known human proteome (UniProt). 2 out of 8 peptides identified from CLT antigens SEQ ID NOs. 1-4 (Table 4) in the inventors' dataset, are in addition to the 10 individual peptides (from the same CLT antigens SEQ ID NOs. 1-4 outlined in Example 2 and Tables 1 & 2) that were associated with the HLA Class I molecules immunoprecipitated from tumor samples from patients examined by Bassani-Sternberg et al.
(363) The detection of these peptides associated with the HLA Class I molecules confirms, that the 4 ORFs from which they were derived, were first translated in melanoma tissues, processed through the HLA Class I pathway and finally presented to the immune system in a complex with HLA Class I molecules. Table 4 shows the properties of the peptides found in the CLT antigens.
(364) All of the peptides detected in association with HLA Class I from Table 4 that were at least 9 AA in length were assessed to determine their predicted strength of binding to HLA Class I type A and B supertypes by using the NetMHCpan 4.0 prediction software (http://www.cbs.dtu.dk/services/BetMHCpan/). The results of these prediction studies showed that all of the peptides (or 9-mers contained within each full sequence) were predicted to bind to at least one of the supertypes tested (see Table 5). Amongst these, many of sequences were predicted to bind with high confidence (low % rank scores) to specific types within the HLA Class I supertypes examined. The fact that all of the detected peptides were expected to bind to HLA types that were expected to be in the patient population is consistent with their detection. Moreover, every peptide discovered in a tumor sample from the inventors' dataset was predicted by NetMHCpan 4.0 to bind to one of the HLA types we detected in the patient sample.
(365) To provide further certainty of the assignment of tumor tissue-derived MS spectra to the peptide sequences that we discovered in Example 2.1, peptides with these discovered sequences were synthesized and subjected to nUPLC-MS.sup.2 using the same conditions applied to the tumor samples in the inventors' data. Comparison of the spectra for selected peptides are shown in
(366) Taken together, the peptide data shown in Table 4,
(367) To further confirm the cancer-specificity of these CLTs, the inventors processed 37 normal tissue samples (10 normal skin, 9 normal lung and 18 normal breast tissue) and prepared for immunopeptidomic analysis. The inventors interrogated the spectra of the HLA-Class I dataset from these normal tissue samples, searching for all possible peptide sequences derived from the polypeptide sequences of CLT antigens no.1, 2, 3 and 4. No peptides derived from CLT antigens no. 1, 2, 3 and 4 were detected in the set of normal tissue samples (Table 6) providing additional confirmation that the CLTs have cancer-specific expression.
(368) In summary: this additional identification of immunopeptidomic peptides derived from the predicted ORFs, further demonstrates that these CLTs are translated into polypeptides (SEQ ID NOs. 1-4; referred to as CLT antigens) in tumor tissue. Thus, these CLT antigens and fragments of them are expected to be useful in a variety of therapeutic modalities for the treatment of melanoma in patients whose tumors express these antigens.
(369) TABLE-US-00004 TABLE4 Listofpeptidesidentifiedbyadditionalimmunopeptidomicanalysesofmelanoma tumorsamples,alongwithCLTantigennameandcrossreferencetoSEQIDNOs. CLT Peptide CLT Ant. Peptide SEQ Ant. SEQ Patient Peptide Peptide #of sequence.sup.1 IDNO. NO. IDNO. #.sup.2 mass.sup.3 length Area.sup.4 spectra.sup.5 Ppm.sup.6 HLADRKL SEQ 1 SEQ 2MT3 1051.61 9 154000 2 1.4 SL IDNO. IDNO. 13 1 HLADRKL SEQ 1 SEQ 2MT10 1051.61 9 ND 1 3.4 SL IDNO. IDNO. 13 1 VVRGGAG SEQ 1 SEQ 2MT3 1059.594 11 985000 6 0.9 FAAR IDNO. IDNO. 12 1 SSFSTLAS SEQ 2 SEQ 2MT4 1154.582 11 559000 1 0.9 LDK IDNO. IDNO. 16 2 NTPNIVSL SEQ 3 SEQ 2MT3 1012.567 9 884000 1 2.8 R IDNO. IDNO. 17 3 RPLRIKGV SEQ 3 SEQ 1MT1 1084.6869 9 19400000 7 0 F IDNO. IDNO. 53 3 AAFDRAV SEQ 4 SEQ 2MT3 1032.514 9 ND 1 1.3 HF IDNO. IDNO. 51 4 KTKGSLS SEQ 4 SEQ 2MT3 1121.6556 10 10100000 6 0.7 VFR IDNO. IDNO. 19 4 KTKGSLS SEQ 4 SEQ 2MT1 1121.6556 10 10100000 2 0.7 VFR IDNO. IDNO. 19 4 KTKGSLS SEQ 4 SEQ 2MT12 965.555 9 4830000 1 1.2 VF IDNO. IDNO. 54 4 ND - Not determined .sup.1HLA Class I peptides identified by mass spectrometry. .sup.2Inventors'dataset (1MT1, 1MT2, 1MT3, 2MT1, 2MT2, 2MT3, 2MT4, 2MT9, 2MT10, 2MT12). .sup.3Calculated peptide mass. .sup.4Peaks program Area from mass spectrum; selected Area values are shown for peptides for which more than one spectrum was obtained. .sup.5Number of spectra in which peptide was detected. .sup.6Deviation between observed mass and calculated mass; selected ppm values are shown for peptides for which more than one spectrum was obtained.
(370) TABLE-US-00005 TABLE5 PredictedNetMHC4.0bindingofMassSpectrometry-identifiedpeptides(length9 residues)to12HLAClassISupertypeAlleles(HLA-A0101,HLA-A0201,HLA-A0301,HLA- A2402,HLA-A2601,HLA-B0702,HLA-B0801,HLA-B1501,HLA-B2705,HLA-B3901,HLA- B4001,HLA-B5801),alongwithCLTantigennameandcrossreferencetoSEQIDNOs. Number Predictedto Numberof ofalleles bind12 alleleswith witha humanHLA arank rank CLT ClassIA&B scoreof scoreof PeptideSEQ Antigen Patient supertypes.sup.1 Peptidesequence <5.1%.sup.2 <2.1%.sup.3 IDNO No. #.sup.4 YES HLADRKLSL 6/12 3/12 SEQID 1 2MT3 NO.13 2MT10 YES VVRGGFAGFAAR 3/12 0 SEQID 1 2MT3 NO.12 YES SSFSTLASLDK 7/12 3/12 SEQID 2 2MT4 NO.16 YES NTPNIVSLR 1/12 1/12 SEQIDNO. 3 2MT3 17 YES RPLRIKGVF 2/12 2/12 SEQIDNO. 3 2MT1 53 YES AAFDRAVHF 12/12 6/12 SEQIDNO. 4 2MT3 51 YES KTKGSLSVFR 4/12 2/12 SEQIDNO. 4 2MT1 19 2MT3 YES KTKGSLSVF 7/12 4/12 SEQIDNO. 4 2MT12 54 .sup.1Predicted binding to interrogated HLA Class I supertypes at any Rank score. .sup.2Fraction of HLA Class I supertypes that were predicted to bind with a rank score of <5.1% (weak binding). .sup.3Fraction of HLA Class I supertypes that were predicted to bind with a rank score of <2.1% (stronger binding). .sup.4Inventor's database (1MT1, 1MT2, 1MT3, 2MT1, 2M12, 2M13, 2M14, 2M19, 2MT10, 2M112).
(371) TABLE-US-00006 TABLE 6 Number of peptides-derived from CLT Antigens 1 to 4 in a set of normal tissue samples. Antigen Skin Lung Breast CLT Antigen 1 0/10 0/9 0/18 CLT Antigen 2 0/10 0/9 0/18 CLT Antigen 3 0/10 0/9 0/18 CLT Antigen 4 0/10 0/9 0/18
(372) The results presented here in Examples 1, 2 and 2.1 are in whole or part based upon data generated by the The Cancer Genome Atlas (TCGA) Research Network (http://cancergenome.nih.gov/); and the Genotype-Tissue Expression (GTEx) Project (supported by the Common Fund of the Office of the Director of the National Institutes of Health, and by NCI, NHGRI, NHLBI, NIDA, NIMH, and NINDS).
Example 3HERVFEST
(373) Functional expansion of specific T-cells (FEST) technology has been used to identify therapeutically relevant tumor-derived epitopes present in the mutation-associated neoantigen (MANA) repertoire found in tumor cells of cancer patients based on detection of patient T-cells that react to MANA epitopes (Anagnostou et al., Cancer Discovery 2017; Le et al., Science 2017; Forde et al., NEJM 2018; Danilova et al., Cancer Immunol. Res. 2018). Application of FEST technology to CLT antigens discovered by using the methods elucidated in Example 1, 2, & 2.1 (Tables 1-6,
(374) Like other assays (e.g., ELISPOT) to identify epitope-specific T-cells in a subject who has undergone immune exposure, FEST technologies derive their specificity by activating/expanding the cognate T-cells in ex vivo cultures that include antigen-presenting cells and suitable antigenic peptides. The technique differs from other immunological assays in that it utilizes next-generation sequencing of the T-cell receptor (TCR) DNA sequences present in these amplified cultures (specifically: TCRseq targeting the TCR-V CDR3 region) to detect the specific TCRs that are expanded in the cells cultured with individual peptides from a panel of target peptides derived from an antigen (or antigens). Application of TCRseq to tumor tissues in the same patient can also be used to demonstrate if TCRs/T-cells detected in the ex vivo, peptide-stimulated cultures are also present within the tumor-infiltrating lymphocytes found in cancer tissues in situ. Thus, MANAFEST has proven to be a powerful technology for identifying MANA epitopes that are recognized by patient T-cells, permitting identification of functionally relevant MANA peptides among the multitude of mutant peptides found by whole-exome sequencing of normal and tumor tissues from cancer patients (Le et al., Science 2017; Forde et al., NEJM 2018; Danilova et al., Cancer Immunol. Res. 2018; Smith et al., J Immunother Cancer 2019).
