TREATMENT OF PATIENTS DIAGNOSED WITH PANCREATIC DUCTAL ADENOCARCINOMA USING MONOCLONAL ANTIBODIES AGAINST THE EPIDERMAL GROWTH FACTOR RECEPTOR (EGFR)
20250099582 ยท 2025-03-27
Assignee
Inventors
- Rikrik Asiyah ILYAS (Singapore, SG)
- Dirk STRUMBERG (Herne, DE)
- Dirk REUTER (Wedel, DE)
- Dirk M. BEHRINGER (Bochum, DE)
- Ferdinand BACH (Wedel, DE)
- Normando E. IZNAGA ESCOBAR (Singapore, SG)
Cpc classification
A61K39/395
HUMAN NECESSITIES
A61K45/06
HUMAN NECESSITIES
A61K31/7068
HUMAN NECESSITIES
G01N2800/52
PHYSICS
A61K31/517
HUMAN NECESSITIES
C12Q2600/106
CHEMISTRY; METALLURGY
A61K31/7068
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
International classification
A61K39/395
HUMAN NECESSITIES
A61K31/7068
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
Abstract
The present invention relates to the field of immunotherapy of cancer, in particular pancreatic ductal adenocarcinoma (PDAC). More specifically, the present invention provides means and methods for treatment of a population of PDAC patients suffering from PDAC tumors which express wild-type KRAS, HRAS or NRAS. The means and methods of the invention envisaged administration of an anti-EGFR antibody or antigen-binding fragment or peptide thereof to the patients. Means and methods for selecting patients and tumors for their responsiveness to the treatment are also provided herein.
Claims
1. A method of diagnosing and treating a patient having pancreatic ductal adenocarcinoma (PDAC) that is responsive to treatment with an anti-epidermal growth factor receptor (anti-EGFR) antibody, comprising: determining the mutational status of a Kirsten rat sarcoma virus (KRAS) gene in a PDAC tumor sample from the patient; diagnosing the patient as having PDAC that is responsive to treatment with an anti-EGFR antibody when the mutational status of the KRAS gene indicates that the PDAC tumor sample has a wild-type KRAS gene; and co-administering to the patient diagnosed as responsive to treatment with an anti-EGFR antibody gemcitabine and a chimeric or a humanized anti-EGFR monoclonal antibody which contains the following complementarity determining regions (CDRs): TABLE-US-00021 (SEQIDNO:1) CDR1ofthelightchain: RSSQNIVHSNGNTYLD, (SEQIDNO:2) CDR2ofthelightchain: KVSNRFS, (SEQIDNO:3) CDR3ofthelightchain: FQYSHVPWT, (SEQIDNO:4) CDR1oftheheavychain: NYYIY, (SEQIDNO:5) CDR2oftheheavychain: GINPTSGGSNFNEKFKT, (SEQIDNO:6) CDR3oftheheavychain: QGLWFDSDGRGFDF. wherein the co-administration of gemcitabine is antecedently, simultaneously and/or subsequently to administration of the monoclonal antibody, antigen binding fragment or peptide thereof.
2. The method of claim 1, wherein the wild-type KRAS is characterized in having a sequence corresponding to SEQ ID NO.: 7 or SEQ ID No. 24.
3. The method of claim 1, wherein the wild-type KRAS is characterized in that is capable of turning off the signaling pathway by catalyzing hydrolysis of guanosine triphosphates (GTP) to guanosine diphosphates.
4. The method of claim 1, wherein said chimeric monoclonal antibody comprises a variable region of the light chain corresponding to TABLE-US-00022 (SEQIDNO.:10) DVLMTQIPLSLPVSLGDQASISCRSSQNIVHSNGNTYLDWYLQKPGQSPN LLIYKVSNRFSGVPDRFRGSGSGTDFTLKISRVEAEDLGVYYCFQYSHVP WTFGGGTKLEIKRA a variable region of the light chain corresponding to TABLE-US-00023 (SEQIDNO.:11) QVQLQQPGAELVKPGASVKLSCKASGYTFTNYYIYWVKQRPGQGLEWIG GINPTSGGSNFNEKFKTKATLTVDESSTTAYMQLSSLTSEDSAVYYCTR QGLWFDSDGRGFDFWGQGTTLTVSS.
5. The method of claim 1, wherein said humanized monoclonal antibody, or antigen binding fragment or peptide thereof comprises a variable region of the light chain corresponding to TABLE-US-00024 (SEQIDNO.:12) DIQMTQSPSSLSASVGDRVTITCRSSQNIVHSNGNTYLDWYQQTPGKAPK LLIYKVSNRFSGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCFQYSHVP WTFGQGTKLQITRE a variable region of the heavy chain corresponding to TABLE-US-00025 (SEQIDNO.:13) QVQLQQSGAEVKKPGSSVKVSCKASGYTFTNYYIYWVRQAPGQGLEWI GGINPTSGGSNFNEKFKTX.sup.1X.sup.2TITVDESX.sup.3X.sup.4TAYMELSSLRSEDTA FYFCX.sup.5RQGLWFDSDGRGFDFWGQGSTVTVSS; whereinX.sup.1isRorK;X.sup.2isVorA;X.sup.3isTorS; X.sup.4isNorT;andX.sup.5isAorT or a variable region of the light chain corresponding to TABLE-US-00026 (SEQIDNO.:14) DIQMTQSPSSLSASVGDRVTITCRSSQNIVHSNGNTYLDWYQQTPGKAPK LLIYKVSNRFSGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCFQYSHVP WTFGQGTKLQITRE a variable region of the heavy chain corresponding to TABLE-US-00027 (SEQIDNO.:15) QVQLQQSGAEVKKPGSSVKVSCKASGYTFTNYYIYWVRQAPGQGLEWI GGINPTSGGSNFNEKFKTRVTITVDESSTTAYMELSSLRSEDTAFYFC TRQGLWFDSDGRGFDFWGQGSTVTVSS; or a variable region of the light chain corresponding to TABLE-US-00028 (SEQIDNO.:16) DIQMTQSPSSLSASVGDRVTITCRSSQNIVHSNGNTYLDWYQQTPGKAPK LLIYKVSNRFSGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCFQYSHVP WTFGQGTKLQITRE a variable region of the heavy chain corresponding to TABLE-US-00029 (SEQIDNO.:17) QVQLQQSGAEVKKPGSSVKVSCKASGYTFTNYYIYWVRQAPGQGLEWI GGINPTSGGSNFNEKFKTKATITVDESSTTAYMELSSLRSEDTAFYFC TRQGLWFDSDGRGFDFWGQGSTVTVSS; or a variable region of the light chain corresponding to TABLE-US-00030 (SEQIDNO.:18) DIQMTQSPSSLSASVGDRVTITCRSSQNIVHSNGNTYLDWYQQTPGKAPK LLIYKVSNRFSGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCFQYSHVP WTFGQGTKLQITRE a variable region of the heavy chain corresponding to TABLE-US-00031 (SEQIDNO.:19) QVQLQQSGAEVKKPGSSVKVSCKASGYTFTNYYIYWVRQAPGQGLEWI GGINPTSGGSNFNEKFKTRVTITVDESSTTAYMELSSLRSEDTAFYFC ARQGLWFDSDGRGFDFWGQGSTVTVSS; or a variable region of the light chain corresponding to TABLE-US-00032 (SEQIDNO.:20) DIQMTQSPSSLSASVGDRVTITCRSSQNIVHSNGNTYLDWYQQTPGKAPK LLIYKVSNRFSGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCFQYSHVP WTFGQGTKLQITRE, a variable region of the heavy chain corresponding to TABLE-US-00033 (SEQIDNO.:21) QVQLQQSGAEVKKPGSSVKVSCKASGYTFTNYYIYWVRQAPGQGLEWI GGINPTSGGSNFNEKFKTRVTITVDESTNTAYMELSSLRSEDTAFYFC TRQGLWFDSDGRGFDFWGQGSTVTVSS; or a variable region of the light chain corresponding to TABLE-US-00034 (SEQIDNO.:22) DIQMTQSPSSLSASVGDRVTITCRSSQNIVHSNGNTYLDWYQQTPGKAPK LLIYKVSNRFSGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCFQYSHVP WTFGQGTKLQITRE a variable region of the heavy chain corresponding to TABLE-US-00035 (SEQIDNO.:23) QVQLQQSGAEVKKPGSSVKVSCKASGYTFTNYYIYWVRQAPGQGLEWI GGINPTSGGSNFNEKFKTKATITVDESTNTAYMELSSLRSEDTAFYFC TRQGLWFDSDGRGFDFWGQGSTVTVSS.
