Gene therapy for NMNAT1-associated retinal degeneration
12257320 ยท 2025-03-25
Assignee
Inventors
- Eric A. Pierce (Belmont, MA, US)
- Luk H. Vandenberghe (Weston, MA)
- Scott Greenwald (Boston, MA, US)
- Emily Brown (Boston, MA, US)
Cpc classification
A61K48/0058
HUMAN NECESSITIES
C12N2750/14143
CHEMISTRY; METALLURGY
A61K48/005
HUMAN NECESSITIES
C12Y207/07001
CHEMISTRY; METALLURGY
A61K9/0019
HUMAN NECESSITIES
C12N2830/008
CHEMISTRY; METALLURGY
A61K48/0075
HUMAN NECESSITIES
International classification
A61K48/00
HUMAN NECESSITIES
A61K9/00
HUMAN NECESSITIES
Abstract
Methods and compositions for gene therapy of retinal degeneration related to mutations in nicotinamide mononucleotide adenylyltransferase 1 (NMNAT1).
Claims
1. A method of treating retinal degeneration caused by mutations in a nicotinamide mononucleotide adenylyltransferase 1 (NMNAT1) gene in a human subject, the method comprising delivering to an eye of the subject a therapeutically effective amount of an Adeno-associated virus 2/9 (AAV2/9) vector comprising a sequence encoding a functional human NMNAT1, operably linked to a CASI promoter that drives expression in photoreceptors, wherein the sequence encoding the functional human NMNAT1 is at least 98% identical to SEQ ID NO: 1.
2. The method of claim 1, wherein the sequence encoding the functional human NMNAT1 is codon optimized.
3. The method of claim 1, wherein the vector is delivered via sub-retinal injection.
4. The method of claim 1, wherein the vector is self-complementary AAV2/9 (scAAV2/9).
5. The method of claim 1, wherein the sequence encoding the functional human NMNAT1 is at least 99% identical to SEQ ID NO: 1.
6. The method of claim 1, wherein the sequence encoding the functional human NMNAT1 comprises SEQ ID NO:1.
7. The method of claim 1, wherein the vector further comprises a 3 bovine growth hormone untranslated region.
8. A method of increasing expression of NMNAT1 in photoreceptor cells in an eye of a human subject, the method comprising delivering to the eye of the subject a therapeutically effective amount of an Adeno-associated virus type 2/9 (AAV2/9) vector comprising a sequence encoding a functional human NMNAT1, operably linked to a CASI promoter that drives expression in the photoreceptor cells, wherein the subject has retinal degeneration caused by a mutation in a nicotinamide mononucleotide adenylyltransferase 1 (NMNAT1) gene, wherein the sequence encoding the functional human NMNAT1 is at least 97% identical to SEQ ID NO: 1.
9. The method of claim 8, wherein the vector is delivered via sub-retinal injection.
10. The method of claim 8, wherein the vector is self-complementary AAV2/9 (scAAV2/9).
11. The method of claim 8, wherein the sequence encoding the functional human NMNAT1 is at least 98% identical to SEQ ID NO:1.
12. The method of claim 8, wherein the sequence encoding the functional human NMNAT1 is at least 99% identical to SEQ ID NO: 1.
13. The method of claim 8, wherein the sequence encoding the functional human NMNAT1 comprises SEQ ID NO:1.
14. An Adeno-associated virus type 2/9 (AAV2/9) vector comprising a sequence encoding a functional human NMNAT1, operably linked to a CASI promotor that drives expression in photoreceptor cells, wherein the sequence encoding the functional human NMNAT1 is codon at least 98% identical to SEQ ID NO: 1.
15. The AAV2/9 vector of claim 14, wherein the vector is a self-complementary AAV2/9 (scAAV2/9).
16. The AAV2/9 vector of claim 14, wherein the sequence encoding the functional human NMNAT1 is at least 99% identical to SEQ ID NO:1.
17. The AAV2/9 vector of claim 14, wherein the sequence encoding the functional human NMNAT1 comprises SEQ ID NO:1.
18. A pharmaceutical composition comprising the vector of claim 14, formulated for delivery via sub-retinal injection.
Description
DESCRIPTION OF DRAWINGS
(1)
(2) D) A self-cleaving NMNAT1-EGFP fusion construct, driven by the CAG promoter and followed by WPRE, is packaged in the AAV2/Anc80 vector. E) NMNAT1, driven by the CASI promoter and packaged into SS.AAV7m8. Abbreviations: bGH, bovine growth hormone polyadenylation signal; EGFP, enhanced green fluorescent protein; WPRE, woodchuck hepatitis virus posttranslational regulatory element; T2A, thosea asigna virus 2A self-cleaving sequence.