(375) Application of MANAFEST methodology (Danilova et al., Cancer Immunol. Res. 2018) to CLT antigens was performed as follows. The method, which we will refer to as HERVFEST, consists of the following steps: Step 1: Peptides predicted to contain epitopes that efficiently bind selected HLA Class I alleles were identified in CLT Antigens. Step 2: PBMCs from suitable melanoma patients were matched by HLA Class I type to the peptide library selected in step 1. Step 3: PBMCs from these patients were separated into T-cell and non T-cell fractions. Non T-cells were added back to the patient's T-cells, and then divided into 20-50 wells (containing 250,000 T-cells per culture) and propagated with various T-cell growth factors and individual CLT Antigen-derived synthetic peptides (selected in step ) for 10 days. Step 4: TCRseq (sequencing of the TCR-V CDR3 sequences) was performed on all wells, and TCR-V CDR3 sequences that were amplified in the presence of individual CLT Antigen-derived peptides (but not amplified in the presence of control peptides or in the absence of peptide stimulation) were identified. The presence of amplified TCR-V CDR3 sequences in individual wells of the assay thus identifies CLT Antigen-derived peptides that elicited an immune response in the melanoma patient. Step 5: TCRseq may also be performed on tumor samples to determine whether the T-cells bearing the CLT-Antigen amplified TCRs homed to patient tumors, providing additional evidence that T-cells bearing these TCRs recognize CLT Antigen-derived peptides within a patient's tumor.
(376) HERVFEST assays were performed with peptides derived from CLT Antigens 1-4 (SEQ ID NOs 1-4). The panel of peptides (see step 1 above) used for these studies was based on NetMHC predictions of CLT Antigen-derived peptides that were predicted to strongly bind the 8 HLA Class I types commonly found in patient tumor samples available for our analyses. CLT Antigen-derived peptides that amplified one or more TCRs in these HERVFEST assays are provided in Table 7. Table 7 also indicates the HLA Class I type(s) of the CLT antigen peptides that were tested with each patient's PBMC-derived cultures. The HLA Class I type of the patients whose PBMCs were tested in these studies and amplified one or more TCRs in the assays, are shown in Table 8.
(377)
(378) The control peptides/conditions used in these experiments were as follows: CEF=mixture of CMV, EBV, and influenza peptides; SL9, TV9 and QK1=HIV-1 control peptides; no peptide=cultivation in absence of peptide; Baseline=T-cells before culture.
(379)
(380) The properties of each HERVFEST detection are defined as follows: Plain text: Significant amplification of a single TCR Bold text: Significant amplification of multiple TCRs Underlined italics text: Significant amplification of a single TCR which was detected in other wells
(381) Underlined bold text: Significant amplification of multiple TCRs, at least one of which was detected in other wells
(382) These results provide strong evidence that CLT Antigens 1-4 are present in melanoma patients and that peptides derived from these CLT antigens have elicited specific T-cell responses in these melanoma patients, confirming the value of these CLT antigens as targets for therapeutic interventions to treat melanoma.
(383) TABLE-US-00007 TABLE7 CLTAntigen-derivedpeptidesthatamplifiedoneormoreTCRsinHERVFESTassays HLAClassI- typeforpeptide Reference (predictedby HERVFEST CLTAntigen SEQIDNO. Peptidesequence NetMHC) panelreference 1 SEQIDNO.55 VPANTYNALK HLA-A*03:01 37 1 SEQIDNO.56 RLGGCQAWWR HLA-A*03:01 41 1 SEQIDNO.57 ANTYNALKSR HLA-A*11:01 60 1 SEQIDNO.13 HLADRKLSL HLA-B*07:02 109 2 SEQIDNO.58 LVTDMVACRI HLA-A*01:01 8 2 SEQIDNO.59 LILDFQPLQL HLA-A*01:01 13 2 SEQIDNO.60 MSSFSTLASL HLA-A*01:01 15 2 SEQIDNO.59 LILDFQPLQL HLA-A*02:01 25 2 SEQIDNO.61 LMSSFSTLASL HLA-A*02:01 27 2 SEQIDNO.62 LMSSFSTLA HLA-A*02:01 23 2 SEQIDNO.63 QLMSSFSTLA HLA-A*02:01 26 2 SEQIDNO.64 MVACRIKTFR HLA-A*03:01 46 2 SEQIDNO.16 SSFSTLASLDK HLA-A*03:01 45 2 SEQIDNO.64 MVACRIKTFR HLA-A*11:01 67 2 SEQIDNO.65 VTDMVACRIK HLA-A*11:01 69 2 SEQIDNO.66 SPADSLIL HLA-B*07:02 119 2 SEQIDNO.78 SLILDFQPL HLA-A*02:01 20 3 SEQIDNO.67 NTPNIVSLRA HLA-A*01:01 18 3 SEQIDNO.68 VLLMRPLRIK HLA-A*11:01 78 3 SEQIDNO.69 MRPLRIKGVF HLA-B*07:02 124 4 SEQIDNO.70 FLFLELWL HLA-A*02:01 30 4 SEQIDNO.71 SVFRELHPA HLA-A*02:01 29 4 SEQIDNO.72 SPPSSTAPL HLA-B*07:02 132
(384) TABLE-US-00008 TABLE 8 Characteristics of the melanoma patient PBMCs used in HERVFEST assays HLA(s) HLA HLA HLA HLA HLA HLA targeted in allele allele allele allele allele allele HERVFEST Patient A1 A2 B1 B2 C1 C2 studies 204B A*01:01 A*25:01 B*03:01 B*16:01 C*07:01 C*12:03 A*01 222B A*02:01 A*30:02 B*44:02 Not C*05:01 B*18:01 A*02 known 224B A*02:01 A*03:01 B*35:01 B*40:02 C*04:01 C*02:02 A*02, A*03 293B A*02:01 A*30:01 B*13:02 B*44:02 C*06:02 C*05:01 A*02 254C A*11:01 A*32:01 B*15:01 B*56:01/ C*01:02 C*03:03 A*11 56:55 188B A*02:01 A*11:01 B8*7:02 B*14:02 C*07:02 C*08:02 A*11, B*07 271B A*01:01 A*01:01 B*08:01 B*08:01 C*07:01 C*07:01 A*01 225B A*02:01 A*03:01 B*07:02 B*51:01 C*07:02 C*14:02 A*03, B*07
Example 4Assays to Demonstrate High-affinity T-cells Specific for CLT Antigens have not been Deleted From Normal Subjects' T-cell Repertoire
(385) An ELISPOT assay may be used to show that CLT antigen-specific CD8 T-cells are present in the normal T-cell repertoire of healthy individuals, and thus have not been deleted by central tolerance due to the expression of cancer-specific CLT antigens in nave and thymic tissues in these patients. This type of ELISPOT assay comprises multiple steps. Step 1: CD8 T-cells and CD14 monocytes can be isolated from the peripheral blood of normal blood donors, these cells are HLA typed to match the specific CLT antigens being tested. CD8 T-cells can be further sub-divided into nave and memory sub-types using magnetically labelled antibodies to the memory marker CD45RO. Step 2: CD14 monocytes are pulsed with individual or pooled CLT antigen peptides for three hours prior to being co-cultured with CD8 T-cells for 14 days. Step 3: Expanded CD8 T-cells are isolated from these cultures and re-stimulated overnight with fresh monocytes pulsed with peptides. These peptides may include; individual CLT antigen peptides, irrelevant control peptides or peptides known to elicit a robust response to infectious (e.g., CMV, EBV, Flu, HCV) or self (e.g. Mart-1) antigens. Re-stimulation is performed on anti-Interferon gamma (IFN) antibody-coated plates. The antibody captures any IFN secreted by the peptide-stimulated T-cells. Following overnight activation, the cells are washed from the plate and IFN captured on the plate is detected with further anti-IFN antibodies and standard colorimetric dyes. Where IFN-producing cells were originally on the plate, dark spots are left behind. Data derived from such assays includes spot count, median spot size and median spot intensity. These are measures of frequency of T-cells producing IFN and amount of IFN per cell. Additionally, a measure of the magnitude of the response to the CLT antigen can be derived from the stimulation index (SI) which is the specific response, measured in spot count or median spot size, divided by the background response to monocytes with no specific peptide. A metric of stimulation strength is derived by multiplying the stimulation index for spot number by the stimulation index for spot intensity. In this way, comparisons of the responses to CLT antigens and control antigens can be used to demonstrate that nave subjects contain a robust repertoire of CLT antigen-reactive T-cells that can be expanded by vaccination with CLT antigen-based immunogenic formulations. Table 9 provides a list of CLT Antigen-derived peptides that induced significant CD8 T-cell responses from HLA-matched normal blood donors. The results are shown in
(386) TABLE-US-00009 TABLE9 CLTAntigen-derivedpeptidesthatinducedsignifi- cantCD8T-cellresponsesfromHLA-matchednormal blooddonors HLA-type Reference forpeptide CLT Peptide (predicted Antigen SEQIDNO. sequence byNetMHC) 1 SEQID.NO.73 RLQGSVTLV HLA-A*02:01 1 SEQID.NO.74 VPANTYNAL HLA-B*07:02 2 SEQID.NO.75 QLMSSFSTL HLA-A*02:01 4 SEQID.NO.76 FLELWLPEPML HLA-A*02:01 4 SEQID.NO.77 APLLGSEPL HLA-B*07:02
Example 5Staining Reactive T-cells with CLT Antigen Peptide Pentamers
(387) The presence and activity of circulating CD8 T-cells specific for CLT antigens in healthy donors and melanoma patients can be measured by using HLA Class I/peptide-pentamer (pentamer) staining and/or in vitro killing assays. Thus, application of these methodologies to CLT antigens discovered using the methods elucidated in Example 1, 2 and 2.1 (Tables 1-6,
(388) For these studies, CD8 T-cells isolated from healthy donor or patient blood are expanded using various cultivation methods, for example anti-CD3 and anti-CD28 coated microscopic beads plus Interleukin-2. Expanded cells can then be stained for specific CLT antigen-reactivity of their T-cell receptors using CLT peptide pentamers, which consist of pentamers of HLA Class I molecules bound to the relevant CLT Antigen peptide in the peptide-binding groove of the HLA molecule. Binding is measured by detection with phycoerythrin or allophycocyanin-conjugated antibody fragments specific for the coiled-coil multimerisation domain of the pentamer structure. In addition to the pentamer stain, further surface markers can be interrogated such as the memory marker CD45RO and the lysosomal release marker CD107a. Association of pentamer positivity with specific surface markers can be used to infer both the number and state (memory versus naive/stem) of the pentamer-reactive T-cell populations
(389) Pentamer stained cells may also be sorted and purified using a fluorescence activated cell sorter (FACS). Sorted cells may then be further tested for their ability to kill target cells in in vitro killing assays. These assays comprise a CD8 T-cell population, and a fluorescently labelled target cell population. In this case, the CD8 population is either CLT antigen-specific or CD8 T-cells pentamer-sorted and specific for a positive-control antigen known to induce a strong killing response such as Mart-1. The target cells for these studies may include peptide-pulsed T2 cells which express HLA-A*02, peptide-pulsed C1R cells transfected with HLA-A*02, 03 or B*07 or melanoma cells lines previously shown to express the CLTs/CLT antigens, or patient tumor cells. Peptides used to pulse the T2 or C1R cells include CLT antigen peptides or positive control peptides. Target cells may be fluorescently labelled with carboxyfluorescein succinimidyl ester (CFSE, a cell proliferation dye) and death is indicated by take up of 7AAD. In this way, as target cells are killed, by apoptosis mediated by CD8 T-cells, they gain red fluorescence and become dual red/green positive. Thus, application of such killing assays to pentamer-sorted, CLT antigen-specific CD8 T-cells can be used to enumerate the cytotoxic activity of CLT-antigen-specific T-cells in ex vivo cultures of melanoma patient or healthy donor T-cells.