6. The method of claim 1, wherein the constant regions of the heavy chain of said antibody, the antigen binding fragment or peptide thereof comprise the amino acid sequence of a gamma-1 chain of a human immunoglobulin and the constant regions of the light chain of said antibody comprise the amino acid sequence of a kappa chain of a human immunoglobulin.
7. The method of claim 1, wherein said monoclonal antibody, or antigen binding fragment or peptide thereof is produced by the cell line h-R3 deposited as ECACC 951110101.
8. The method of claim 7, wherein said monoclonal antibody is nimotuzumab.
9. The method of claim 1, wherein said monoclonal antibody, or antigen binding fragment or peptide thereof has one or more of the following properties: is capable of inhibiting binding of epidermal growth factor (EGF) to its receptor, is capable of inhibiting growth of EGF-dependent tumor cells, has antibody-dependent cellular cytotoxicity, has an anti-angiogenic effect, has a pro-apoptotic effect, causes an effect on cluster of differentiation 133 (CD133) positive cancer stem cells, has complement-mediated cytotoxic activity, induces cell cycle arrest, is capable of producing a synergetic effect in inhibiting proliferation of tumor cells if combined with N-acetyl GM3 ganglioside, is capable of producing a synergetic effect in inhibiting proliferation of tumor cells if combined with a monoclonal antibody against EGF, is capable of repairing tumor microsatellite instability produced by radiotherapy.
10. The method of claim 1, wherein said monoclonal antibody, or antigen binding fragment or peptide thereof recognizes both human EGFR present in normal cells and EGFR present in tumoral cells.
11. The method of claim 1, wherein determining the mutational status of a Kirsten rat sarcoma virus (KRAS) gene comprises amplifying a KRAS nucleic acid from the tumor and sequencing the nucleic acid and/or comprises detecting mutant and/or wild-type KRAS polypeptide in a sample of the PDAC tumor.
12. The method of claim 1, wherein the co-administration comprises intravenous infusion of 400 mg nimotuzumab once weekly and intravenous infusion of 1000 mg/m.sup.2 gemcitabine once weekly.
13. The method of claim 1, wherein the patient has been diagnosed with locally advanced and/or metastatic pancreatic ductal adenocarcinoma (PDAC).
Description
DESCRIPTION OF THE FIGURES
[0020] The invention will be better understood with reference to the detailed description when considered in conjunction with the non-limiting examples and the accompanying drawings. The figures illustrate embodiments of methods of the invention.
[0021]
[0022]
[0023]
[0024]
DETAILED DESCRIPTION
[0025] The present inventors provide herein, for the first time, a specific and effective treatment for a population of PDAC patients that has not been explicitly addressed in previous treatment approaches before. Herein, a novel method of treating PDAC patients whose tumors express wild-type KRAS, wild-type HRAS or wild-type NRAS is provided. The inventors have surprisingly discovered that the anti-EGFR antibody nimotuzumab has a beneficial therapeutic effect on patients suffering from such PDAC tumors. This was unexpected, as no or only minimal therapeutic benefits could be found in patients whose PDAC tumors expressed mutated KRAS (HRAS, NRAS), which by far constitute the majority of all PDAC patients.
[0026] Without wishing to be bound by theory, it is contemplated that those patients with KRAS, HRAS or NRAS mutated genes will not respond to the treatment with the anti-EGFR monoclonal antibody nimotuzumab, because the gene is activated, while patients with KRAS, HRAS or NRAS wilt type gene will respond to the therapy with anti-EGFR monoclonal antibody nimotuzumab.
[0027] In accordance with the foregoing, the present invention provides a method of treating a population of patients having been diagnosed with pancreatic ductal adenocarcinoma (PDAC), wherein the pancreatic ductal adenocarcinoma expresses the wild-type protein of at least one member of the RAS gene family selected from the KRAS wild-type, the HRAS wild-type or the NRAS wild-type, the method comprising administering to the patient a monoclonal antibody or an antigen binding fragment or peptide thereof which specifically binds epidermal growth factor receptor (EGF-R), wherein the antibody is a chimeric or a humanized monoclonal antibody which contains the following complementarity determining regions (CDRs):
TABLE-US-00004 (SEQIDNO:1) CDR1ofthelightchain: RSSQNIVHSNGNTYLD, (SEQIDNO:2) CDR2ofthelightchain: KVSNRFS, (SEQIDNO:3) CDR3ofthelightchain: FQYSHVPWT, (SEQIDNO:4) CDR1oftheheavychain: NYYIY, (SEQIDNO:5) CDR2oftheheavychain: GINPTSGGSNFNEKFKT, (SEQIDNO:6) CDR3oftheheavychain: QGLWFDSDGRGFDF.
[0028] Also envisaged herein is the treatment said population of PDAC patients by administration of a nucleic acid encoding a monoclonal antibody or an antigen binding fragment or peptide thereof as described herein, i.e. which specifically binds epidermal growth factor receptor (EGF-R), wherein the antibody is a chimeric or a humanized monoclonal antibody which contains the following complementarity determining regions (CDRs):
TABLE-US-00005 (SEQIDNO:1) CDR1ofthelightchain: RSSQNIVHSNGNTYLD, (SEQIDNO:2) CDR2ofthelightchain: KVSNRFS, (SEQIDNO:3) CDR3ofthelightchain: FQYSHVPWT, (SEQIDNO:4) CDR1oftheheavychain: NYYIY, (SEQIDNO:5) CDR2oftheheavychain: GINPTSGGSNFNEKFKT, (SEQIDNO:6) CDR3oftheheavychain: QGLWFDSDGRGFDF.
[0029] What is disclosed in the context of treatment of patients with the monoclonal antibody (fragment/peptide) in the following also applies to treatment with the nucleic acid encoding said monoclonal antibody (fragment/peptide), mutatis mutandis.
PDAC
[0030] The inventive methods relate to the treatment of pancreatic ductal adenocarcinoma, a pancreatic cancer. Pancreatic cancer is typically characterized by the presence of cancerous pancreatic cells and/or growth of a tumor mass in the pancreas. It is thus a physiological condition in a subject that is typically characterized by malignant cell growth in the pancreas. Malignant cells are not self-limited in their growth, are capable of invading into adjacent tissues, and may be capable of spreading to distant tissues (metastasizing). Malignant when used herein is synonymous with cancerous. PDAC, or pancreatic ductal adenocarcinoma, is a form of pancreatic cancer characterized by malignant cells derived from the pancreatic ductal epithelium.
KRAS
[0031] The methods and uses of the present invention are envisaged for treatment and/or stratification of PDAC patients whose PDAC tumors express a wild-type protein of at least one member of the RAS gene family. Said protein may be wild-type KRAS. The term wild-type KRAS refers to the naturally occurring KRAS isoforms (Uniprot Acc. No. P01116, version 190 of Jul. 22, 2015). It is in particular envisaged that wild-type KRAS comprises a sequence corresponding to SEQ ID NO.: 7 or SEQ ID No. 24. The wild-type KRAS may consist of a sequence corresponding to SEQ ID NO.: 7 or SEQ ID No. 24.
[0032] The term wild-type KRAS generally also encompasses KRAS polypeptides having mutations relative to the reference sequence shown in SEQ ID NO: 7 (KRAS4A) or SEQ ID No. 24 (KRAS4B) and also encompasses polypeptides having an amino acid sequence which shares as a certain degree of identity with the amino acid sequence shown in SEQ ID NO: 7 (KRAS4A, Uniprot Acc. No. P01116-1) or SEQ ID No. 24 (KRAS4B, Uniprot Acc. No. P01116-2) as described herein. More specifically, wild-type KRAS includes KRAS polypeptides having at least 80%, 85%, 90%, 95% or 100% identity with SEQ ID NO.: 7 (KRAS4A) or SEQ ID No. 24 (KRAS4B). In particular, KRAS isoforms 4A and 4B are encompassed by the term wild-type KRAS. Preferably, the wild-type KRAS does not comprise a mutation in its amino acid sequence compared to SEQ ID No. 7 or SEQ ID No. 24, respectively. Preferably, the wild-type KRAS does not comprise a mutation in any of amino acid residues of codon G12, G13, Q61, A146 or D154 of SEQ ID NO.: 7 or SEQ ID No. 24. The lacking mutation, i.e. the mutation not present in the wild-type KRAS amino acid sequence, may in particular be G12D, G12A, G12R, G12C, G12S, G12V and G13D.