(3)
(4)
(5)
(6)
(7)
(8)
(9)
DETAILED DESCRIPTION
(10) Currently, no treatment exists for NMNAT1-associated retinal degeneration. Because patients incur considerable vision loss during the first years of life, but are expected to have normal longevity, an early intervention has the potential to preserve sight for many decades. Since this disease has a recessive inheritance pattern.sup.10 and because NMNAT1 is a relatively small gene,.sup.14 treatment with adeno-associated virus (AAV)-mediated gene augmentation therapy is an attractive strategy. At 840 bp, human NMNAT1 cDNA is well within the 4.7 kb maximum cargo capacity for single-stranded AAV (SS.AAV).sup.15 and the 2.2 kb maximum cargo capacity of self-complementary AAV (SC.AAV)..sup.16 This approach of supplementing cells with a normal copy of a mutant gene via an AAV vector to maintain retinal cell viability is presently being used as an FDA approved therapy (Luxturna) in patients for the treatment of RPE65-associated retinal degeneration..sup.17 In addition, there are ongoing clinical trials of AAV-mediated gene augmentation therapies for choroideremia,.sup.18 achromatopsia (clinicaltrials.gov, accessed Nov. 7, 2019), MERTK-retinitis pigmentosa,.sup.19 X-linked retinitis pigmentosa (recruiting, clinicaltrials.gov, accessed Nov. 7, 2019), and X-linked retinoschesis,.sup.20 among others,.sup.15 as well as numerous preclinical studies for other inherited retinal degenerations..sup.21-24
(11) When NMNAT1 was first reported as a disease gene in 2012, a suitable animal model was not available for evaluating potential therapies in situ. Traditional Nmnat1 knockout mice were not viable.sup.12 and conditional knockout animals, which ablate Nmnat1 in targeted retinal cells, would not have accurately represented the physiology of the disease. We recently reported the characterization of an NMNAT1-associated retinal disease mouse model that is homozygous for the p. Val9Met (V9M) mutation in Nmnat1,.sup.1,25 an allele that has been found to cause retinal disease in members of unrelated families..sup.4,10 The founder of this mouse line was identified during an ENU mutagenesis screen. The homozygous mutant progeny (Nmnat1.sup.V9M/V9M) invariably develop an early-onset isolated retinal disease without obvious detriments to longevity, mobility, or cognition, much like the humans they model. Nmnat1.sup.V9M/V9M mice have fully mature retinas and reliable responses to light, as detected by the electroretinogram (ERG), at three weeks of age, but a week later, the photoreceptor layer shows signs of degeneration accompanied by reduced function. By approximately four months of age, the retina is severely degenerated, and responses to light are often undetectable..sup.25 Given that the mutation in this mouse is present in the patient population and there is an opportunity for intervention during the first month of life, this model is appropriate for testing therapies that aim to protect the retina from NMNAT1-associated disease.
(12) For the purpose of developing a therapy to preserve vision in people with Nmnat1-associated retinal degeneration, we used the p. V9M-Nmnat1 mouse model to test the hypothesis that providing retinal cells with a normal copy of NMNAT1 prevents disease progression. To accomplish this, a human NMNAT1 cDNA was delivered to the retinas of Nmnat1.sup.V9M/V9M mice via several recombinant AAV2 vectors that were evaluated independently. Efficacy varied across viral preparations and experimental conditions, and therefore, we aimed to understand why specific variables were associated with success or failure and how these lessons might generalize to assist in the development of other AAV-mediated gene therapies.
(13) Morphological and functional data collected from Nmnat1.sup.V9M/V9M mice treated using AAV-mediated gene augmentation offer the first demonstration of any type of therapy that targets NMNAT1-associated retinal degeneration. Because of the narrow therapeutic window in this mouse model, a self-complementary viral vector was required so that the transgene would be expressed early enough to rescue vulnerable cells. A self-complementary AAV differs from a single-stranded vector in that it contains an inverted repeat genome that folds to make double-stranded DNA..sup.42 In this way, the virus is able to bypass the rate-limiting step of second strand DNA synthesis that is normally required prior to transgene expression,.sup.31,43 as well as circumvent the vector genome instability that briefly follows DNA replication..sup.44 Also, self-complementary vectors require neither transport to the nucleus nor uncoating from the capsid prior to transgene expression..sup.16 In this model, single-stranded vectors, including one that was the same AAV serotype/capsid (AAV2/9) and contained the identical genomic cargo, yielded unfavorable results; however, such single stranded vectors may be of use in other species including humans.
(14) The therapeutic window of the Nmnat1.sup.V9M/V9M mouse was bounded by the limitation of rod photoreceptor developmental biology.sup.45 on the early side and by the onset of degeneration at slightly under four weeks of age on the late side..sup.25 Logically, the earliest possible intervention would be preferred, implying treatment immediately after birth. However, the observation that rods do not show strong transgene expression following neonatal injections agrees with recent reports by other groups describing that developing rod photoreceptors in P0-P1 mice are not competent to be transduced by AAV..sup.45,46 The need for transgene expression in photoreceptors was made clear by the experiment in which intravitreal injections of AAV2/7m8 were delivered to two-week-old mice. This treatment provided no therapeutic benefit despite strong and widespread coverage of the inner retinal cell layers. Using self-complementary AAV5, Petit et al. reported that approximately twice as many rods become transduced if the injection is provided at P21 rather than P10..sup.45
(15) However, since SC.AAV2/9 requires longer than one week to express NMNAT1 in the mouse retina, delaying the intervention until P21 would have allowed uncontested disease progression during the viral incubation period. Instead, injections were performed at P16, which afforded the time necessary for transgene expression to be initiated while still having the possibility of transducing a substantial portion of the rod population. In this case, the number of photoreceptors that were rescued by the treatment was sufficient to maintain 80% of ONL thickness in comparison to age-matched wildtype littermates. It should be noted that while this preservation of retinal structure was immediate, rescue of function was not apparent by ERG until 3.5 months post-injection.