Example 6Mouse Immunogenicity Studies
(390) To demonstrate the immunogenicity of CLT antigens, mice can be inoculated with replication-defective adenovirus vectors expressing one or more CLT antigens, and T-cells obtained from these mice can be tested for the presence of CLT antigen-specific T-cells using IFN ELISPOT assays (Mennuni et al., Int. J. Cancer, 2005). Briefly, mice are inoculated with CLT antigen-expressing recombinant adenoviruses, and at a suitable timepoint they are humanely euthanized, and preparations of spleen cells are loaded into wells of a multiwell dish derivatized with monoclonal antibodies to murine IFN, in the presence (or absence) of overlapping peptides corresponding to the CLT antigen. Following a suitable time, the immobilized IFN is stained with a different monoclonal antibody, permitting innumeration of the cells/spots which are then compared to total cells loaded into the well to give a quantitative readout of CLT antigen-reactive T-cells.
Example 7Assays to Validate CLT Expression in Melanoma Cells
(391) a) qRT-PCR Validation of CLT Expression in Melanoma Cell Lines
(392) Quantitative real-time polymerase chain reaction (qRT-PCR) is a widespread technique to determine the amount of a particular transcript present in RNA extracted from a given biological sample. Specific nucleic acid primer sequences are designed against the transcript of interest, and the region between the primers is subsequently amplified through a series of thermocyle reactions and fluorescently quantified through the use of intercalating dyes (SYBR Green). Primer pairs were designed against the CLTs and assayed against RNA extracted from melanoma cell lines. Non-melanoma cell lines were utilised as negative controls. Specifically, melanoma cell lines COLO 829 (ATCC reference CRL-1974), MeWo (ATCC reference HTB-65), SH-4 (ATCC reference CRL-7724) and control cell lines HepG2 (hepatocellular carcinoma, ATCC reference HB-8065), Jurkat (T-cell leukemia, ATCC reference TIB152) and MCF7 (adenocarcinoma, ATCC reference HTB-22) were expanded in vitro and RNA was extracted from 110.sup.6 snap-frozen cells and reverse transcribed into cDNA. qRT-PCR analysis WITH SYBR Green detection following standard techniques was performed with primers designed against two regions of each CLT, and reference genes. Relative quantification (RQ) was calculated as:
RQ=2[Ct(REFERENCE)Ct(TARGET)]
(393) The results of these experiments are presented in
(394) b) RNAScope Validation of CLT Expression in Melanoma Cells In Situ
(395) In situ hybridisation (ISH) methods of transcript expression analysis allow the presence and expression levels of a given transcript to be visualised within the histopathological context of a specimen. Traditional RNA ISH assays involve the recognition of native RNA molecules in situ with oligonucleotide probes specific to a short stretch of the desired RNA sequence, which are visualised through a signal produced by a combination of antibody or enzymatic-based colorimetric reactions. RNAScope is a recently developed in situ hybridization-based technique with more advanced probe chemistry ensuring specificity of the signal produced and allowing sensitive, single-molecule visulation of target transcripts (Wang et al 2012 J Mol Diagn. 14(1): 22-29). Positive staining for a transcript molecule appears as a small red dot in a given cell, with multiple dots indicative of multiple transcripts present.
(396) RNAScope probes were designed against the CLTs and assayed on sections of 12 formalin-fixed, paraffin-embedded cutaneous melanoma tumour cores. Scoring of the expression signal was performed on representative images from each core as follows: Estimated % cells with positive staining for the CLT probe, rounded up to the nearest 10 Estimated level of per cell expression across the given section as: 0 =no staining 1=1-2 dots per cell 2=2-6 dots per cell 3=6-10 dots per cell 4=>10 dots per cell
(397) Expression of each of each CLT was detected across a number of different patient tumour cores, independently validating the discovery of CLTs from tumour-derived RNAseq data and confirming homogeneity of expression within tumour tissue across certain samples and also highlighting the presence of at least one CLT in each patient core analysed.
(398) TABLE-US-00010 TABLE 10 Scoring of RNAScope in melanoma patient tissue cores CLT Antigen 1 CLT Antigen 2 CLT Antigen 3/4 (SEQ ID 33) (SEQ ID 34) (SEQ ID 35) % of % of % of positive positive positive Tissue Core cells Score cells Score cells Score Melanoma 61 10 1 80 4 10 1 Melanoma 62 80 2 80 2 100 4 Melanoma 63 100 4 0 0 100 4 Melanoma 64 0 0 0 0 100 3 Melanoma 65 70 3 0 0 80 4 Melanoma 66 100 3 50 2 90 3 Melanoma 67 100 3 100 4 50 2 Melanoma 68 0 0 0 0 100 3 Melanoma 69 90 3 100 4 100 4 Melanoma 70 0 0 0 0 70 3 Melanoma 71 0 0 0 0 80 4 Melanoma 72 100 3 100 4 60 2
(399) Throughout the specification and the claims which follow, unless the context requires otherwise, the word comprise, and variations such as comprises and comprising, will be understood to imply the inclusion of a stated integer, step, group of integers or group of steps but not to the exclusion of any other integer, step, group of integers or group of steps.
(400) All patents, patent applications and references mentioned throughout the specification of the present invention are herein incorporated in their entirety by reference.
(401) The invention embraces all combinations of preferred and more preferred groups and suitable and more suitable groups and embodiments of groups recited above.