[0033] The wild-type KRAS is preferably characterized in that it is capable of turning off the signaling pathways by catalyzing hydrolysis of guanosine triphosphates (GTP) to guanosine diphosphates. GTPase activity (i.e., capability of GTP hydrolysis to guanosine diphosphates) can be readily assessed using commercially available GTPase assay kits.
HRAS
[0034] The PDAC tumors of the patients to be treated and/or stratified according to the methods and uses of the invention may express wild-type HRAS. The term wild-type HRAS refers to the naturally occurring HRAS (Uniprot Acc. No. P01112, version 202 of Jul. 22, 2015). It is in particular envisaged that wild-type HRAS comprises a sequence corresponding to SEQ ID NO.: 8 or SEQ ID No. 25. The wild-type HRAS may consist of a sequence corresponding to SEQ ID NO.: 8 or SEQ ID No. 25.
[0035] The term wild-type HRAS generally also encompasses HRAS polypeptides having mutations relative to the reference sequence shown in SEQ ID NO: 8 or SEQ ID No. 25 and also encompasses polypeptides having an amino acid sequence which shares as a certain degree of identity with the amino acid sequence shown in SEQ ID NO: 8 or SEQ ID No. 25 as described herein. More specifically, wild-type HRAS includes HRAS polypeptides having at least 80%, 85%, 90%, 95% or 100% identity with SEQ ID NO.: 8 or SEQ ID No. 25. In particular, isoforms H-Ras4A (Uniprot Acc. No. P01112-1) and H-Ras (Uniprot Acc. No. P01112-2) are encompassed by the term wild-type HRAS. Preferably, the wild-type HRAS does not comprise a mutation in any of amino acid residues of does not comprise a mutation in any of amino acid residues of codon G12, G13, or Q61 of SEQ ID NO.: 8 or SEQ ID No. 25.
NRAS
[0036] The member of the RAS gene family which is expressed wild-type in the PDAC tumors of the patients to be treated and/or stratified according to the methods and uses of the invention may, additionally or alternatively, be NRAS. The term wild-type NRAS refers to the naturally occurring NRAS (Uniprot Acc. No. P01111, version 182 of Jul. 22, 2015). It is in particular envisaged that wild-type NRAS comprises a sequence corresponding to SEQ ID NO.: 9. The wild-type NRAS may consist of a sequence corresponding to SEQ ID NO.: 9.
[0037] The term wild-type NRAS generally also encompasses NRAS polypeptides having mutations relative to the reference sequence shown in SEQ ID NO: 9 and also encompasses polypeptides having an amino acid sequence which shares as a certain degree of identity with the amino acid sequence shown in SEQ ID NO: 9 as described herein. More specifically, wild-type NRAS includes NRAS polypeptides having at least 80%, 85%, 90%, 95% or 100% identity with SEQ ID NO.: 9. Preferably, the wild-type NRAS does not comprise a mutation in any of amino acid residues of does not comprise a mutation in any of amino acid residues of codon G12, G13, or Q61 of SEQ ID NO.: 9.
[0038] Sequence identity or % identity refers to the percentage of residue matches between at least two polypeptide or polynucleotide sequences aligned using a standardized algorithm. Such an algorithm may insert, in a standardized and reproducible way, gaps in the sequences being compared in order to optimize alignment between two sequences, and therefore achieve a more meaningful comparison of the two sequences. Sequence comparisons can be performed using standard software programs such as the NCBI BLAST program.
[0039] In the context of the invention, the expression position corresponding to another position (e.g., regions, fragments, nucleotide or amino acid positions, or the like) is based on the convention of numbering according to nucleotide or amino acid position number and then aligning the sequences in a manner that maximizes the percentage of sequence identity. Because not all positions within a given corresponding region need be identical, non-matching positions within a corresponding region may be regarded as corresponding positions. Accordingly, as used herein, referral to an amino acid position corresponding to amino acid position [X] of a specified protein sequence represents, in addition to referral to amino acid positions of the specified protein sequence, referral to a collection of equivalent positions in other recognized protein and structural homologues and families.
Anti-EGFR Antibody
[0040] The present inventors have discovered the therapeutic benefit of treating patients with a PDAC tumor expressing wild-type KRAS, HRAS or NRAS with a monoclonal antibody (or an antigen-binding fragment or peptide thereof) as defined herein.
[0041] As is well known in the art, an antibody is an immunoglobulin molecule capable of specific binding to a target through at least one epitope recognition site, located in the variable region of the immunoglobulin molecule. Antigen-binding fragments are also envisaged for use in the methods of the invention. The term antigen-binding fragment as used herein refers to a polypeptide fragment that contains all 6 CDRs of a VH and VL sequence set forth herein from monoclonal antibodies that specifically bind EGFR. The term comprises dAb, Fab, Fab, F (ab).sub.2, Fv), single chain Fvs (ScFv), diabodies, and minibodies comprising a scFv joined to a CH3 domain. Also included are synthetic variants, naturally occurring variants, fusion proteins comprising an antibody portion with an antigen-binding fragment of the required specificity and any other modified configuration of the immunoglobulin molecule that comprises an antigen-binding site or fragment (epitope recognition site) of the required specificity.
[0042] The monoclonal antibody (or antigen-binding fragment thereof) used in the methods of the invention is also termed anti-EGFR antibody herein. The term anti-EGFR antibody is used herein to denote the antibodies potential to specifically bind to EGFR. The expression antibody (fragment/peptide) is used herein as an abbreviation to denote the monoclonal antibody or antigen-binding fragment or peptide thereof as applied in the methods of the invention. EGFR or EGF-R refers to the epidermal growth factor receptor.
[0043] The monoclonal antibody or antigen-binding fragment or peptide thereof for use in accordance with the methods and uses of the invention is envisaged to specifically bind to epidermal growth factor receptor (EGF-R). Binding to EGF-R can be assessed by routine methods, e.g. by adding the antibody (fragment/peptide) to plates coated with (partially) purified EGFR and detecting antibody (fragment/peptide) binding to the EGFR by a solid phase, indirect immune-enzymatic assay as briefly described in European Patent EP 0586 002 B2. Specifically binding refers to the ability of a specific binding agent (here: the anti-EGFR antibody or an antigen-binding fragment or peptide thereof) to bind to its target (here: EGFR) with a greater affinity than it binds to a non-target. Binding affinity may for example be determined by an affinity ELISA, a BIAcore assay, a kinetic method, or an equilibrium/solution method. The anti-EGFR antibody (fragment/peptide) may be defined as specifically binding to EGFR when the dissociation constant between the antibody and its recognized epitope is less than 1 M, preferably less than 100 nM and more preferably less than 10 nM. Preferably, EGFR-binding characteristics of the antibody (fragment/peptide) used in the methods of the invention are comparable or equal to the EGFR-binding characteristics of the antibody disclosed in European Patent EP 0 586 002 B1 as ascertainable by the indirect immune-enzymatic assay described therein.
[0044] It is envisaged that the anti-EGFR antibody (fragment/peptide) may recognize or bind to both human EGFR present in normal, i.e. non-tumoral cells (normal EGFR) and EGFR present in tumoral cells (tumoral EGFR). Binding to both normal and tumoral EGFR can be easily assessed by using soluble EGFR obtained from non-malignant cells and EGFR obtained from malignant cells in the indirect immune-enzymatic assay described in European Patent EP 0 586 002 B1, respectively.
Chimeric Antibody
[0045] The monoclonal antibody applied in the methods of the invention may be a chimeric antibody (or antigen-binding fragment or peptide thereof). The term chimeric antibody refers to an antibody in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, as long as they exhibit the desired biological activity, i.e. (specifically) bind to EGFR.