(16) In the present methods, delivery is performed during the therapeutic window in human patients. Rescued retinas in Nmnat1.sup.V9M/V9M mice showed preservation of cone and rod photoreceptor function that was stable for months. While ERGs from eyes treated with SC.AAV2/9 were approximately fifty percent of what was measured in non-injected wildtype retinas, this difference is consistent with prior observations that subretinal injections dampen the ERG response, likely due to mechanical damage sustained during the surgical procedure..sup.50 This possibility is supported by the finding that the injected retinas of the wildtype littermates also tended to have b-wave amplitude decrements, although typically less extensive, and regions in which the photoreceptor layer was thinner following injection. In addition, photoreceptor degeneration that appears to have occurred during the viral incubation period may have also contributed to the lower signal. An alternative hypothesis is that some cells were augmented such that they overexpressed NMNAT1 and that this is not compatible with viability. However, the reason for such a ceiling effect on the therapeutic index for NMNAT1/NAD.sup.+ supplementation is not obvious. In the mutant mice, the highest dose (210.sup.9 gc/L) of the reagent produced the best outcome, but due to manufacturing constraints, it was not possible to test the effects of even higher levels.
(17) The present methods can use ubiquitously activating promoters or cell type-specific promoters. Characterization of the p. V9M-Nmnat1 mouse model indicated that photoreceptors were the first cells to be affected by the disease, followed by inner retinal cells and the RPE,.sup.25 and we know from experiments described here that the photoreceptors must be treated if the retina is to be preserved. Thus in some methods a photoreceptor-specific promoter is used to provide rescue of the retina. However, other cell types may degenerate at slower rates in response to low nuclear NAD, causing a secondary degeneration that cannot be mitigated by treating only photoreceptors. In that case, ganglion cell, bipolar, and Mller glia-specific promoters could then be used.
(18) As shown herein, the exemplary SC.AAV2/9 reagent with CASI driving NMNAT1 expression demonstrated success use of gene augmentation therapy in patients with NMNAT1-associated retinal degeneration. In some embodiments, rapidly driving the initiation of transgene expression with a self-complementary vector is an optimal strategy.
(19) This therapy has the potential to provide many decades of vision to people worldwide who would otherwise sustain severe vision loss early in life.
(20) Vectors
(21) Described herein are targeted expression vectors for in vivo transfection and expression of a polynucleotide that encodes a NMNAT1 polypeptide as described herein, in the retina, e.g., in photoreceptors, e.g., primarily or only in photoreceptors. In some embodiments the expression is also in inner retinal cells or RPE cells. Expression constructs of such components can be administered in any effective carrier, e.g., any formulation or composition capable of effectively delivering the component gene to cells in vivo. Approaches include insertion of the gene in viral vectors, including recombinant retroviruses, adenovirus, adeno-associated virus, lentivirus, and herpes simplex virus-1, alphavirus, vaccinia virus, or recombinant bacterial or eukaryotic plasmids; preferred viral vectors are adeno-associated virus type 2 (AAV2). Viral vectors transfect cells directly; plasmid DNA can be delivered naked or with the help of, for example, cationic liposomes (lipofectamine) or derivatized (e.g., antibody conjugated), cationic dendrimers, inorganic vectors (e.g., iron oxide magnetofection), lipidoids, cell-penetrating peptides, cyclodextrin polymer (CDP), polylysine conjugates, gramacidin S, artificial viral envelopes or other such intracellular carriers, as well as direct injection of the gene construct or CaPO4 precipitation carried out in vivo.
(22) An exemplary approach for in vivo introduction of nucleic acid into a cell is by use of a viral vector containing nucleic acid, e.g., a cDNA. Infection of cells with a viral vector has the advantage that a large proportion of the targeted cells can receive the nucleic acid. Additionally, molecules encoded within the viral vector, e.g., by a cDNA contained in the viral vector, are expressed efficiently in cells that have taken up viral vector nucleic acid.
(23) Viral vectors can be used as a recombinant gene delivery system for the transfer of exogenous genes in vivo, particularly into humans. These vectors provide efficient delivery of genes into cells, and in some cases the transferred nucleic acids are stably integrated into the chromosomal DNA of the host. Protocols for producing recombinant viruses and for infecting cells in vitro or in vivo with such viruses can be found in Ausubel, et al., eds., Gene Therapy Protocols Volume 1: Production and In Vivo Applications of Gene Transfer Vectors, Humana Press, (2008), pp. 1-32 and other standard laboratory manuals.