(402) TABLE-US-00011 SEQUENCELISTING SEQIDNO.1(PolypeptidesequenceofCLTAntigen1) MWNFFRRELTSNGFPENFSLDVPANTYNALKSRLCDPNADHTSCPSPCSLHAAGALP GTGRQRWRVELAHLADRKLSLRDVSRLRQGGERRSGIAVKVVRGGAGFAARLQGSV TLVQQGWFFPRLGGCQAWWRMGAVVWCGELLTCTS SEQIDNO.2(PolypeptidesequenceofCLTAntigen2) MTGVLIRRGDLVTDMVACRIKTFRGHTEKAAICKTRKESSAETSPADSLILDFQPLQLM SSFSTLASLDK SEQIDNO.3(PolypeptidesequenceofCLTAntigen3) MNTPNIVSLRAHQPEVGIIPSVLLMRPLRIKGVFHHIHSPLHGENQGFTLCLQGAPPSSS V SEQIDNO.4(PolypeptidesequenceofCLTAntigen4) MAKTKGSLSVFRELHPAAAFDRAVHFLFLELWLPEPMLSSSPPSSTAPLLGSEPLRHW EASLSR SEQIDNO.5(PolypeptidesequenceofCLTAntigen5) MKRKANRWRLSLRNGLLPSTPRATQQIPMEFLNSRVADIPIKPW SEQIDNO.6(PolypeptidesequenceofCLTAntigen6) MRGFLWRVETRGVEGSMRGPQKVLGNRLPGAGRNARSRDNFAVW SEQIDNO.7(PolypeptidesequenceofCLTAntigen7) MVYYGNPESSPGISLVFGLLRLDRMQPGFSVSQEGDPVGITDHLGC SEQIDNO.8(PolypeptidesequenceofCLTAntigen8) MPAQLKFTLQVNPATKMRVTLLSQPMETYEGDVLGVQTPYSSDSTILVL SEQIDNO.9(PolypeptidesequenceofCLTAntigen9) MGSSRVGERMMEEESRTGQKVNPGNTGKLFVGVGISRIAKVKYGECGQGFSDKSDVI THQRTHTGGKPYVCRECGRALAGSQTSSVTRGHTQGRSLMSAESVSGALAGSQSSS FTRGHTGETPQSAGRMSKSLVIKPYLNSHKKTNVITTHLHTPALRWLQRKSANPLHSP RV SEQIDNO.10(PolypeptidesequenceofCLTAntigen10) MHSLQIFSLCLFTLLIVSFIVQKPFNLIRSNLSIFLLVEIAFEDLVMNYLPKLTSRRVFSRFS YMTFYSFRSYIKVFVSSQIDFFSLVKGRGPVQAHFSMWFCYSG SEQIDNO.11(peptidesequencederivedfromCLTAntigen1) VQQGWFFPR SEQIDNO.12(peptidesequencederivedfromCLTAntigen1) VVRGGAGFAAR SEQIDNO.13(peptidesequencederivedfromCLTAntigen1) HLADRKLSL SEQIDNO.14(peptidesequencederivedfromCLTAntigen1) ARLQGSVTL SEQIDNO.15(peptidesequencederivedfromCLTAntigen2) ADSLILDF SEQIDNO.16(peptidesequencederivedfromCLTAntigen2) SSFSTLASLDK SEQIDNO.17(peptidesequencederivedfromCLTAntigen3) NTPNIVSLR SEQIDNO.18(peptidesequencederivedfromCLTAntigen3) QPEVGIIPSVLLMRP SEQIDNO.19(peptidesequencederivedfromCLTAntigen4) KTKGSLSVFR SEQIDNO.20(peptidesequencederivedfromCLTAntigen5) RVADIPIKPW SEQIDNO.21(peptidesequencederivedfromCLTAntigen5) DIPIKPW SEQIDNO.22(peptidesequencederivedfromCLTAntigen5) RVADIPIKP SEQIDNO.23(peptidesequencederivedfromCLTAntigen6) RSRDNFAVW SEQIDNO.24(peptidesequencederivedfromCLTAntigen6) RSRDNFA SEQIDNO.25(peptidesequencederivedfromCLTAntigen7) SPGISLVF SEQIDNO.26(peptidesequencederivedfromCLTAntigen8) SSDSTILVL SEQIDNO.27(peptidesequencederivedfromCLTAntigen9) AGRMSKSLVIK SEQIDNO.28(peptidesequencederivedfromCLTAntigen9) PQSAGRM SEQIDNO.29(peptidesequencederivedfromCLTAntigen9) AGSQSSSFTRGHTGETPQ SEQIDNO.30(peptidesequencederivedfromCLTAntigen10) RSNLSIFL SEQIDNO.31(peptidesequencederivedfromCLTAntigen10) FSLCLFTL SEQIDNO.32(peptidesequencederivedfromCLTAntigen10) SRRVFSRFSYMTFYSFRSYIKVFV SEQIDNO.33(cDNAsequenceofCLTencodingCLTAntigen1) CGGGGCCAGTCTTTCCCGTGCTATTCTCGTGATAGTGAATAAGTCTCACAAGATCT GATGGGTTTATCAGGGGTTTTCATTTTGCTTCTTCCTCATTTTCTTTTGCTGCTGTAA TGTAAGAAACGCCTTTTGCCTCCTGCCATAATTCTGAGGCCTCACAGCCATGTGGA ACTTCTTCAGGAGAGAATTAACATCCAATGGATTCCCAGAAAACTTTTCCCTCGATG TACCAGCAAACACCTACAATGCCCTGAAAAGCCGCCTCTGCGACCCCAATGCAGA TCACACGTCCTGTCCCAGCCCCTGCAGCCTCCACGCGGCGGGTGCACTGCCAGG CACGGGAAGGCAGCGCTGGCGAGTAGAACTGGCCCATCTCGCAGATAGGAAGCT GAGCCTCAGGGACGTTTCACGCCTTCGTCAAGGTGGTGAGAGGAGGAGCGGGAT TGCCGTGAAGGTGGTGAGAGGAGGAGCGGGGTTTGCTGCCCGACTTCAGGGATC TGTCACCCTCGTCCAGCAGGGTTGGTTCTTCCCGAGGCTGGGAGGATGCCAAGCC TGGTGGAGGATGGGGGCGGTGGTGTGGTGTGGGGAGCTTCTGACTTGCACATCC TGAGGGAACCTTCTGCAGCTGATGTGTGAACTGGACCCCAGGCCGTGCCTCCGAG GAATCCCCAAGGCTATGGCCCCTCAGGTCCTGCTGGGGTGTTGGCCCCCACCTCT GCCTCAGAATGCAGGGGTTCTGCAGGGAAGCCGCAGACCAGCCTGCTGCCTTGG GCCCTAGGGACACTGCAGCCCCAGAAAGTACTGTGGGGGACAAAAGAGTTGTTTC TCGGGGGAGAAAACACCTGTGAGGAAATGCAGGTGCCACAGAGGGAAATCCTCCT GGGGAGGAGGGTACCTGTTCCATCCTCGGCCGACACGGGACTGCCTGGTGCCTG GTACCCACAGCCGCTACCTGCCGCACGCATCTCTCCATGGTTTGCTAATTACTTCC ATTAGTTTTAAACAAACTTGACAAGAGACAGAAGGGTCCAGAGAGAAATTAAATCTA ACTGTTTAAACATGT SEQIDNO.34(cDNAsequenceofCLTencodingCLTAntigen2) CACCTCCATCACTGCGAATTATAATTCGACATGAGATTTGGGAGATGACACAAAAC CAAACCATATCAGTCTTTAAAGAGTTAAGTTAAAATAAGCTCTTTAAAGTGGGCCCT AATCCAGTATGACTGGTGTTCTTATAAGAAGAGGAGATTTGGTCACAGACATGGTT GCATGCAGAATAAAGACTTTTCGAGGACACACTGAGAAGGCAGCCATCTGCAAAA CAAGGAAAGAGTCCTCAGCAGAAACCAGTCCTGCAGACTCCTTGATCTTGGACTTC CAGCCACTGCAATTGATGTCAAGCTTCAGCACCCTTGCATCTCTGGATAAATGAAA TGTCACCCCAGCTGCCGTCCTTGTTCAGATCTGTGCAATAAAGAGCAAAGCATAAA ACCAAGTCAAGGCTTTGAGGGAGTGACCTACAAAATGCATAATGTGAAACAATGCA AAAGCGAAAGGTGCAAAATCCCCATCAAAGAGCTGGAGGCTGACAGATGCGCCAG TGATAATTCCCATCTTCCAACACAGGAGCACAGCTTCCATTTTCCATAACAGAACAA CAGCCAGAGCAGCTGGAAGGCAGGGCCGCATCCCAGACTTCCACCAACAATGGG ATGAGACTTGACATCTGGAATCACAACCACAACAGACCTGAGAGACCCACCAGCTT GATGACAAGCTTCTTCTTTCAAAGAAAGGTATCAGTCTGGGGGACCTAGTGCTGCA AACCATGACAAATTAAGTGTGGCATCCCTCACTTGCATAATGGAACTCAGTGATATT TTTTAATTAACAAGAGTTATTTTTATGTAAGCTTCTCTCATTCCTCCACTGTGCGTGC TCGGGGGCTGGTGGTGAGGAAAAAGAAAACAGCTGTGCGGGAAGCATCAAGAAA AGGCAAGTCATGAAGTCTTAGAGATCAGTGACATGTAAGAAAAAGAGTGAGGAGAA