[0046] It is envisaged that the chimeric antibody may comprise a variable region of the light chain corresponding to
TABLE-US-00006 (SEQIDNO.:10) DVLMTQIPLSLPVSLGDQASISCRSSQNIVHSNGNTYLDWYLQKPGQSPN LLIYKVSNRFSGVPDRFRGSGSGTDFTLKISRVEAEDLGVYYCFQYSHVP WTFGGGTKLEIKRA
a variable region of the heavy chain corresponding to
TABLE-US-00007 (SEQIDNO.:11) QVQLQQPGAELVKPGASVKLSCKASGYTFTNYYIYWVKQRPGQGLEWI GGINPTSGGSNFNEKFKTKATLTVDESSTTAYMQLSSLTSEDSAVYYC TRQGLWFDSDGRGFDFWGQGTTLTVSS.
Humanized Antibody
[0047] Humanized antibodies contain minimal sequence derived from the non-human antibody. In general, humanized antibodies are human immunoglobulins in which residues from a hypervariable region of the recipient are replaced by residues from a hypervariable region of a non-human species such as mouse, rat, rabbit or non-human primate having the desired biological effect, i.e. specifically bind to EGFR in the context of the present invention. In some instances, framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues. Furthermore, humanized antibodies may comprise residues that are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance. In general, the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin and all or substantially all of the FRs are those of a human immunoglobulin sequence. The humanized antibody optionally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
[0048] Particularly envisaged humanized monoclonal antibodies (or antigen-binding fragments) for use in the methods of the invention comprise the following variable regions:
[0049] a variable region of the light chain corresponding to
TABLE-US-00008 (SEQIDNO.:12) DIQMTQSPSSLSASVGDRVTITCRSSQNIVHSNGNTYLDWYQQTPGKAPK LLIYKVSNRFSGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCFQYSHVP WTFGQGTKLQITRE
a variable region of the heavy chain corresponding to
TABLE-US-00009 (SEQIDNO.:13) QVQLQQSGAEVKKPGSSVKVSCKASGYTFTNYYIYWVRQAPGQGLEWI GGINPTSGGSNFNEKFKTX.sup.1X.sup.2TITVDESX.sup.3X.sup.4TAYMELSSLRSEDTA FYFCX.sup.5RQGLWFDSDGRGFDFWGQGSTVTVSS; whereinX.sup.1isRorK;X.sup.2isVorA;X.sup.3isTorS; X.sup.4isNorT;andX.sup.5isAorT or
a variable region of the light chain corresponding to
TABLE-US-00010 (SEQIDNO.:14) DIQMTQSPSSLSASVGDRVTITCRSSQNIVHSNGNTYLDWYQQTPGKAPK LLIYKVSNRFSGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCFQYSHVP WTFGQGTKLQITRE
a variable region of the heavy chain corresponding to
TABLE-US-00011 (SEQIDNO.:15) QVQLQQSGAEVKKPGSSVKVSCKASGYTFTNYYIYWVRQAPGQGLEWI GGINPTSGGSNFNEKFKTRVTITVDESSTTAYMELSSLRSEDTAFYFC TRQGLWFDSDGRGFDFWGQGSTVTVSS; or
a variable region of the light chain corresponding to
TABLE-US-00012 (SEQIDNO.:16) DIQMTQSPSSLSASVGDRVTITCRSSQNIVHSNGNTYLDWYQQTPGKAPK LLIYKVSNRFSGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCFQYSHVP WTFGQGTKLQITRE
a variable region of the heavy chain corresponding to
TABLE-US-00013 (SEQIDNO.:17) QVQLQQSGAEVKKPGSSVKVSCKASGYTFTNYYIYWVRQAPGQGLEWI GGINPTSGGSNFNEKFKTKATITVDESSTTAYMELSSLRSEDTAFYFC TRQGLWFDSDGRGFDFWGQGSTVTVSS; or
a variable region of the light chain corresponding to
TABLE-US-00014 (SEQIDNO.:18) DIQMTQSPSSLSASVGDRVTITCRSSQNIVHSNGNTYLDWYQQTPGKAPK LLIYKVSNRFSGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCFQYSHVP WTFGQGTKLQITRE
a variable region of the heavy chain corresponding to
TABLE-US-00015 (SEQIDNO.:19) QVQLQQSGAEVKKPGSSVKVSCKASGYTFTNYYIYWVRQAPGQGLEWI GGINPTSGGSNFNEKFKTRVTITVDESSTTAYMELSSLRSEDTAFYFC ARQGLWFDSDGRGFDFWGQGSTVTVSS; or
a variable region of the light chain corresponding to
TABLE-US-00016 (SEQIDNO.:20) DIQMTQSPSSLSASVGDRVTITCRSSQNIVHSNGNTYLDWYQQTPGKAPK LLIYKVSNRFSGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCFQYSHVP WTFGQGTKLQITRE,
a variable region of the heavy chain corresponding to
TABLE-US-00017 (SEQIDNO.:21) QVQLQQSGAEVKKPGSSVKVSCKASGYTFTNYYIYWVRQAPGQGLEWI GGINPTSGGSNFNEKFKTRVTITVDESTNTAYMELSSLRSEDTAFYFC TRQGLWFDSDGRGFDFWGQGSTVTVSS; or
a variable region of the light chain corresponding to
TABLE-US-00018 (SEQIDNO.:22) DIQMTQSPSSLSASVGDRVTITCRSSQNIVHSNGNTYLDWYQQTPGKAPK LLIYKVSNRFSGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCFQYSHVP WTFGQGTKLQITRE
a variable region of the heavy chain corresponding to
TABLE-US-00019 (SEQIDNO.:23) QVQLQQSGAEVKKPGSSVKVSCKASGYTFTNYYIYWVRQAPGQGLEWI GGINPTSGGSNFNEKFKTKATITVDESTNTAYMELSSLRSEDTAFYFC TRQGLWFDSDGRGFDFWGQGSTVTVSS.
[0050] It is further envisaged for all the monoclonal antibodies (and, where applicable, antigen-binding fragments or peptides thereof) described herein to comprise a constant regions of the heavy chain comprising the amino acid sequence of a gamma-1 chain of a human immunoglobulin and the constant regions of the light chain of said antibody comprise the amino acid sequence of a kappa chain of a human immunoglobulin.
Nimotuzumab
[0051] The present inventors have found that the monoclonal antibody (or antigen-binding fragment thereof) produced by the cell line h-R3 deposited as ECACC 951110101 is particularly useful for application in the inventive methods. In particular, the monoclonal antibody may be nimotuzumab ((Ramakrishnan et al. MAbs. 2009 January-Feb; 1 (1): 41-48.).
Modifications
[0052] The antibodies and antigen-binding fragments thereof used in the methods of the invention may be modified. Typical modifications conceivable in the context of the invention include, e.g., chemical modifications as described in the following.
[0053] Generally, all kind of modifications are conceivable as long as they do not alter the CDR sequences of said antibody or antigen-binding fragment as defined elsewhere herein and further do not abolish the capability of monoclonal antibody (or antigen-binding fragment or peptide thereof) to specifically bind to EGFR.
[0054] Possible chemical modifications of the monoclonal antibody (or antigen-binding fragment thereof) include acylation or acetylation of the amino-terminal end or amidation or esterification of the carboxy-terminal end or, alternatively, on both. The modifications may also affect the amino group in the side chain of lysine or the hydroxyl group of threonine. Other suitable modifications include, e.g., extension of an amino group with polypeptide chains of varying length (e.g., XTEN technology or PASylation), N-glycosylation, O-glycosylation, and chemical conjugation of carbohydrates, such as hydroxyethyl starch (e.g., HESylation) or polysialic acid (e.g., PolyXen technology). Chemical modifications such as alkylation (e. g., methylation, propylation, butylation), arylation, and etherification may be possible and are also envisaged.
Functional Features
[0055] It is also envisaged that the monoclonal antibody (or antigen-binding fragment or peptide thereof) may have one or more of the following capabilities:
[0056] The anti-EGFR antibody (fragment/peptide) may be capable of inhibiting binding of EGF to the receptor, as readily ascertainable by the radioligand competition assay as described in Mateo et al. Immunotechnology. 1997 March;3 (1): 71-81.