(24) A preferred viral vector system useful for delivery of nucleic acids is the adeno-associated virus (AAV). Adeno-associated virus is a naturally occurring defective virus that requires another virus, such as an adenovirus or a herpes virus, as a helper virus for efficient replication and a productive life cycle. (For a review see Muzyczka et al., Curr. Topics in Micro and Immunol. 158:97-129 (1992); see also Domenger and Grimm, Human Molecular Genetics, 28 (R1): R3-R14 (October 2019)). AAV vectors efficiently transduce various cell types and can produce long-term expression of transgenes in vivo. Although AAV vector genomes can persist within cells as episomes, vector integration has been observed (see for example Deyle and Russell, Curr Opin Mol Ther. 2009 August; 11 (4): 442-447; Asokan et al., Mol Ther. 2012 April; 20 (4): 699-708; Flotte et al., Am. J. Respir. Cell. Mol. Biol. 7:349-356 (1992); Samulski et al., J. Virol. 63:3822-3828 (1989); and Mclaughlin et al., J. Virol. 62:1963-1973 (1989)). AAV vectors, particularly AAV2, have been extensively used for gene augmentation or replacement and have shown therapeutic efficacy in a range of animal models as well as in the clinic; see, e.g., Mingozzi and High, Nature Reviews Genetics 12, 341-355 (2011); Deyle and Russell, Curr Opin Mol Ther. 2009 August; 11 (4): 442-447; Asokan et al., Mol Ther. 2012 April; 20 (4): 699-708. AAV vectors containing as little as 300 base pairs of AAV can be packaged and can produce recombinant protein expression. Space for exogenous DNA is limited to about 4.5 kb. For example, an AAV1, 2, 4, 5, or 8 vector can be used to introduce DNA into the retina, e.g., into photoreceptors, inner retinal cells, or RPE cells (such as those described in Maguire et al. (2008). Safety and efficacy of gene transfer for Leber's congenital amaurosis. N Engl J Med 358:2240-2248. Maguire et al. (2009). Age-dependent effects of RPE65 gene therapy for Leber's congenital amaurosis: a phase 1 dose-escalation trial. Lancet 374:1597-1605; Bainbridge et al. (2008). Effect of gene therapy on visual function in Leber's congenital amaurosis. N Engl J Med 358:2231-2239; Hauswirth et al. (2008). Treatment of leber congenital amaurosis due to RPE65 mutations by ocular subretinal injection of adeno-associated virus gene vector: short-term results of a phase I trial. Hum Gene Ther 19:979-990; Cideciyan et al. (2008). Human gene therapy for RPE65 isomerase deficiency activates the retinoid cycle of vision but with slow rod kinetics. Proc Natl Acad Sci USA 105:15112-15117. Cideciyan et al. (2009). Vision 1 year after gene therapy for Leber's congenital amaurosis. N Engl J Med 361:725-727; Simonelli et al. (2010). Gene therapy for Leber's congenital amaurosis is safe and effective through 1.5 years after vector administration. Mol Ther 18:643-650; Acland, et al. (2005). Long-term restoration of rod and cone vision by single dose rAAV-mediated gene transfer to the retina in a canine model of childhood blindness. Mol Ther 12:1072-1082; Le Meur et al. (2007). Restoration of vision in RPE65-deficient Briard dogs using an AAV serotype 4 vector that specifically targets the retinal pigmented epithelium. Gene Ther 14:292-303; Stieger et al. (2008). Subretinal delivery of recombinant AAV serotype 8 vector in dogs results in gene transfer to neurons in the brain. Mol Ther 16:916-923; and Vandenberghe et al. (2011). Dosage thresholds for AAV2 and AAV8 photoreceptor gene therapy in monkey. Sci Transl Med 3: 88ra54). In some embodiments, the AAV vector can include (or include a sequence encoding) an AAV capsid polypeptide described in WO 2015054653; for example, a virus particle comprising an AAV capsid polypeptide having an amino acid sequence selected from the group consisting of SEQ ID NOs: 1, 3, 5, 7, 9, 11, 13, 15, and 17 of WO 2015054653, and a NMNAT1-encoding sequence as described herein. In some embodiments, the AAV capsid polypeptide is as shown in Table 1 of WO 2015054653, reproduced here:
(25) TABLE-US-00001 Node Polypeptide (SEQ ID NO) Nucleic Acid (SEQ ID NO) Anc80 1 2 Anc81 3 4 Anc82 5 6 Anc83 7 8 Anc84 9 10 Anc94 11 12 Anc113 13 14 Anc126 15 16 Anc127 17 18
In some embodiments, the AAV capsid polypeptide is an Anc80 polypeptide, e.g., an exemplary polypeptide shown in SEQ ID NO: 19 (Anc80L27); SEQ ID NO: 20 (Anc80L59); SEQ ID NO: 21 (Anc80L60); SEQ ID NO: 22 (Anc80L62); SEQ ID NO: 23 (Anc80L65); SEQ ID NO: 24 (Anc80L33); SEQ ID NO: 25 (Anc80L36); and SEQ ID NO: 26 (Anc80L44).
(26) A variety of nucleic acids have been introduced into different cell types using AAV vectors (see for example the references cited above and those cited in Asokan et al., Molecular Therapy (2012); 20 4, 699-708; and Hermonat et al., Proc. Natl. Acad. Sci. USA 81:6466-6470 (1984); Tratschin et al., Mol. Cell. Biol. 4:2072-2081 (1985); Wondisford et al., Mol. Endocrinol. 2:32-39 (1988); Tratschin et al., J. Virol. 51:611-619 (1984); and Flotte et al., J. Biol. Chem. 268:3781-3790 (1993).
(27) In some embodiments, a self-complementary AAV is used, which contains an inverted repeat genome that folds to make double-stranded DNA.
(28) In some embodiments, a gene encoding NMNAT1 is entrapped in liposomes bearing positive charges on their surface (e.g., lipofectins), which can be tagged with antibodies against cell surface antigens of the target tissue (Mizuno et al., No Shinkei Geka 20:547-551 (1992); PCT publication WO91/06309; Japanese patent application 1047381; and European patent publication EP-A-43075).