AAATATTCCTACTAAAGTTTTCCATTTGTTTACCTTCCTTGTCACATAGACTTCCAAG AGTTAGAAGTCTAGGATTTGATCTCCAAATCTTCCTGGCAGATTACTCATCTTCATT TCATTCATATAGTCCAGGGGTTTGTACAAAGGAAGATGCCAGTTCTTCCCCAATCA TAACTAAGATATCAAGAGATATTCTTTTGAAATGTAACAAAGGAGATCTGAAGTTCA TCTGAAAAAAATAAATGGTTTTAGGCGGTCATGACCATGGGATGCTGGACCAGGAT GGTAAGCTTCAGGAAACAGAATCTGGAGAATGCCCAGCTGCTCCCACAGGAAGCA TCAGGGAAGAAGAAGAAGAGGTGTGAAGTCTGCCTTCTGCTCTGCTGGGATCCCT TTCACATCTCCTTTGCCTCCAGGCAGTTTTGGTTCCTGGCCATTTCCAGGTGTGAC TCACTCAGGATGGTAAGCATCTTCTCTCCTACCCAGAGTAGAGGATGAAGACCTCA TCTCAGAGGTTGAAGGGAGCTCCAGAGAGAGGTCTCAAACTTCCAGCATTAACTG CTAAAGAAGCTTCATGAGCTGCTGGAGAACCTGGGAAATGACCAATTATAGGGACA GAGCTCAAATACTCTGGGACACTCTAGTAGCTGAGAAAGTTCCAACTCCAGGGTGA TAGAGGACTGCCTGGCAAACCATCATCAAAGCAGAAGACCTGATACTAACATCACA GGCTATGGTTTATTACTGAAGATCAGTGCTTACACCCTGCCAGAGGTTCAGAAGCA AACTTATCATTGTTCTCCCTGGAGATGTTGGCCCACATTCTGAAAAGTGTGGTCAG TAGTAGCAACAGAAAGCAATTGTGCTTGCCAAGCACAATGTCACTGTCCCCAGCCC TTCCCCCAACACAACCCAGTAGGTGCTTCCTGGCTGCAAACTTGGGAAAGTCACTT GACCTGTCTGAGGTTCCACTTCCTAATCTGGCCTGGCGAAGATAAGAAAAACAGTT TATTTAAAGTGTCTAGCAAAGTGCTTGGACCAAAATAGGACCTCTGAAATGGTTATG GTAGTGCTGTTAAGGTGATGTTTTAAGTGCTGATGAGCACAAAGATGGGTAAGATA TTCCTTCTGTTAAAATCTACAGTCTAATGAGAGAGAACAAGATGAATGCACAATAAC TGTCATTCAGAACAGGATTATGAGAAGGTGTGAATTTCTGTGAAAAATCAGAACAG GGAGTAATATGATCCCAGGTGATTGGCAGGGGGTGGGGGTCTGGATTCAACTGGA GAGGGAGCTGGCAGGGAAGGCTTCCTGGAGGATGAGAGTTCAACAAGGGGCAGG TGTAGGATGTGGGTGGCCAAGTGACTGGGCAGAAGGAGCTGCAGAAGTAAGACC CCAAATCAGGAAGACAAGGGCCTGCTGAGAAACACGAGCTACAAAGTGCAAGTGC AGGAAGAGTTGGGATGAGATTAGAAGGGGGTCTGGGGCCAGACTGTGGAAGGCC CAAATGCCGGGCTAAGGAGTTTGTACTTAATTCAGTGGTCAACGGGGAGTCATTG GAGGCTGTTGAGCAGGAGAGTTGCTTTCTTTACAGCTGTGCCAGACTAAATTAAAC CTAAACAGTACTTTATAGCTGGAAAGGGAAGGCCCAGGAATAGCTCTTGACTCAGA AACAGGCATTGGGGAAGGTAATGAGAAACAGCCGTGACTGATCAAAGCAGAGAGG TTAATTAAATTTGTAATTATTGTGAAAGGCCATTAAAAACCCTAGTTCACTAGAGATA ACTGCTCTAGTGGGGCTTCAAAGACAAACGCTTCTTTTAACCTTGAATAGGGGGAT GTTTGCTTCTCTGTGGAGGAGATATGATTAAGATACTTAATAAATGGTAGATAAACA SEQIDNO.35(cDNAsequenceofCLTencodingCLTAntigens3and4) AAACACACTAAGGGCTTTGTTATGGACTGAAATGTGTCCTCTCCCCAGAGTCACAG GATTATGAAGCCATAATCCTCAATGTGACTATATTTGGAGCAGGGGCCTTTACAGA CATAATTAAATTAAATGAGGTCATAAGAGTGGGGCCCTAGTCTGATAGGACTGGTG TCCTTACAAGAAGAGGGAGAGTCCTCAGAGAGTCCTCTCTCTCGGCATGGACACA AAAGAAAAGCCATGTGAGGACACAGAGAGAAGGTGGCTGTCTACGAGCTAGGAAG AAAGGCCTCACCGGAAACCAACCCTCACAGCAGCTCCATCTTGGACTTCCAGCCT CCGGAACTGTGAGAAAATAAATGTTTGCAATTCAGGTCGGTTGTATTTTGTGAAGG CCATCCTAGCAAATGAATACTCCTAACATTGTCTCTTTAAGAGCTCACCAGCCTGA GGTAGGAATCATTCCATCTGTGTTACTAATGAGACCGCTGAGGATCAAAGGGGTTT TCCACCACATCCACTCACCTCTACATGGCGAAAACCAAGGGTTCACTCTCTGTCTT CAGGGAGCTCCACCCAGCAGCAGCGTTTGACAGAGCTGTTCACTTCCTCTTCCTG GAGCTGTGGCTTCCAGAGCCCATGCTCAGCAGTTCCCCTCCTTCTTCGACTGCTC CTCTCTTAGGCTCAGAGCCACTCAGACATTGGGAAGCAAGTTTGTCAAGATGACAG AGAACCGAGGTAATGGATTCGAGTGATGAAACAGGAAGTTCATTCATGAGTTTTTG GCCACACCTCCAAAGTGACGACTTAGCCAGAAATGGGATAACTGGGTTTCCCTACT TCTCTTTTATCATCCTCAATGAGAGTGACCAAATATTAGAGCTAGATGGAACCTTAG TGAAAATCTGGCTACTCGTCCCGTCCCACCAGCCTGCCACCCATTTCAAGTTTGAA GAGACAAAGACACATGGACCTTATGTAATTACTGGGGATTACCCCAGGAGTCTGTG GCAAAAGTCAGCTTCTTCCCTCCCTGCTTCCCCGCCCTGTCTCTGGTACTTTCTAC CAACACTGGGCTGTTTCTGTGATCACACTTAAGCGTACCTAACCTGCGAATGCTGT ATAGAAGGTGCTAATGAACATGATTTAGCTTTAACACTCAGTTTTCTAAAGGGACAC GTGGGGGCAGCAAATGTTTAGGCAAAAACAATTCCAGTTCTAGCCTCTACTGTCTA CATATGTGTATACATTTGGGAAACGTTTGGGAAAGGGATATTTGAGAGCTTCTTTTT CTTTTTTGTGGTTTAGTTATTTGATGATATTGAGATTGTTTCTGAGCCATGTGCTTCA ACATCGGATTGGGGATTTCAGAAAAAGTTTTAGTCACTGTGATTCCATTTAGCTTCC AAATGTGTCTCTGCTAAGAGACTTAAAAGCACTCATAAATAGCACGTGTGTCTTCTT TGCAGTGTTTGCTAATTTTGAGTCACATCTTTTTAGAAAATCATGAGATTTGGTGTC ACAGAGACTGGAATAAATATAGTCAAACTTATTGGTGAAGATTTCCTTTAGCTGTTT TCATAATCCATTTCCATTGTTATGATTATTGATGAATAAAACATTTTCTTTAGGTAGA TACTTCTTTTTTCCCCCCACCTTGATTTAATGTTTCCACTCTTATTGTCAAGTTTCTT ATTACTCCCTAATAACTCTCAATAAAATAATGATTCCTGGGAGATTATTCCTGCTTTC CTACTATCACCTGTTGATTTGAAAAGACAGAACAATACCGTAGAAGCTTCACTAATA CATTGAAAGATAAAATGATAATACTAAATACTAAAATATGAAAAGTGATACTAAAAGT GGAGTCCTGGCACTAGTATTTTTTTTTTTGAGTCTTTAAATTTTATTTATTTATTTTTG AATTTTTTAAAATTATATGTTATGTTCTGGGATACATGTGCAGAACGTGCAGGTTTG TTACATAGGTATACAGGTCTGGCACTAGTATTTTGTTGCCACAAAATATCAAGCATG TATCCAAACTGCTCAAGACACATTAAAGACACAGGTAATCTGTAGGCATATTCAGG CTTGTAGTTTGCATTTTTTGGTTTTCTTGTGGCTTTCAGTGCAAGTTGAGGTAATTC ATGGGAAACAGTCACCAAAGAAGTGCCAGTATTAGAAATCCAAGAGCCATTTCTCT AGCTTCTTCCAGAATCAAGACTTTAGAGGTAATTTCTATCAACACTGGACATTTCCT GTCTGCAATTAACAATGAACACATAGCATTATGTTTAATTGCAACCTGTTTAAAGCA GATTGGATGCTAAGGTTTAAGAACACTCTTCAGTCAAAAAGGTCTTTTAATCAGGTT TTTAATCTTGAGCACAATCTAGGACACAGCATCATAGACTAACTCATTCGAGAATAG GTGTTGTCATCTAATCCTAACCACCCCCACCACCAACAAGCTGAATAGCTCTGGGC TCAGTATATACATTTGTACTGGGCTCAGTACACACACCTAAGCTGGGTTCAGTATAT GCCACTTTATAGTGAGAGGCATTTTGTAATGAGAGCTCTGGGTTCACTATATACATT TGTACTGGGCTCA SEQIDNO36(cDNAsequenceofCLTencodingCLTAntigen5) GGGAGGGGGCCATGGCGGGGCCACTTCAAAGGAAAAGCTCTAGCTCCCCTACCT CTCTCACATCCTAAGGCTGCCTTTGTGGGATTCCACACAGAACAGCCTGGAAGCTT