[0057] The anti-EGFR antibody (fragment/peptide) may be capable of inhibiting growth of EGF-dependent tumor cells, as readily ascertainable by, e.g. cultivating EGF-dependent tumor cell lines (e.g., U-1752 and H125) in the presence of the antibody (fragment/peptide) and, after a predetermined period of time, quantify the total number of cells, e.g. by determination of total protein. An exemplary method is described in EP0586002.
[0058] The anti-EGFR antibody (fragment/peptide) may elicit antibody-dependent cellular cytotoxicity (ADCC). Several routine methods exist for determining the efficacy of antibodies (fragments) in eliciting ADCC, including the chromium-51 release assay, europium release assay, and sulfur-35 release assay. Briefly, a labelled target cell line expressing EGFR is incubated with the anti-EGFR antibody (fragment/peptide). After washing, effector cells (for example, peripheral blood mononuclear cells (PBMC) obtained from donors) expressing Fc receptor CD16 are co-incubated with the antibody-labelled target cells. Target cell lysis is subsequently measured by release of intracellular label by a scintillation counter or spectrophotometry. An exemplary protocol is disclosed in EP0586002 B1.
[0059] The anti-EGFR antibody (fragment/peptide) may have an anti-angiogenic effect. Means and methods for assessing angiogenesis in vitro and in vivo have been reviewed by Staton et al. Int J Exp Pathol. 2004 October; 85 (5): 233-248. E.g., assays of endothelial cell proliferation are readily available and easy to perform. Briefly, endothelial cells are e.g. incubated with a candidate anti-EGFR antibody (fragment/peptide). After incubation, the net cell number is determined using e.g. an electronic counter such as a Coulter counter and compared to untreated controls.
[0060] The anti-EGFR antibody (fragment/peptide) may have an anti-apoptotic effect. A variety of apoptosis kits are commercially available from various manufacturers and evaluate, e.g., active Caspase 3, 7 or 9, DNA fragmentation, phosphatidyl serine (PS) on the cytoplasmic surface of the cell membrane, membrane integrity and other apoptosis markers.
[0061] The anti-EGFR antibody (fragment/peptide) may cause an effect on CD133 positive cancer stem cells. CD133-positive cells display many cancer-stem cell characteristics, such as tumorsphere formation ability, expression of early-stage development markers, high invasiveness, raised tumor initiation potential and resistance to cisplatin chemotherapy treatment. It is envisaged that the anti-EGFR antibody (peptide/fragment) of the invention may reduce or abolish any of the cancer-stem cell properties.
[0062] The anti-EGFR antibody (fragment/peptide) may elicit complement-mediated cytotoxic activity, which can be assessed similarly to ADCC as described above. However, instead of effector cells, a complement source (e.g. rabbit serum) is added to the target cells, and target cell lysis is measured by release of intracellular label as described in EP0586002.
[0063] The anti-EGFR antibody (fragment/peptide) may induce cell-cyle arrest as easily ascertainable using flow cytometry. Briefly, cells are permeabilised and treated with a fluorescent dye that stains DNA quantitatively, usually propidium iodide (PI). As the DNA content of cells duplicates during the S phase of the cell cycle, the relative amount of cells in the G0 phase and G1 phase (before S phase), in the S phase, and in the G2 phase and M phase (after S phase) can be determined, as the fluorescence of cells in the G2/M phase will be twice as high as that of cells in the G0/G1 phase.
[0064] The anti-EGFR antibody (fragment/peptide) may be capable of producing a synergetic effect in inhibiting proliferation of tumor cells if combined with N-acetyl GM3 ganglioside, as readily ascertainable by culturing EGFR-expressing cell lines (such as H-125) in the presence of the anti-EGFR antibody (fragment/peptide) and N-acetyl GM3, and determine total cell numbers (e.g. by assessing total protein concentration) after a predefined period of time in relation to untreated controls. It is envisaged that the synergistic effect of the anti-EGFR antibody (fragment/peptide) and N-acetyl GM3 results in an inhibition of EGFR-expressing tumor cell proliferation. Again, a protocol for assessing said synergistic effect is provided in EP0586002.
[0065] The anti-EGFR antibody (fragment/peptide) may be capable of producing a synergetic effect in inhibiting proliferation of tumor cells if combined with a monoclonal antibody against EGF, as can be easily evaluated using a similar protocol as for determination of the synergistic effect of the anti-EGFR antibody (fragment/peptide) and N-acetyl GM3; with the exception that the cells are cultivated in the presence of an anti-EGF antibody instead of N-acetyl GM3. Again, it is envisaged that the synergistic effect of the anti-EGFR antibody (fragment/peptide) and anti-EGF antibody results in an inhibition of EGFR-expressing tumor cell proliferation.
[0066] The anti-EGFR antibody (fragment/peptide) may be capable of repairing tumor microsatellite instability produced by radiotherapy. Microsatellite instability (MSI) is a hypermutable phenotype caused by the loss of DNA mismatch repair activity and can be assessed by evaluating microsatellite markers as suggested by Dietmaier et al. Cancer Res. 1997 Nov. 1;57 (21): 4749-56.
Patients
[0067] Whereas most of the PDAC studies relate to patients with mutated KRAS, the present inventors have, for the first time, developed an effective treatment for a population of patients with PDAC expressing wild-type KRAS, HRAS or NRAS. The term patient refers to a human patient preferably being pre-diagnosed with PDAC, in particular locally advanced and/or metastatic PDAC.
[0068] Whether or not a certain patient belongs to the population of patients to be treated by the inventive method can be assessed using routine experimentation known in the art. E.g., in order to determine whether or not a PDAC tumor expresses wild-type KRAS, HRAS or NRAS a tumor sample is typically obtained from the patient to be evaluated, and KRAS, HRAS or NRAS nucleic acid sequence is, respectively, obtained from the sample and amplified, and subjected to sequencing.
[0069] Another method is related to plasma or serum samples wherein circulating tumor cells with KRAS, HRAS or NRAS oncogene can be detected using membrane microarrays. In this regards a positive KRAS, HRAS or NRAS mutation in plasma or serum suggests a KRAS, HRAS or NRAS mutation in the tumor whereas the absence of a KRAS, HRAS or NRAS mutation in the plasma or serum does not necessarily prove a lack of a similar mutation in the pancreatic tumor tissue.
[0070] Additionally or alternatively, expression of wild-type KRAS, HRAS or NRAS can be determined by detecting mutant and/or wild-type KRAS, HRAS or NRAS polypeptides in the tumor sample, e.g. by using specific antibodies binding to epitopes specific for wild-type or mutant KRAS, HRAS or NRAS, respectively. It is envisaged that patients with PDAC tumors expressing wild-type KRAS, HRAS or NRAS are selected for treatment, whereas patients expression mutant KRAS, HRAS or NRAS are not selected for treatment.
[0071] It is thought that patients with PDAC tumors expressing mutant KRAS, HRAS or NRAS and in particular KRAS, HRAS or NRAS having on or more mutations as set out elsewhere herein, are less responsive or non-responsive to treatment with the monoclonal antibody (fragment/peptide) used in the methods of the invention. Thus, the present invention also provides a method for stratification of PDAC patients. Stratification, when used herein, means sorting PDAC patients into those who may benefit from treatment with the anti-EGFR antibody (or antigen-binding fragment or peptide thereof) as defined herein, and those who may not benefit. It is envisaged that patients whose PDAC tumors do not express wild-type KRAS, HRAS or NRAS and in particular patients whose PDAC tumors express mutated KRAS, HRAS or NRAS, are not likely to benefit from (be responsive to) treatment with the anti-EGFR antibody (or antigen-binding fragment or peptide thereof). Said mutations which presence is in especially thought to be indicative for non-responsiveness to treatment with an anti-EGFR antibody (fragment/peptide) according to the invention are, are G12, G13, Q61, A146 or D154 of SEQ ID NO.: 7 or SEQ ID No. 24 (KRAS); G12, G13, or Q61 of SEQ ID NO.: 8 or SEQ ID No. 25 (HRAS) or G12, G13, or Q61 of SEQ ID NO.: 9 (NRAS).