(29) The vectors can also include promoters, enhancers (e.g., CMV enhancer), other cis-regulatory elements, and/or capsid serotype variants. With regard to promoters, vectors can include promoters that drive expression in many cell types (e.g., CAG, CMV, or CASI) and photoreceptor cells (RHO, rhodopsin kinase (GRK1) and cone arrestin (CAR)) or RPE cells (e.g., promotors for RPE-specific proteins such as VMD2, RPE65, RLBP1, RGR, or TIMP3) (Esumi et al., Journal Biological Chemistry. 2004; 279:19064-73; Guziewicz et al., PLOS One. 2013; 8: e75666; Allocca et al., J Virol. 2007; 81:11372-80; see also Domenger and Grimm, Human Molecular Genetics, 28 (R1): R3-R14 (October 2019)). Synthetic promoters ProC1 and ProDS could also be used, see, e.g., Jttner et al. Nat Neurosci. 2019 August; 22 (8): 1345-1356. Other cis-regulatory elements can include woodchuck hepatitis virus post-transcriptional regulatory element (WPRE) or minute virus of mice (MVM) intron (see Domenger and Grimm, Human Molecular Genetics, 28 (R1): R3-R14 (October 2019)).
(30) The pharmaceutical preparation of the gene therapy construct can consist essentially of the gene delivery system (viral vector and any associated agents such as helper viruses, proteins, lipids, and so on) in an acceptable diluent, or can comprise a slow release matrix in which the gene delivery vehicle is embedded. Alternatively, where the complete gene delivery system can be produced intact from recombinant cells, e.g., retroviral vectors, the pharmaceutical preparation can comprise one or more cells, which produce the gene delivery system.
(31) Sequences
(32) The present methods include delivery of sequences encoding human NMNAT1. Exemplary human nicotinamide nucleotide adenylyltransferase 1 (NMNAT1) sequences are shown in the following table:
(33) TABLE-US-00002 Transcript Protein Isoform encoded Variant NM_022787.4 NP_073624.2 isoform 1 variant (1) NM_001297778.1 NP_001284707.1 isoform 1 variant (2) NM_001297779.2 NP_001284708.1 isoform 2 variant (3)
(34) Variant (1) encodes the longer isoform (1). Variant (2) differs in the 5 UTR, compared to variant 1. Variants 1 and 2 encode the same isoform (1). Variant (3) lacks an exon and contains an alternate 3 terminal exon, resulting in a different 3 coding region and 3 UTR, compared to variant 1. The encoded isoform (2) has a distinct C-terminus and is shorter than isoform 1.
(35) In some embodiments, the sequence encoding NMNAT1 comprises SEQ ID NO: 2, or a sequence that is at least 80, 85, 90, 95, 97, 98, or 99% identical to SEQ ID NO: 2.
(36) Human NMNAT1 Encoding Sequence
(37) TABLE-US-00003 (SEQIDNO:2) atggaaaattccgagaagactgaagtggttctccttgcttgtggttcat tcaatcccatcaccaacatgcacctcaggttgtttgagctggccaagga ctacatgaatggaacaggaaggtacacagttgtcaaaggcatcatctct cctgttggtgatgcctacaagaagaaaggactcattcctgcctatcacc gggtcatcatggcagaacttgctaccaagaattctaaatgggtggaagt tgatacatgggaaagtcttcagaaggagtggaaagagactctgaaggtg ctaagacaccatcaagagaaattggaggctagtgactgtgatcaccagc agaactcacctactctagaaaggcctggaaggaagaggaagtggactga aacacaagattctagtcaaaagaaatccctagagccaaaaacaaaagct gtgccaaaggtcaagctgctgtgtggggcagatttattggagtcctttg ctgttcccaatttgtggaagagtgaagacatcacccaaatcgtggccaa ctatgggctcatatgtgttactcgggctggaaatgatgctcagaagttt atctatgaatcggatgtgctgtggaaacaccggagcaacattcacgtgg tgaatgaatggatcgctaatgacatctcatccacaaaaatccggagagc cctcagaaggggccagagcattcgctacttggtaccagatcttgtccaa gaatacattgaaaagcataatttgtacagctctgagagtgaagacagga atgctggggtcatcctggcccctttgcagagaaacactgcagaagctaa gacatag
(38) In some embodiments, the sequence encoding NMNAT1 can be codon optimized so that it can be more efficiently translated into an amino acid sequence. Codon usage tables for different organisms are known in the art. An exemplary codon-optimized NMNAT1-encoding sequence is presented in
(39) Sequences useful in the present methods, vectors, and compositions include those that encode a human NMNAT1 protein, or a protein that is at least 80, 85, 90, 95, 97, 98, or 99% identical to a human NMNAT1 protein. An exemplary human NMNAT1 protein sequence is presented in NP_073624.2, shown herein as SEQ ID NO:3.
(40) Exemplary Human NMAT1 Protein Sequence
(41) TABLE-US-00004 (SEQIDNO:3) MENSEKTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIIS PVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKV LRHHQEKLEASDCDHQQNSPTLERPGRKRKWTETQDSSQKKSLEPKTKA VPKVKLLCGADLLESFAVPNLWKSEDITQIVANYGLICVTRAGNDAQKF IYESDVLWKHRSNIHVVNEWIANDISSTKIRRALRRGQSIRYLVPDLVQ EYIEKHNLYSSESEDRNAGVILAPLQRNTAEAKT
In some embodiments, human NMNAT1 protein isoform 2 can be used, e.g., as provided at GenBank Ref. No. NP 001284708.1.