GGGGCCCTGGCTTCCTTTTCTGGCCTGGGAGTCAGGTCATGGGGCCATCGCTTCA CAGCAATCATGAGGGCCCAGGCCCAAGTGCTCACATGCTCCTCATGGGGACTGCT CCTCTTAAAGGGTGGGCCCTCCTCACCCAGCTCCCTGCCCTGGCCAAGGAGGAG GCTGAAAGAGCCTGAGCTGTGCCCTCTCCATTCCACTGCTGTGGCAGGGTCAGAA ATCTTGGATAGAGAAAACCTTTTGCAAACGGGAATGTATCTTTGTAATTCCTAGCAT GAAAGACTCTAACAGGTGTTGCTGTGGCCAGTTCACCAACCAGCATATCCCCCCTC TGCCAAGTGCAACACCCAGCAAAAATGAAGAGGAAAGCAAACAGGTGGAGACTCA GCCTGAGAAATGGTCTGTTGCCAAGCACACCCAGAGCTACCCAACAGATTCCTAT GGAGTTCTTGAATTCCAGGGTGGCGGATATTCCAATAAAGCCATGGTGAGAAAGG CATTCAGACATGGTGCCACTAGGATCACAGCTTTCATTGGCGGCCAGTCTCCCAG CCCCAAACTGCAGATACCTGGTCTTCTTCATGGCTGTGGCTCAATCTTCCTAGATA TTTCATTGAAAAACCAAGAGATATATCTGTGCACATGGCTTTTAGCCATGAGGCTTG GAAACTGGACACCACTGTAAAGAACATCTAGTGTCCCGTAAATCCATACCAAAGCT CTGAATCCACAAACCAGGCTCTGGCCCAACCCTGCAAACACACTCCATTGCTCCAT CTTCAGTAAAGGAAGACAAATTCATTTTTCTAATAACTGTGGACCTGCAGCCCCCTT AGATGTGTTGAGAGTCTTTGGAAATATTTTCCTCTGAGGTCTGTCCACAGCTTCCCT GGGCCTGCGCTCAGCTGGCCCGAGAAGGACCAAGGTCCCTCACATTTGCATGTAA ACAGGGAGTGCCCTCTGCCCTTCCAGTGAGCCCTGCCAGCGTGGGGGAGGCTTC AGCTCTGTGATCCGTTCCAGCTCACTCTGAATTACACTCCTACATGCCCAGTCACA GACTTTTTGCAATTTCATTTTATTTCACTGGCCCAACATCATTGTTAAAATAAAATTT AGCTGTGTTCCAAATGCTGCAATATACAGTCTTCTGAAATGGCACCCTACATATTAG CCCAGACACAAAGAAGCAGTTTATAGGAGACAAGGCATCTGAGCATTATTAGCCTC CTCCTCACTTTGAAGAGGTCAAGTTCATGGGTGGGCCCATGATCGCCTGACCCATT TACTCAACAACATCCTCATCCAACTTCTTGGGCCACTGTTCTAGCTAAGCCAGCTTT GGAACCTATTCCTCCAACATTAGGATTGCCAGATAAAATACAGGACACCCAGTTAT ATTTGAACTTCAGACATACATTGGATAAATTTTCAGTACAAGTATGTCCCAAATATTG CATGATTTATTGCATTTAATAAAAATGTTGTACTGAAACATTTTTCATTGTTCCTCTAA AATTCAAATTTAACTGGGTGTCTTGGTCTGTTTGGCTGCTATAACAAATTGCCTTAG GCTGGGGAATTTATAAACAACAGAAATTTATTGCTCACATTTCTAGAGTCTGGGAG GCCCAAGATCAAGGTGCCAGCAGATTTGGTGCCTGGCGAGGGCCCATCCTCTGCT TCATAGATAGCACCTTCTTGCTGTGTCCTCACATGGCAGAAGCAGAGAACAAGCTC TCTGAGTCCTC SEQIDNO37(cDNAsequenceofCLTencodingCLTAntigen6) CTTGGACTTCCCAGCCTCCAGAACTGTGAGAAATAAATTTTTGTTGTTTAATCCATC CAGTCTGTGATATTTTGTTATGGCAGCTGAAGCAGTCAGGAAAGGATCCTCCCCAT CTCTGCAGAAGCCTGACCATCCCCCTAGAGGGCCTGGGAGGAAGTGGGTTTTGCA TACAGTCCCTGTTGACTCTAGTGCCCCCTGCTGGCCCCAGACGCGAGTTCCGGCG AGGCTTCAGGGTACAGCTCCCCCGCAGCCAGAAGCCGGGCCTGCAGCGCCTCAG CACCGCTCCGGGACACCCCACCCGCTTCCCAGGCGTGACCTGTCAACAGGTCTGT ATTGGCGACAAAAGGAGCAGCCCTGAATGTAGGGAAAGCAGGGCGGAGTCCTCT GCAGGCTCGGGGGAGGGGAGGGGCGTGAATGCGTGGATTTCTGTGGAGAGTGG AAACACGGGGAGTCGAGGGGAGCATGCGCGGGCCTCAGAAAGTTCTGGGAAACC GACTCCCGGGAGCAGGGAGGAACGCGCGCTCCAGAGACAACTTCGCGGTGTGGT GAACTCTCTGAGGAAAAACACGTGCGTGGCAACAAGTGACTGAGACCTAGAAATC CAAGCGTTGGAGGTCCTGAGGCCAGCCTAAGTCGCTTCAAAATGGAACGAAGGCG TTTGTGGGGTTCCATTCAGAGCCGATACATCAGCATGAGTGTGTGGACAAGCCCA CGGAGACTTGTGGAGCTGGCAGGGCAGAGCCTGCTGAAGGATGAGGCCCTGGCC ATTGCCGCCCTGGAGTTGCTGCCCAGGGAGCTCTTCCCGCCACTCTTCATGGCAG CCTTTGACGGGAGACACAGCCAGACCCTGAAGGCAATGGTGCAGGCCTGGCCCT TCACCTGCCTCCCTCTGGGAGTGCTGATGAAGGGACAACATCTTCACCTGGAGAC CTTCAAAGCTGTGCTTGATGGACTTGATGTGCTCCTTGCCCAGGAGGTTCGCCCCA GGAGGTGGAAACTTCAAGTGCTGGATTTACGGAAGAACTCTCATCAGGACTTCTG GACTGTATGGTCTGGAAACAGGGCCAGTCTGTACTCATTTCCAGAGCCAGAAGCA GCTCAGCCCATGACAAAGAAGCGAAAAGTAGATGGTTTGAGCACAGAGGCAGAGC AGCCCTTCATTCCAGTAGAGGTGCTCGTAGACCTGTTCCTCAAGGAAGGTGCCTGT GATGAATTGTTCTCCTACCTCATTGAGAAAGTGAAGCGAAAGAAAAATGTACTACG CCTGTGCTGTAAGAAGCTGAAGATTTTTGCAATGCCCATGCAGGATATCAAGATGA TCCTGAAAATGGTGCAGCTGGACTCTATTGAAGATTTGGAAGTGACTTGTACCTGG AAGCTACCCACCTTGGCGAAATTTTCTCCTTACCTGGGCCAGATGATTAATCTGCG TAGACTCCTCCTCTCCCACATCCATGCATCTTCCTACATTTCCCCGGAGAAGGAAG AGCAGTATATCGCCCAGTTCACCTCTCAGTTCCTCAGTCTGCAGTGCCTGCAGGCT CTCTATGTGGACTCTTTATTTTTCCTTAGAGGCCGCCTGGATCAGTTGCTCAGGCA CGTGATGAACCCCTTGGAAACCCTCTCAATAACTAACTGCCGGCTTTCGGAAGGG GATGTGATGCATCTGTCCCAGAGTCCCAGCGTCAGTCAGCTAAGTGTCCTGAGTCT AAGTGGGGTCATGCTGACCGATGTAAGTCCCGAGCCCCTCCAAGCTCTGCTGGAG AGAGCCTCTGCCACCCTCCAGGACCTGGTCTTTGATGAGTGTGGGATCACGGATG ATCAGCTCCTTGCCCTCCTGCCTTCCCTGAGCCACTGCTCCCAGCTTACGACCTTA AGCTTCTACGGGAATTCCATCTCCATATCTGCCCTGCAGAGTCTCCTGCAGCACCT CATCGGGCTGAGCAATCTGACCCACGTGCTGTATCCTGTCCCCCTGGAGAGTTAT GAGGACATCCATGGTACCCTCCACCTGGAGAGGCTTGCCTATCTGCATGCCAGGC TCAGGGAGTTGCTGTGTGAGTTGGGGCGGCCCAGCATGGTCTGGCTTAGTGCCAA CCCCTGTCCTCACTGTGGGGACAGAACCTTCTATGACCCGGAGCCCATCCTGTGC CCCTGTTTCATGCCTAATTAGCTGGGTGCACATATCAAATGCTTCATTCTGCATACT TGGACACTAAAGCCAGGATGTGCATGCATCTTGAAGCAACAAAGCAGCCACAGTTT CAGACAAATGTTCAGTGTGAGTGAGGAAAACATGTTCAGTGAGGAAAAAACATTCA GACAAATGTTCAGTGAGGAAAAAAAGGGGAAGTTGGGGGTAGGCAGATGTTGACT TGAGGAGTTAATGTGATCTTTGGGGAGATACATCTTATAGAGTTAGAAATAGAATCT GAATTTCTAAAGGGAGATTCTGGCTTGGGAAGTACATGTAGGAGTTAATCCCTGTG TAGACTGTTGTAAAGAAACTGTTGAAAATAAAGAGAAGCAATGTGAAGC SEQIDNO38(cDNAsequenceofCLTencodingCLTAntigens7and8) GAGACAGGTCTCACTCTGTTGCCCGGTCAGGAAAGTGGCACAATCACAGCTCACT GCAGTCTCAGTCTCCCAGGCTCAAGATGGATACATTTAAGGTATGGTGATCCGGTC CACCGTGTGGTTAGGATTCCCAAATTTTGTTGACAGCGTCTCGGATATGAACCACA CGGAAATTTGGCCTGCTGCTTTCTGCGTGGGGAGTGCGATGTGGATCCAGCTGTT GTACAGTGCCTGCTTCTGGTGGCTGTTTTGCTATGCAGTGGATGCTTATCTGGTGA TCCGGAGATCGGCAGGACTGAGCACCATCCTGCTGTATCACATCATGGCGTGGGG CCTGGCCACCCTGCTCTGTGTGGAGGGAGCCGCCATGCTCTACTACCCTTCCGTG