[0072] Otherwise, patients whose PDAC tumors express wild-type KRAS, HRAS or NRAS as defined elsewhere herein are likely to benefit (be responsive to) from the treatment as described herein. Said wild-type KRAS preferably has a sequence corresponding to SEQ ID No. 7 or SEQ ID No. 24 and preferably does not comprise mutations in amino acid residues G12, G13, Q61, A146 or D154 of SEQ ID NO.: 7 or SEQ ID No. 24, said wild-type HRAS preferably has a sequence corresponding to SEQ ID No. 8 or SEQ ID No. 25 and preferably does not comprise mutations in amino acid residues G12, G13, or Q61 of SEQ ID No. 8 or SEQ ID No. 25, and/or said wild-type NRAS preferably has a sequence corresponding to SEQ ID No. 9 and preferably does not comprise mutations in amino acid residues G12, G13, or Q61 of SEQ ID No. 9.
[0073] The term being responsive in the context of the method of treatment provided herein means that a patient, or tumor, or tumor shows a complete response or a partial response after administering the anti-EGFR antibody (fragment/peptide) as defined herein, according to RECIST (Response Evaluation Criteria in Solid Tumors). The term nonresponsive as used herein means that a patient or tumor shows stable disease or progressive disease after administering the anti-EGFR antibody (fragment/peptide) as defined herein, according to RECIST. RECIST is described, e.g., in Eisenhauer et al.: New response evaluation criteria in solid tumours: revised RECIST guideline (version 1.1). Eur. J. Cancer. 45, Nr. 2, 2009, 228-47.
[0074] Also provided herein is therefore a method of selecting a patient or the population of patients to be treated. This is achieved by determining the presence or absence of mutant and/or wild-type KRAS, HRAS or NRAS in a PDAC tumor sample of each patient. Patients, in whose tumor samples mutant KRAS, HRAS or NRAS is detected and/or wild-type KRAS, HRAS or NRAS is not detected are not considered eligible for treatment, whereas patients in whose tumor samples wild-type KRAS, HRAS or NRAS is detected and/or mutant KRAS, HRAS or NRAS is not detected are considered eligible are therefore selected for treatment in accordance with the invention.
[0075] Further, as described before, the invention allows provides a method for prognosis of whether a patient suffering from PDAC, or a PDAC tumor, will be responsive or nonresponsive to treatment with the anti-EGFR antibody (fragment/peptide) as described herein. As set out before, absence or presence of mutated and/or wild-type KRAS, HRAS or NRAS in a tumor sample of the patient can be assessed using routine methods known in the art and described elsewhere herein. Expression of mutated KRAS, HRAS or NRAS in the PDAC tumor indicates that the patient, or PDAC tumor, will be nonresponsive to treatment, whereas expression of wild-type KRAS, HRAS or NRAS in the PDAC tumor indicates that the patient will be responsive to treatment with the antibody (fragment/peptide) as described herein.
Treatment
[0076] The term treatment in all its grammatical forms includes therapeutic or prophylactic treatment of PDAC. A therapeutic or prophylactic treatment comprises prophylactic treatments aimed at the complete prevention of clinical and/or pathological manifestations or therapeutic treatment aimed at amelioration or remission of clinical and/or pathological manifestations. The term treatment thus also includes the amelioration or prevention of PDAC.
[0077] In the context with the present invention the term therapeutic effect in general refers to the desirable or beneficial impact of a treatment, e.g. amelioration or remission of the disease manifestations. The term manifestation of a disease is used herein to describe its perceptible expression, and includes both clinical manifestations, hereinafter defined as indications of the disease that may be detected during a physical examination and/or that are perceptible by the patient (i.e., symptoms), and pathological manifestations, meaning expressions of the disease on the cellular and molecular level. The therapeutic effect of treatment with the anti-EGFR antibody (fragment/peptide) can be assessed by RECIST as described elsewhere herein. Additionally or alternatively it is also possible to evaluate the general appearance of the respective patient (e.g., fitness, well-being) which will also aid the skilled practitioner to evaluate whether a therapeutic effect has been elicited. The skilled person is aware of numerous other ways which are suitable to observe a therapeutic effect of the compounds of the present invention.
Dose
[0078] Preferably, a therapeutically effective amount of anti-EGFR antibody (fragment/peptide) is administered. By therapeutically effective amount is meant an amount of the monoclonal antibody (or antigen-binding fragment or fragment thereof) that elicits a therapeutic effect as described herein. The exact dose of anti-EGFR antibody (fragment/peptide) will depend on the purpose of the treatment (e.g. remission maintenance vs. acute tumor growth or metastatic spread), and will be ascertainable by one skilled in the art using known techniques. Adjustments for route of administration, age, body weight, general health, sex, diet, time of administration, drug interaction and the severity of the condition may be necessary, and will be ascertainable with routine experimentation by those skilled in the art.
[0079] Also provided herein is a treatment regimen for treating patients with PDAC with a monoclonal antibody (fragment/peptide), said antibody preferably being nimotuzumab. It is envisaged to treat patients with nimotuzumab in a dosage range of between 200 and 400 mg once a week. The envisioned dosage range of between 200 mg and 400 mg comprises, e.g., 200 mg, 250 mg, 300 mg, 350 mg and 400 mg and dosages in between. Weakly treatment with the dosage of nimotuzumab between 200 and 400 mg is envisioned to be carried out over a period of time of 12, 24 or 36 weeks. After said weakly treatment, patients may be treated with a dosage of nimotuzumab of between 200 and 400 mg once every 2-3 weeks.
Administration
[0080] A variety of routes are applicable for administration of the monoclonal antibody (peptide/fragment) according to the present invention, including, but not limited to, orally, topically, transdermally, subcutaneously, intravenously, intraperitoneally, intramuscularly or intraocularly. However, any other route may readily be chosen by the person skilled in the art if desired. Intravenous infusion of said antibody (peptide/fragment) is particularly envisaged.
Anti-Cancer Agents
[0081] Also envisaged herein is the additional administration (co-administration) of anti-cancer agents to PDAC patients. Said anti-cancer agents may be administered antecedently, simultaneously, and/or subsequently to the antibody (fragment/peptide) as described herein.
[0082] In the context of the present invention, the term anti-cancer agent comprises any agent useful in the treatment of PDAC, including chemotherapeutic agents, anti-neoplastic agents and biological molecules. Agents included in the definition of anti-cancer agents are, without limitation, alkylating agents, e.g. mechlorethamine, cyclophosphamide, melphalan, chlorambucil, ifosfamide, busulfan, N-Nitroso-N-methylurea (MNU), carmustine (BCNU), lomustine (CCNU), semustine (MeCCNU), fotemustine, streptozotocin, dacarbazine, mitozolomide, temozolomide, thiotepa, mytomycin, diaziquone (AZQ), cisplatin, carboplatin, oxaliplatin, procarbazine and hexamethylmelamine; antimetabolites, e.g. methotrexate, pemetrexed, fluorouracil, capecitabine, cytarabine, gemcitabine, decitabine, Vidaza, fludarabine, nelarabine, cladribine, clofarabine, pentostatin, thioguanine, mercaptopurine; anti-microtubule agents e.g. vincristine, vinblastine, vinorelbine, vindesine, vinflunine, paclitaxel, docetaxel, podophyllotoxin; topoisomerase inhibitors, e.g. irinotecan, topotecan, etoposide, doxorubicin, mitoxantrone, teniposide, novobiocin, merbarone, aclarubicin; cytotoxic antibiotics, e.g. actinomycin, bleomycin, plicamycin, mitomycin, doxorubicin, daunorubicin, epirubicin, idarubicin, pirarubicin, aclarubicin, and mitoxantrone. Particularly envisaged is the use of gemtabicine, FOLFIRINOX, erlotinib, 5-fluorouracil, paclitaxel, nab-paclitaxel, docetaxel, capecitabine, oxaliplatin cisplatin, FOLFOXIRI, abraxane, anti-CD40 antibodies, oregovomab, Nelfinavir, cetuximab, tegafur, leucovorin and combinations thereof.
[0083] Additional administration of palliative agents in order to reduce or control side effects of PDAC treatment and PDAC symptoms, including pain, nausea, breathlessness, insomnia, and other physical symptoms caused by cancer or its treatment is also envisaged.