(42) The human NMNAT1 protein can include one or more mutations, e.g., mutations at up to 1, 2, 3, 4, 5, 10, 15, or 20% of the residues. Such variants should retain the activity of the wild type protein, e.g., the ability to participate in regenerating NAD+ in cell nuclei. In some embodiments, the mutation is a conservative substitution. Such changes include substituting any of isoleucine (I), valine (V), and leucine (L) for any other of these hydrophobic amino acids; aspartic acid (D) for glutamic acid (E) and vice versa; glutamine (Q) for asparagine (N) and vice versa; and serine(S) for threonine (T) and vice versa. Other substitutions can also be considered conservative, depending on the environment of the particular amino acid and its role in the three-dimensional structure of the protein. For example, glycine (G) and alanine (A) can frequently be interchangeable, as can alanine (A) and valine (V). Methionine (M), which is relatively hydrophobic, can frequently be interchanged with leucine and isoleucine, and sometimes with valine. Lysine (K) and arginine (R) are frequently interchangeable in locations in which the significant feature of the amino acid residue is its charge and the differing pk's of these two amino acid residues are not significant. Still other changes can be considered conservative in particular environments (see, e.g. Table III of US 20110201052; pages 13-15 Biochemistry 2nd ED. Stryer ed (Stanford University); Henikoff et al., PNAS 1992 Vol 89 10915-10919; Lei et al., J Biol Chem 1995 May 19; 270 (20): 11882-6).
(43) To determine the percent identity of two amino acid sequences, or of two nucleic acid sequences, the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second amino acid or nucleic acid sequence for optimal alignment and non-homologous sequences can be disregarded for comparison purposes). In a preferred embodiment, the length of a reference sequence aligned for comparison purposes is at least 80% of the length of the reference sequence, and in some embodiments is at least 90% or 100%. The amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared. When a position in the first sequence is occupied by the same amino acid residue or nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position (as used herein amino acid or nucleic acid identity is equivalent to amino acid or nucleic acid homology). The percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences.
(44) The comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm. For example, the percent identity between two amino acid sequences can determined using the Needleman and Wunsch ((1970) J. Mol. Biol. 48:444-453) algorithm which has been incorporated into the GAP program in the GCG software package (available on the world wide web at gcg.com), using the default parameters, e.g., a Blossum 62 scoring matrix with a gap penalty of 12, a gap extend penalty of 4, and a frameshift gap penalty of 5.
(45) Methods
(46) In clinical settings, the vectors can be introduced into a subject by any of a number of methods, each of which is familiar in the art. Although other methods can be used, in some embodiments, the route of choice for delivery of gene therapy vectors to the retina is via sub-retinal injection. This provides access to the RPE and photoreceptor cells of the retina. Different serotypes of AAV have been shown to transduce these cell populations effectively after sub-retinal injection in animal studies (Vandenberghe et al., PLOS One. 2013; 8:e53463. PMCID: 3559681; Vandenberghe and Auricchio, Gene Therapy. 2012; 19:162-8; Vandenberghe et al., Science translational medicine. 2011; 3: 88ra54; Dinculescu et al., HumGene Ther. 2005; 16:649-63; Boye et al., Mol Ther. 2013; 21:509-19; Alexander and Hauswirth, Adv Exp Med Biol. 2008; 613:121-8). The sub-retinal injection approach is being used in the ongoing clinical trials of gene augmentation therapy for retinal degeneration caused by mutations in the RPE65 and CHM genes genetic disease (Maguire et al., New England Journal of Medicine. 2008; 358:2240-8; Bainbridge et al., New England Journal of Medicine. 2008; 358:2231-9; Cideciyan et al., Proceedings National Academy Sciences USA. 2008; 105:15112-7; Maguire et al., Lancet. 2009; 374:1597-605; Jacobson et al., Archives Ophthalmology. 2012; 130:9-24; Bennett et al., Science translational medicine. 2012; 4: 120ra15; MacLaren et al., Lancet. 2014; 383:1129-37). Sub-retinal injections can be performed using a standard surgical approach (e.g., as described in Maguire et al., 2008 supra; Bainbridge et al., 2008 supra; Cideciyan et al., 2008 supra; MacLaren et al., 2014 supra).
(47) Subjects
(48) The present methods can be used to treat subjects who have NMNAT1-associated retinopathy/retinal degeneration, e.g., Leber congenital amaurosis or early-onset severe retinal dystrophy (EOSRD). Such subjects can be identified by one of skill in the art and a diagnosis confirmed by genetic testing (e.g., sequencing to identify the presence of a mutation in the subject's NMNAT1 gene). See, e.g., Kumaran et al., Leber Congenital Amaurosis/Early-Onset Severe Retinal Dystrophy Overview in Gene Reviews, Adam M P, Ardinger H H, Pagon R A, et al., editors. Seattle (WA): University of Washington, Seattle; 1993-2020; Kumaran et al., Retin Cases Brief Rep. 2018 Jul. 11. doi: 10.1097/ICB.0000000000000754.
EXAMPLES
(49) The invention is further described in the following examples, which do not limit the scope of the invention described in the claims.
Materials and Methods
(50) The following materials and methods were used in the Examples below.
(51) Mouse Lines
(52) The p. V9M-Nmnat1 mouse line was derived previously from an N-ethyl-N-nitrosourea (ENU) mutagenesis screen..sup.25 For the purpose of increasing fecundity, the original C57B1/6J line was alternately outcrossed with wildtype 129S6/SvEvTac mice (Taconic, Rensselaer, NY) and wildtype C57BL/6J mice (The Jackson Laboratory, Bar Harbor, ME) to maintain a mixed C57B1/6J-129S6 genetic background. Wildtype CD1-IGS mice (Charles River, Wilmington, MA), used only to screen for reagent component toxicity, were maintained separately. Male and female mice were used in experiments without preference.