TCCAGGTGTGAGCGGGGCCTGGACCACGCCATCCCCCACTATGTCACCATGTACC TGCCCCTGCTGCTGGTTCTCGTGGCGAACCCCATCCTGTTCCAAAAGACAGTGAC TGCAGTGGCCTCTTTACTTAAAGGAAGACAAGGCATTTACACGGAGAACGAGAGG AGGATGGGAGCCGTGATCAAGATCCGATTTTTCAAAATCATGCTGGTTTTAATTATT TGTTGGTTGTCGAATATCATCAATGAAAGCCTTTTATTCTATCTTGAGATGCAAACA GATATCAATGGAGGTTCTTTGAAACCTGTCAGAACTGCAGCCAAGACCACATGGTT TATTATGGGAATCCTGAATCCAGCCCAGGGATTTCTCTTGTCTTTGGCCTTCTACG GCTGGACAGGATGCAGCCTGGGTTTTCAGTCTCCCAGGAAGGAGATCCAGTGGGA ATCACTGACCACCTCGGCTGCTGAGGGGGCTCACCCATCCCCACTGATGCCCCAT GAAAACCCTGCTTCCGGGAAGGTGTCTCAAGTGGGTGGGCAGACTTCTGACGAAG CCCTGAGCATGCTGTCTGAAGGTTCTGATGCCAGCACAATTGAAATTCACACTGCA AGTGAATCCTGCAACAAAAATGAGGGTGACCCTGCTCTCCCAACCCATGGAGACC TATGAAGGGGATGTGCTGGGGGTCCAGACCCCATATTCCTCAGACTCAACAATTCT TGTTCTTTAGAACTGTGTTCTCACCTTCCCAACACTGCACTGCCGAAGTGTAGCGG CCCCCAAACCTTGCTCTCATCACCAGCTAGAGCTTCTTCCCGAAGGGCCTTTAGGA TAGGAGAAAGGGTTCATGCACACACGTGTGAGA SEQIDNO39(cDNAsequenceofCLTencodingCLTAntigen9) CCTGTAGTCCCAGCTACTCAGGAGGCTGAGGCAGGAGAATTGCTTGAATCCGGGA GGCGGAGGTTGCAGTGAGGGGAGATTGTGCCACTGCACTCCAGCCTGGGCGACA GAGGGAGACTCCATATCAAAAAGAAAAAAAAATCTCTAGAGTTTGGAAACATTTACC AACCAAACCACTGATTTCTCATCACCTCTTAGTCAAACCTCCTTGGATGGCCTTCAG AGGAGAACAGAGTAAACACCAGAAGAACTCAGGAGGAAGGAGACTGAAGGAAAGA TGTATAGCCTGCGAGAAAGAAAGGGTCATGCATACAAAGAGATCAGCGAGCCACA GGATGATGACTACCTCTATTGTGAGATGTGTCAGAACTTCTTCATTGACAGCTGTG CTGCTCATGGGCCCCCTACATTTGTAAAGGACAGTGCAGTGGACAAGGGGCATCC CAACCGTTCAGCCCTCAGTCTGCCCCCGGGGCTGAGAATTGGGCCATCAGGCATC CCTCAGGCTGGGCTTGGAGTATGGAACGAGGCATCTGATCTGCCACTGGGTCTGC ACTTTGGCCCCTATGAGGGCCGAATTACAGAAGACGAAGAGGCAGCCAACAGTGG ATATTCCTGGCTAATCACCAAGGGGAGAAACTGCTATGAGTATGTGGATGGAAAAG ATAAATCCTCGGCCAACTGGATGAGAACCAAAGCCAGAGATCCATCCATGTCCCTC ATGCTGTCTGGCCTTTTCAAGTCAAAAATTTCTCAGTCAACATGTGGAACGCAATCA CTCCTCTCAGAACTTCCCAGGACCATCTGCAAGAAAACTTCTCCAACCAGAGAATC CCTGCCCAGGGGATCAGAATCAGGAGCGGCAATATTCTGATCCACGCTGCTGTAA TGACAAAACCAAAGGTCAAGAGATCAAAGAAAGGTCCAAACTCTTGAATAAAAGGA CATGGCAGAGGGAGATTTCAAGGGCCTTTTCTAGCCCACCCAAAGGACAAATGGG GAGCTCTAGAGTGGGAGAAAGAATGATGGAAGAAGAGTCCAGAACAGGCCAGAAA GTGAATCCAGGGAACACAGGCAAATTATTTGTGGGGGTAGGAATCTCAAGAATTGC GAAAGTCAAATATGGAGAGTGTGGGCAAGGTTTCAGTGATAAGTCAGATGTTATTA CACACCAAAGGACACACACAGGGGGGAAGCCCTACGTCTGCAGAGAGTGTGGGA GGGCTTTAGCCGGAAGTCAGACCTCCTCAGTCACCAGAGGACACACACAGGGGA GAAGCCTTATGTCTGCAGAGAGTGTGAGCGGGGCTTTAGCCGGAAGTCAGTCCTC CTCATTCACCAGAGGACACACAGGGGAGACGCCCCAGTCTGCAGGAAGGATGAG TAAGTCATTAGTAATAAAACCTTATCTCAATAGCCACAAGAAGACAAACGTGATCAC CACACACTTGCACACCCCAGCTCTGAGGTGGCTTCAGCGAAAGTCTGCTAACCCC TTACATTCCCCGAGAGTGTAAAGAGATCGGAAATAACTAATTAAACAAATCCGCCA CTTTCATGACTAGAGTTGAGGAAGAACAGGGGATAGTTCTGTAAGTGTTCGGGGG ACGTCAACATGTGTGGTTGTTTCCCGCACTGATCCCCTCCATTTTTTGTGTTTTGCC TCCTGTTCTAATTAATTTTGTCTCCATACATATCTGAACCCCAAGTGTGTACCTCATT CTTCCCTTATCACTGAAGGAAGGAAGAGTCCAGAAGGGCCACAGAGAACTCAAAC GTTCAGTTCAAGTCTCCACAGGAATTCAACCCCAGAAAGACATAAACTTGGAGTCC ATCTGGTTTAATTATTGGAGAATCGATTCCCAAGTCCAGGAAGAGAAATGTAGGGT TTTACAGAGTCGCAGCAGGAAAGAGAGCTCCCTGGTCTCCTGGGAAGTGTGACCT CTTCTAATGGACCCCTCTCCTCTGCTGCCATACTCCCCCTTGGCTCCCCCTGTCTC CTCTCCTGATTTCCTCCAATCTCTGTAGCCCCAGAAGTGAACGCCAGACAGGAACA CGCATGTGTGTATATATGTGTTCACGTGTGCTATGTGTGTTAAGCCTGCATGCATG GGTGTGGGGGTATGTGCCCTCTGTGTACGTATCTGTGTGAGTGTGGGGGTTTCAA GGGTGTATTAGGAATAACGCTCAAAATCCTAAGGAAATTGAATACTCTGAGAGAAG AGAGACAGACCCTCTCATACTGTTTTATATTGTTTTATACTCAGAAAAGGAAAAAGA AGCAAAACTAAAGGCAGGTAGCCTGGCGCCTAGGAACCAGACCTGAAACCAAGGA ACCAGACCCGAAACCAGGCCTGGGCCGGCCTGACCTAAGCCTGGTAGTTAAAATT CGACCCCTGACCTAGCAACTGATGTTATCTATAGATTATAGAAAGACATTGTGAAAC TTCCCGGTCTGTTCTGTTCCACTCTGACCATCGGTGCATGCAGCCCCTGTCACCTA CCCCCTGCTTGCTCAATCGATCACGACCCTCTCACGTGGACCCCCTTAGAGTTGTG AGCCCTTAAAAGGGACAGGAATTGCTCACTCGGGGAGCTCGGCTCTTGAGACAGC AGTCTTGCTGATGCTCCTGGCCGAATAAACCGCTTCCTTCTTT SEQIDNO40(cDNAsequenceofCLTencodingCLTAntigen10) CCCACCTACTGATTTACCAACTCTTTTTCATTTCAACTTTTATTTTAGGTCCAGAGGG TACATGTGTGAGTTTGTTGCATGAGTATATTGTGTGACACTCATGTATGGGGTACAA ATAATCCCAACACCAATGTAGAGAACACAATATCCAATAGGCAGTTCTTCAGGCCC TTTCTCCATCCTGCCCTCCCCCACATGGTAGATCCCAGTGTCTATTGTGCCCATCT TTATGTCCATGCATAACCAATGTTTAGTTCCCACTTATAAGTGAGAGCATGCAGTAT TGGGCTTTCTGTGCCCACATTAATTCACTTAAGATAATGGTCTCCAGCTGGATCCAT ATTGATGCAAAGTACATAATTTCTTTCATTTTATGGCTGCATAGTATTCCATGTTATG TTTGTACCACATTTTCTTTATCCAGTCCATAGCTGATGGACATCTACATTGATTCCAT GTCCTCATTAATGTGAATAGTGTTTTGATGAACATATGAATGTATGTGTCTTTTTGGT AGAATAATTTATTTTCCTTTGGATATAAAGCCAGTAATGGAATTGCTGGGTCGAATC GTCGTTCTTTTGTAAGTTCTTTGAGATATCTCCAAGTTTCGTTCCACAGGCACTGAA ATAGTTTACATTCCCACCAATAATGAACACGCATTCCCTTTTCTCCACAACCCTGTC AACATCTGTTATTTTTTTACTTTTTAATAGTAGCCATTCTGACTGGTGTGTGATGGTA CTTCATTATGGCTTTCATTCGCATTTCTTTCCTGACTTGTGATTTTGAGTAGTTTTTC ATATGTTTGTTGGCGACATGTATGTCTTCTGAGAAGAGCCTGTTCATGTTTTTTGCC CACTTCTTAACAGGGCTGTTCATCTTTTGCTTGTTGATTTGTTCAAGTTTCTTAGAGA TAGTGGATATTAGATCTCTGTTGGATGCATAGTTTGCAAATATTTTCTCTCTGTCTGT TTACCCTGTTGATAGTTTCTTTTATTGTGCAGAAACCCTTTAATTTAATCAGGTCCAA CTTATCCATTTTTCTTTTGGTTGAAATTGCTTTTGAGGACTTAGTTATGAATTATTTG