Composition
[0084] It is envisaged to administer the anti-EGFR antibody (fragment/peptide) or a nucleic acid encoding said anti-EGFR antibody or antigen-binding fragment or peptide thereof in the form of a pharmaceutical composition. Preferably, said anti-EGFR antibody (fragment/peptide) or nucleic acid is present in the pharmaceutical composition in a therapeutically effective amount. The term pharmaceutical composition particularly refers to a composition suitable for administering to a human, i.e., a composition containing components which are pharmaceutically acceptable. Preferably, a pharmaceutical composition comprises a monoclonal antibody (or antigen-binding fragment or peptide thereof) or nucleic acid as described herein together with one or more pharmaceutical excipients. The composition may also comprise further anti-cancer agents as described elsewhere herein. The term excipient includes fillers, binders, disintegrants, coatings, sorbents, antiadherents, glidants, preservatives, antioxidants, flavoring, coloring, sweeting agents, solvents, co-solvents, buffering agents, chelating agents, viscosity imparting agents, surface active agents, diluents, humectants. carriers, diluents, preservatives, emulsifiers, stabilizers or tonicity modifiers. Pharmaceutical compositions of the invention preferably comprise a therapeutically effective amount of the monoclonal antibody (or antigen-binding fragment or peptide thereof) and can be formulated in various forms, e.g. in solid, liquid, gaseous or lyophilized form and may be, inter alia, in the form of an ointment, a cream, transdermal patches, a gel, powder, a tablet, solution, an aerosol, granules, pills, suspensions, emulsions, capsules, syrups, liquids, elixirs, extracts, tincture or fluid extracts or in a form which is particularly suitable for the desired method of administration.
[0085] The pharmaceutical composition of the present invention may further comprise one or more additional anti-cancer agents. Preferably, said agents are therapeutically effective for treatment of PDAC. Particularly suitable anti-cancer agents have been described in the context of co-administration herein. Examples that can be used in the pharmaceutical composition of the invention include, without limitation, gemtabicine, FOLFIRINOX, erlotinib, 5-fluorouracil, paclitaxel, nab-paclitaxel, docetaxel, capecitabine, oxaliplatin cisplatin, FOLFOXIRI, abraxane, an anti-CD40 antibody, oregovomab, Nelfinavir, cetuximab, tegafur, leucovorin and combinations thereof.
[0086] In view of the above, the present invention hence also provides a pharmaceutical composition comprising a monoclonal antibody (or antigen-binding fragment or peptide thereof) as described herein or a nucleic acid encoding the same for use in treating a population of patients having been diagnosed with pancreatic ductal adenocarcinoma (PDAC), said PDAC expressing KRAS, HRAS or NRAS wild-type. The antibody may in particular be nimotuzumab.
[0087] The pharmaceutical composition is envisaged to comprise a dosage of active agent of between 200 to 400 mg. The term dosage of ( . . . ) between 200 to 400 mg comprises dosages of, e.g., 200 mg, 250 mg, 300 mg, 350 mg and 400 mg active agent, and dosages in between. The active agent, i.e. the monoclonal antibody (or antigen-binding fragment or peptide thereof), in particular be nimotuzumab.
[0088] A better understanding of the present invention and of its advantages will be had from the following examples, offered for illustrative purposes only. The examples are not intended to limit the scope of the present invention in any way.
[0089] It is noted that as used herein, the singular forms a, an, and the, include plural references unless the context clearly indicates otherwise. Thus, for example, reference to a reagent includes one or more of such different reagents and reference to the method includes reference to equivalent steps and methods known to those of ordinary skill in the art that could be modified or substituted for the methods described herein.
[0090] Unless otherwise indicated, the term at least preceding a series of elements is to be understood to refer to every element in the series. Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the invention described herein. Such equivalents are intended to be encompassed by the present invention.
[0091] The term and/or wherever used herein includes the meaning of and, or and all or any other combination of the elements connected by said term.
[0092] The term about or approximately as used herein means within 20%, preferably within 10%, and more preferably within 5% of a given value or range. It includes, however, also the concrete number, e.g., about 20 includes 20.
[0093] The term less than or greater than includes the concrete number. For example, less than 20 means less than or equal to. Similarly, more than or greater than means more than or equal to, or greater than or equal to, respectively.
[0094] Throughout this specification and the claims which follow, unless the context requires otherwise, the word comprise, and variations such as comprises and comprising, will be understood to imply the inclusion of a stated integer or step or group of integers or steps but not the exclusion of any other integer or step or group of integer or step. When used herein the term comprising can be substituted with the term containing or including or sometimes when used herein with the term having.
[0095] When used herein consisting of excludes any element, step, or ingredient not specified in the claim element. When used herein, consisting essentially of does not exclude materials or steps that do not materially affect the basic and novel characteristics of the claim.
[0096] It should be understood that this invention is not limited to the particular methodology, protocols, material, reagents, and substances, etc., described herein and as such can vary. The terminology used herein is for the purpose of describing particular embodiments only, and is not intended to limit the scope of the present invention, which is defined solely by the claims.
[0097] All publications and patents cited throughout the text of this specification (including all patents, patent applications, scientific publications, manufacturer's specifications, instructions, etc.), whether supra or infra, are hereby incorporated by reference in their entirety. Nothing herein is to be construed as an admission that the invention is not entitled to antedate such disclosure by virtue of prior invention. To the extent the material incorporated by reference contradicts or is inconsistent with this specification, the specification will supersede any such material.
EXAMPLES
[0098] FOLFIRINOX significantly increases survival in metastatic PC compared to gemcitabine, but its use is limited to selected patients, due its high toxicity. In the majority of cases, gemcitabine (gem) remains the mainstay of palliative treatment, although its modest impact on survival and disease progression. The addition of the EGFR tyrosine kinase inhibitor erlotinib prolonged median survival for only 2 weeks. This study was aimed to investigate the effect of adding Nimotuzumab (nimo), an anti-EGFR monoclonal antibody, to first-line gemcitabine, in pancreatic cancer patients (PCP).
EXAMPLE 1: Locally Advanced or Metastatic Pancreatic Cancer Response to Gemcitabine Plus Nimotuzumab
Treatment
[0099] One hundred and ninety two (192) newly diagnosed patients with locally advanced or metastatic pancreatic cancer were randomized and recruited into 2 arms, on the treatment arm patients were administered administered i.v infusion of nimotuzumab at 400 mg dose once a week until progressive disease or unacceptable toxicity and gemcitabine 1000 mg/m.sup.2 once weekly for 3 weeks, followed by a 1-week rest (d1, 8, 15; q28) and on the control arm patients were administered i.v infusion of placebo once a week until progressive disease or unacceptable toxicity and gemcitabine 1000 mg/m.sup.2 once weekly for 3 weeks, followed by a 1-week rest (d1, 8, 15; q28).
[0100] Tumor response was assessed using CT (Computed Tomography) or MRI (Magnetic Resonance Imaging) and statistically analyzed using RECIST (Response Evaluation Criteria in Solid Tumors), which provides guidelines for identifying complete response, partial response, stable disease, or progressive disease based on tumor size (see, e.g., Therasse et al., February 2000, New Guidelines to Evaluate the Response to Treatment in Solid Tumors, J. Natl. Cancer Inst. 92 (3): 205-216) and overall survival was assessed by the last patient visit, death or loss of follow up.
EXAMPLE 2: Mutational Analysis of KRAS in Patients with Locally Advanced or Metastatic Pancreatic Cancer and Relationship with Survival
[0101] Out of 192 patients that were randomized into 2 arms, tumor samples were taken from 101 patients (49 from the control arm and 52 from the treatment arm).
[0102] To determine if KRAS status correlates with survival the 101 samples were tested. From the KRAS analysis of the 101 samples, 34 samples were KRAS Wild Type (20 from the control arm and 14 from the treatment arm) and 67 samples has the mutation of the KRAS (29 from the control arm and 38 from the treatment arm). Table 1 shows KRAS status of the patients included on the clinical trial by treatment arm.