(53) Animal Husbandry
(54) Mice were bred and maintained in the Schepens Eye Research Institute Animal Care Facility where they were fed 4% fat rodent diet and water ad libitum and housed in a 12-hour light/12-hour dark cycle. This study conformed to the Association for Research in Vision and Ophthalmology Statement for the Use of Animals in Ophthalmic and Vision Research, and all procedures were approved by the Animal Care and Use Committee of the Schepens Eye Research Institute.
(55) Genotyping
(56) A tissue biopsy was prepared for polymerase chain reaction (PCR) using Allele-In-One Mouse Tail Direct Lysis Buffer (Allele Biotech, San Diego, CA) according to the manufacturer's instructions. PCR was carried out using the forward primer 5-CATGGCTGTGCTGAGGTG-3 (intron 1; SEQ ID NO:4) and reverse primer 5-AACAGCCTGAGGTGCATGTT-3 (exon 2; SEQ ID NO:5) to amplify a 691 bp region of Nmnat1 that includes codon 9. The 20 L PCR reactions had final concentrations of 200 mol/L for each primer, 200 nmol/L for each of the dNTPs (dATP, dGTP, dTTP, and dCTP), 2 mmol/L MgCl2, and 1 unit of Hot FirePol DNA polymerase (Solis BioDyne, Tartu, Estonia). The thermocycling protocol was 95 C. for 14 minutes; 30 cycles of 95 C. for 45 seconds, 53 C. for 45 seconds, 72 C. for 30 seconds; 72 C. for 7 minutes. Next, the amplified product was subjected to Sanger sequencing using primer 5-ACGTATTTGCCCACCTGTCT-3; SEQ ID NO:6, and the electropherograms were analyzed at c.25 to identify each mouse as being wildtype, heterozygous, or homozygous for Nmnat1.sup.V9M.
(57) DNA Construct and AAV Vector Preparation
(58) A codon-optimized human NMNAT1 cDNA (
(59) Plasmids containing the full constructs were generated using standard endotoxin-free molecular cloning techniques and validated by sequencing NMNAT1 and regions crossing ligation sites.
(60) AAV was prepared by the Grousbeck Gene Therapy Center of Massachusetts Eye and Ear, as described previously..sup.34 Purified virus was collected in a final buffer containing 1PBS, 35 mM NaCl, and 0.001% Pluronic F68 surfactant and then titered. The same buffer was used to further dilute the virus, if required, to achieve the target dose. To assist with the injection procedure, <0.25% of fluorescein (AK-Fluor, Akorn, Lake Forest, IL) was mixed into the working solution as a tracer.
(61) To troubleshoot AAV2/Anc80 reagent toxicity, injections were performed using specific modifications: 1) AAV2/Anc80 was manufactured with surfactant added only after production, 2) AAV2/Anc80 was diluted in low salt dilution buffer, 3) Saline only (vector removed), 4) Saline plus a 100 concentration of the surfactant (vector removed), 5) Saline (vector removed) with fluorescein.
(62) General Anesthesia
(63) For general anesthesia, a mixture of ketamine/xlyazine was delivered by intraperitoneal injection. Two-week-old mice received a dose of 37.5 mg/kg ketamine and 3.8 mg/kg xylazine and adult mice received a dose of 100 mg/kg ketamine and 20 mg/kg xylazine. To counteract the formation of permanent anesthesia-induced corneal opacities, a 2 mg/kg dose of Yohimbine HCL (Wedgewood Pharmacy, Swedesboro, NJ) was administered by subcutaneous injection immediately following each recovery procedure in which ketamine/xylazine was used (i.e., AAV injection, in vivo imaging, ERG)..sup.51,52 For neonatal mice, general anesthesia by hypothermia was induced by indirect exposure to ice..sup.53
(64) Virus Delivery
(65) In two-week-old mice, the Micro4 microinjection pump with RPE kit (World Precision Instruments, Sarasota, FL) was used to deliver the viral reagents into either the subretinal space or the vitreous chamber. Pupils were dilated using either Tropicamide (1%) or a half mixture of Tropicamide (0.25%), Phenyephrine hydrochloride (0.25%), and Cyclepentalate (1%). Mice were deeply anesthetized with ketamine/xylazine and local anesthesia was administered topically using Proparacaine hydrochloride (0.5%). Next, the eye was proposed and a 30 g syringe needle was used to puncture the superior-temporal sclera and retina immediately posterior to the episcleral vessels of limbus to make an entry route for a blunt-end 33 g cannula.
(66) For subretinal injections, the traversal of the cannula through the vitreous chamber was visualized via a dissecting microscope through the dilated pupil and the cannula tip was positioned in the subretinal space of the posterior part of the inferior-nasal quadrant of the eye. Four successive 185.5 nL boluses of reagent (0.75 L total) were injected, and the formation of a bleb was confirmed by visualization that was enhanced by the fluorescein tracer. The cannula was held in place for approximately three seconds following injection to avoid reflux of the reagent and then gently removed from the eye. Finally, the entry wound was treated by tamponade with a cotton swab. The eyes were then hydrated with artificial tears (Blink Tears, Abbott Laboratories, Chicago, IL), and the mice recovered from anesthesia on a heating pad.