CCAAAGCTGACGTCAAGAAGGGTATTCTCTAGGTTTTCTTATATGACATTTTATAGT TTTAGGTCTTATATTAAAGTCTTTGTTTCATCTCAAATTGACTTTTTTTCTCTGGTAAA AGGTAGGGGTCCAGTTCAAGCTCATTTTTCCATGTGGTTTTGTTACAGTGGGTAGC TGCAGACATGAGCTGGGCAGGAGAGGCCTCTTCCTAACAGGAATGTCAGGTGACC A SEQIDNO.41(cDNAsequenceencodingCLTAntigen1) ATGTGGAACTTCTTCAGGAGAGAATTAACATCCAATGGATTCCCAGAAAACTTTTCC CTCGATGTACCAGCAAACACCTACAATGCCCTGAAAAGCCGCCTCTGCGACCCCA ATGCAGATCACACGTCCTGTCCCAGCCCCTGCAGCCTCCACGCGGCGGGTGCACT GCCAGGCACGGGAAGGCAGCGCTGGCGAGTAGAACTGGCCCATCTCGCAGATAG GAAGCTGAGCCTCAGGGACGTTTCACGCCTTCGTCAAGGTGGTGAGAGGAGGAG CGGGATTGCCGTGAAGGTGGTGAGAGGAGGAGCGGGGTTTGCTGCCCGACTTCA GGGATCTGTCACCCTCGTCCAGCAGGGTTGGTTCTTCCCGAGGCTGGGAGGATGC CAAGCCTGGTGGAGGATGGGGGCGGTGGTGTGGTGTGGGGAGCTTCTGACTTGC ACATCC SEQIDNO.42(cDNAsequenceencodingCLTAntigen2) ATGACTGGTGTTCTTATAAGAAGAGGAGATTTGGTCACAGACATGGTTGCATGCAG AATAAAGACTTTTCGAGGACACACTGAGAAGGCAGCCATCTGCAAAACAAGGAAAG AGTCCTCAGCAGAAACCAGTCCTGCAGACTCCTTGATCTTGGACTTCCAGCCACTG CAATTGATGTCAAGCTTCAGCACCCTTGCATCTCTGGATAAA SEQIDNO.43(cDNAsequenceencodingCLTAntigen3) ATGAATACTCCTAACATTGTCTCTTTAAGAGCTCACCAGCCTGAGGTAGGAATCATT CCATCTGTGTTACTAATGAGACCGCTGAGGATCAAAGGGGTTTTCCACCACATCCA CTCACCTCTACATGGCGAAAACCAAGGGTTCACTCTCTGTCTTCAGGGAGCTCCAC CCAGCAGCAGCGTT SEQIDNO.44(cDNAsequenceencodingCLTAntigen4) ATGGCGAAAACCAAGGGTTCACTCTCTGTCTTCAGGGAGCTCCACCCAGCAGCAG CGTTTGACAGAGCTGTTCACTTCCTCTTCCTGGAGCTGTGGCTTCCAGAGCCCATG CTCAGCAGTTCCCCTCCTTCTTCGACTGCTCCTCTCTTAGGCTCAGAGCCACTCAG ACATTGGGAAGCAAGTTTGTCAAGA SEQIDNO.45(cDNAsequenceencodingCLTAntigen5) ATGAAGAGGAAAGCAAACAGGTGGAGACTCAGCCTGAGAAATGGTCTGTTGCCAA GCACACCCAGAGCTACCCAACAGATTCCTATGGAGTTCTTGAATTCCAGGGTGGC GGATATTCCAATAAAGCCATGG SEQIDNO.46(cDNAsequenceencodingCLTAntigen6) ATGCGTGGATTTCTGTGGAGAGTGGAAACACGGGGAGTCGAGGGGAGCATGCGC GGGCCTCAGAAAGTTCTGGGAAACCGACTCCCGGGAGCAGGGAGGAACGCGCGC TCCAGAGACAACTTCGCGGTGTGG SEQIDNO47(cDNAsequenceencodingCLTAntigen7) ATGGTTTATTATGGGAATCCTGAATCCAGCCCAGGGATTTCTCTTGTCTTTGGCCTT CTACGGCTGGACAGGATGCAGCCTGGGTTTTCAGTCTCCCAGGAAGGAGATCCAG TGGGAATCACTGACCACCTCGGCTGC SEQIDNO48(cDNAsequenceencodingCLTAntigen8) ATGCCAGCACAATTGAAATTCACACTGCAAGTGAATCCTGCAACAAAAATGAGGGT GACCCTGCTCTCCCAACCCATGGAGACCTATGAAGGGGATGTGCTGGGGGTCCA GACCCCATATTCCTCAGACTCAACAATTCTTGTTCTT SEQIDNO49(cDNAsequenceencodingCLTAntigen9) ATGGGGAGCTCTAGAGTGGGAGAAAGAATGATGGAAGAAGAGTCCAGAACAGGC CAGAAAGTGAATCCAGGGAACACAGGCAAATTATTTGTGGGGGTAGGAATCTCAA GAATTGCGAAAGTCAAATATGGAGAGTGTGGGCAAGGTTTCAGTGATAAGTCAGAT GTTATTACACACCAAAGGACACACACAGGGGGGAAGCCCTACGTCTGCAGAGAGT GTGGGAGGGCTTTAGCCGGAAGTCAGACCTCCTCAGTCACCAGAGGACACACACA GGGGAGAAGCCTTATGTCTGCAGAGAGTGTGAGCGGGGCTTTAGCCGGAAGTCA GTCCTCCTCATTCACCAGAGGACACACAGGGGAGACGCCCCAGTCTGCAGGAAG GATGAGTAAGTCATTAGTAATAAAACCTTATCTCAATAGCCACAAGAAGACAAACGT GATCACCACACACTTGCACACCCCAGCTCTGAGGTGGCTTCAGCGAAAGTCTGCT AACCCCTTACATTCCCCGAGAGTG SEQIDNO50(cDNAsequenceencodingCLTAntigen10) ATGCATAGTTTGCAAATATTTTCTCTCTGTCTGTTTACCCTGTTGATAGTTTCTTTTA TTGTGCAGAAACCCTTTAATTTAATCAGGTCCAACTTATCCATTTTTCTTTTGGTTGA AATTGCTTTTGAGGACTTAGTTATGAATTATTTGCCAAAGCTGACGTCAAGAAGGGT ATTCTCTAGGTTTTCTTATATGACATTTTATAGTTTTAGGTCTTATATTAAAGTCTTTG TTTCATCTCAAATTGACTTTTTTTCTCTGGTAAAAGGTAGGGGTCCAGTTCAAGCTC ATTTTTCCATGTGGTTTTGTTACAGTGGG SEQIDNO.51(peptidesequencederivedfromCLTAntigen4) AAFDRAVHF SEQIDNO.52(peptidesequencederivedfromCLTAntigen4) AFDRAVHF SEQIDNO.53(peptidesequencederivedfromCLTAntigen3) RPLRIKGVF SEQIDNO.54(peptidesequencederivedfromCLTAntigen4) KTKGSLSVF SEQIDNO.55(peptidesequencederivedfromCLTAntigen1) VPANTYNALK SEQIDNO.56(peptidesequencederivedfromCLTAntigen1) RLGGCQAWWR SEQIDNO.57(peptidesequencederivedfromCLTAntigen1) ANTYNALKSR SEQIDNO.58(peptidesequencederivedfromCLTAntigen2) LVTDMVACRI SEQIDNO.59(peptidesequencederivedfromCLTAntigen2) LILDFQPLQL SEQIDNO.60(peptidesequencederivedfromCLTAntigen2) MSSFSTLASL SEQIDNO.61(peptidesequencederivedfromCLTAntigen2) LMSSFSTLASL SEQIDNO.62(peptidesequencederivedfromCLTAntigen2) LMSSFSTLA SEQIDNO.63(peptidesequencederivedfromCLTAntigen2) QLMSSFSTLA SEQIDNO.64(peptidesequencederivedfromCLTAntigen2) MVACRIKTFR SEQIDNO.65(peptidesequencederivedfromCLTAntigen2) VTDMVACRIK SEQIDNO.66(peptidesequencederivedfromCLTAntigen2) SPADSLIL SEQIDNO.67(peptidesequencederivedfromCLTAntigen3) NTPNIVSLRA SEQIDNO.68(peptidesequencederivedfromCLTAntigen3) VLLMRPLRIK SEQIDNO.69(peptidesequencederivedfromCLTAntigen3) MRPLRIKGVF SEQIDNO.70(peptidesequencederivedfromCLTAntigen4) FLFLELWL SEQIDNO.71(peptidesequencederivedfromCLTAntigen4) SVFRELHPA SEQIDNO.72(peptidesequencederivedfromCLTAntigen4) SPPSSTAPL SEQIDNO.73(peptidesequencederivedfromCLTAntigen1) RLQGSVTLV SEQIDNO.74(peptidesequencederivedfromCLTAntigen1) VPANTYNAL SEQIDNO.75(peptidesequencederivedfromCLTAntigen2) QLMSSFSTL SEQIDNO.76(peptidesequencederivedfromCLTAntigen4) FLELWLPEPML SEQIDNO.77(peptidesequencederivedfromCLTAntigen4) APLLGSEPL SEQIDNO.78(peptidesequencederivedfromCLTAntigen2) SLILDFQPL