TABLE-US-00020 TABLE 1 KRAS status of the locally advanced or metastatic pancreatic cancer patients. No. Patient ID Treatment Arm KRAS Status 1 005 OSAG 101 Mutation G12D (G35A) 2 006 OSAG 101 Wildtyp 3 007 Placebo Mutation G12V (G35T) 4 008 Placebo Wildtyp 5 010 Placebo Mutation G12D (G35A) 6 011 OSAG 101 Wildtyp 7 012 OSAG 101 Wildtyp 8 016 Placebo Mutation G12D (G35A) 9 018 OSAG 101 Mutation G12R (G34C) 10 019 OSAG 101 Mutation G12D (G35A) 11 020 Placebo Wildtyp 12 021 Placebo Wildtyp 13 023 OSAG 101 Mutation G12D (G35A) 14 025 OSAG 101 Mutation G12A (G35C) 15 026 Placebo Wildtyp 16 027 OSAG 101 Mutation G12D (G35A) 17 029 OSAG 101 Mutation G12A (G35C) 18 032 Placebo Mutation G12R (G34C) 19 034 Placebo Mutation G12D (G35A) 20 036 OSAG 101 Wildtyp 21 038 Placebo Mutation G12R (G34C) 22 040 OSAG 101 Mutation G12D (G35A) 23 041 OSAG 101 Mutation G12R (G34C) 24 043 Placebo Wildtyp 25 045 Placebo Wildtyp 26 050 OSAG 101 Wildtyp 27 051 Placebo Mutation G12V (G35T) 28 052 Placebo Mutation G12D (G35A) 29 053 OSAG 101 Mutation G12R (G34C) 30 054 OSAG 101 Mutation G12V (G35T) 31 056 Placebo Mutation G12S (G34A) 32 057 OSAG 101 Mutation G12D (G35A) 33 058 OSAG 101 Mutation G12V (G35T) 34 059 Placebo Mutation G12A (G35C) 35 061 Placebo Mutation G12D (G35A) 36 062 OSAG 101 Mutation G12D (G35A) 37 064 OSAG 101 Wildtyp 38 066 OSAG 101 Mutation G12D (G35A) 39 067 Placebo Wildtyp 40 068 Placebo Mutation G12D (G35A) 41 069 OSAG 101 Wildtyp 42 070 OSAG 101 Mutation G12V (G35T) 43 072 Placebo Wildtyp 44 073 OSAG 101 Mutation G12D (G35A) 45 074 OSAG 101 Mutation G12D (G35A) 46 076 OSAG 101 Mutation G12D (G35A) 47 077 OSAG 101 Mutation G12D (G35A) 48 078 Placebo Mutation G12D (G35A) 49 080 Placebo Mutation G12V (G35T) 50 082 Placebo Mutation G12D (G35A) 51 083 OSAG 101 Wildtyp 52 084 Placebo Mutation G12V (G35T) 53 085 Placebo Wildtyp 54 086 Placebo Wildtyp 55 087 OSAG 101 Mutation G12D (G35A) 56 088 OSAG 101 Mutation G12V (G35T) 57 089 OSAG 101 Mutation G12D (G35A) 58 090 Placebo Mutation G12V (G35T) 59 091 Placebo Mutation G12V (G35T) 60 092 OSAG 101 Wildtyp 61 093 OSAG 101 Mutation G12D (G35A) 62 095 OSAG 101 Mutation G12D (G35A) 63 096 Placebo Mutation G12D (G35A) 64 097 Placebo Wildtyp 65 098 Placebo Mutation G12D (G35A) 66 099 OSAG 101 Mutation G12V (G35T) 67 100 OSAG 101 Wildtyp 68 101 OSAG 101 Mutation G12V (G35T) 69 102 Placebo Wildtyp 70 103 OSAG 101 Mutation G12R (G34C) 71 104 Placebo Mutation G12D (G35A) 72 105 OSAG 101 Wildtyp 73 106 Placebo Mutation G12V (G35T) 74 109 OSAG 101 Mutation G12V (G35T) 75 110 Placebo Wildtyp 76 112 Placebo Mutation G12D (G35A) 77 114 Placebo Wildtyp 78 118 OSAG 101 Mutation G12V (G35T) 79 119 Placebo Wildtyp 80 121 Placebo Mutation G12V (G35T) 81 124 OSAG 101 Mutation G12V (G35T) 82 125 OSAG 101 Wildtyp 83 129 OSAG 101 Mutation G12V (G35T) 84 133 OSAG 101 Mutation G12D (G35A) 85 134 OSAG 101 Wildtyp 86 135 Placebo Mutation G12V (G35T) 87 140 OSAG 101 Mutation G12D (G35A) 88 143 OSAG 101 Wildtyp 89 145 Placebo Mutation G12V (G35T) 90 149 OSAG 101 Mutation G12D (G35A) 91 150 Placebo Mutation G12D (G35A) 92 158 OSAG 101 Mutation G12D (G35A) 93 161 Placebo Wildtyp 94 164 OSAG 101 Mutation G12D (G35A) 95 165 Placebo Wildtyp 96 168 OSAG 101 Mutation G12D (G35A) 97 169 Placebo Wildtyp 98 171 Placebo Wildtyp 99 174 Placebo Mutation G12D (G35A) 100 179 Placebo Wildtyp 101 189 Placebo Mutation G12V (G35T)
[0103] The Kaplan-Meier curves of the locally advanced or metastatic pancreatic cancer patient with KRAS mutated from the placebo-gemcitabine arm compared to the patients from the nimotuzumab-gemcitabine arm shows no difference in term of progression-free-survival (PFS) and overall survival (OS) (
[0104] The Kaplan-Meier curves of the locally advanced or metastatic pancreatic cancer patient with KRAS wild type from the placebo-gemcitabine arm compared to the patients from the nimotuzumab-gemcitabine arm shows a significant difference in favour of the treatment arm in term of progression-free-survival (PFS) and overall survival (OS) (
Safety
[0105] There were a total of 212 serious adverse events (SAEs) reported in 115 patients, 104 SAEs from the placebo-gemcitabine control arm reported in 61/93 (65.6%) patients and 108 SAEs from nimotuzumab plus gemcitabine arm reported in 54/93 (58.1%) patients. Of the 108 SAEs, reported on the nimotuzumab arm, 26 SAEs in 15/93 (16.1%) patients were reported to be related to the study drug. Most common SAEs reported to be related to study drug were general physical health deterioration (3 subjects, 3.23%), nausea (2 subjects, 2.15%), vomiting (2 subjects, 2.15%), and thrombocytopenia (2 subjects, 2.15%).
Results
[0106] As a primary endpoint, overall survival (OS) in the intention-to-treat (ITT) population was evaluated. The OS was assessed by the date of the last visit, death or loss of the follow up. The OS was initially calculated for all population and then a subset analysis was run taking into consideration the KRAS status of each of the patients on each treatment arm. Secondary endpoints included progression free survival (PFS), assessed by the day of the progression or the death, safety, assessed by the incidence of adverse events (AE) or serious adverse events (SAE), objective response rate (ORR), assessed by the number of patients on each treatment arm with Complete Response (CR) and Partial Response (PR) to the treatment ((CR+PR)/N, No. patients in the arm)) and Quality of Life (QoL), assessed using EORTC quality of life questionnaire QLQ-C30 version 2.0 (EORTC, NL).
[0107] Progression-free-survival (PFS) is defined as the length of time during and after the treatment of a disease, such as cancer, that a patient lives with the disease without worsening of the symptoms and was measured from date of randomization to the occurrence of progression or death or last date of observation without progression.
[0108] Complete response is defined as the disappearance of all target cancer lesions and was measured at weeks 8, 16, and 24
[0109] Partial Response (PR) is defined as at least a 30% decrease in the sum of the longest dimensions of target lesions, taking as a reference the baseline sum of longest dimensions and measured at weeks 8, 16 and 24
[0110] Quality-of-Life was assessed with the EORTC QLQ-C30 module as reviewed in Fayers et al. Eur J Cancer. 2002 March;38 Suppl 4: S125-33 and was measured at the following time points: (1) Baseline within 7 days prior to first study medication administration on Day 1, (2) In week 6, 14 and then every 8 weeks, and (3) At the end of treatment.
[0111] In the analysis of subgroup of KRAS WT, overall survival was significantly improved on the patients with locally advanced or metastatic pancreatic cancer that received the treatment of nimotuzumab and gemcitabine with an increase of median overall survival in 6 months when it was compared to the control arm that received placebo-gemcitabine. (see TABLE 2).