(67) The procedure for intravitreal injection of two-week-old mice was identical, except that the cannula tip was positioned in the center of the vitreous chamber during injection.
(68) In neonates, subretinal injections were performed using the FemtoJet 4i microinjection system (Eppendorf, Hamburg, Germany). While the mice were anesthetized on ice, the tip of a 30 g hypodermic needle was used to separate the upper and lower eyelids. The eye was proposed and a custom beveled glass needle (Cat #C060609, Origio, Trumbull, CT) was directly inserted through the sclera and positioned in the underlying subretinal space. A single bolus of 0.5 L of reagent was administered at pressure of 330 hPa over 6 seconds, after which the needle was held in place for approximately three seconds to avoid reflux and then gently removed. The mice recovered from anesthesia on a heating pad.
(69) In Vivo Retinal Imaging
(70) En face and cross-sectional images of the retina were acquired using fundus photography and spectral domain optical coherence tomography (OCT) (
(71) Electroretinography
(72) Full-field, flash electroretinograms were collected from the mice as described previously..sup.25 Briefly, mice were dark adapted overnight, and rod and mixed rod/cone responses were generated using a 0.01 cd.Math.s/m.sup.2 (scotopic) and 10 cd.Math.s/m.sup.2 (scotopic) broadband light stimuli, respectively. Next, the mice were light adapted by exposure to a steady 30 cd/m.sup.2 (photopic) broadband light for 10 minutes, and this light remained on in the background during the acquisition of cone-isolated responses to a 20 cd.Math.s/m.sup.2 (photopic) broadband light stimulus.
(73) Statistics
(74) Statistical analyses were completed in Prism version 8.2.1 (GraphPad, San Diego, CA). For OCT and electroretinogram (ERG) time courses, a two-way ANOVA using a mixed effects regression model was performed. When analyzing the effect of treatment, the inferior retina of the non-injected eye was used as the negative control to which the means all other measurements were compared. The Dunnett post hoc test was used to account for Type I error generated from multiple comparisons testing. When analyzing the effects of injection and all quantitative data are reported as the meanS.E.M.
(75) Custom Anti-Human NMNAT1 Antibody Development
(76) Purified, full-length human NMNAT1 was used by Aves Labs (Tigard, OR) as the antigen to generate a custom polyclonal antibody in chicken. This antibody reacts strongly against human NMNAT1 with minimal cross-reactivity with the mouse ortholog. In
(77) Ex Vivo Retinal Imaging
(78) Immunohistochemistry
(79) Mice were euthanized by CO.sub.2 asphyxiation and immediately perfused through the heart using a Masterflex peristaltic pump (Cole-Parmer, Vernon Hills, IL). Each animal was perfused first with 0.13 mol/L phosphate-buffered saline (PBS) pH 7.2 to 7.4 that contained 2 U heparin/mL until the perfusate became clear, and this was followed by perfusion of 40 mL of 2% paraformaldehyde (PFA). Both solutions were warmed to 37 C. at the time of perfusion. A small vessel cauterizer (#18000-00, Fine Science Tools, Foster City, CA) was used to mark the cornea immediately anterior to the superior limbus. Eyes were enucleated, incubated at 2% PFA for 0.5 hr at room temperature, the anterior segment was removed, and then the remaining eye cup was incubated once again in 2% PFA for 0.5 hr at room temperature before being immersed in 30% sucrose at room temperature for at least one hour. Eye cups were embedded, sectioned at 10 L thickness by cryotomy, immunolabeled and stained, and imaged in either fluorescence or bright-field mode using the Eclipse Ti fluorescence microscope (Nikon, Tokyo, Japan) as described previously,.sup.25 unless otherwise imaged with the TCS SP8 confocal microscope (Leica, Wetzlar, Germany).
(80) Hemotoxylin & Eosin Labeling
(81) Eyes were enucleated following euthanasia by CO.sub.2 asphyxiation, washed in PBS, immediately submerged in O-fix tissue fixative [<70% ethanol, <5% methanol, <7% acetic acid, <4% acetic acid, and 4% formaldehyde] (Leica, 3800676), and incubated in the fixative overnight. Samples were then dehydrated in a series of graded ethyl alcohols, cleared in xylenes, and embedded in paraffin (Paraplast Plus, McCormick Scientific, Richmond, IL). 6 m thick sections were prepared using a Leica RM2145 microtome (Leica Biosystems, Buffalo Grove, IL) and then slides were stained with Gill's #2 Hematoxylin and Eosin-y (Fisher Scientific, Pittsburgh, PA USA) prior to being coverslipped with Permount mounting media.
Example 1. DNA Construct and AAV Reagent Preparation
(82) A codon-optimized human NMNAT1 cDNA (
(83) Four DNA constructs and six AAV vectors subtypes were used in combination to create four reagents that were delivered to mice as part of this study. A construct in which NMNAT1 was driven by the ubiquitously expressing CASI promoter was packaged into both a self-complementary (SC) and single-stranded (SS) version of AAV2/9. The SC vector was selected for testing because it activates gene expression more rapidly than traditional SS vectors..sup.31 Moreover, a construct containing an EGFP (enhanced green fluorescent protein) reporter gene, driven also by the CASI promoter and followed by WPRE (woodchuck hepatitis virus posttranslational regulatory element) that serves to enhance AAV2 mediated transduction in mouse retina,.sup.32 was packaged into SS.AAV2/9. This EGFP reagent was spiked in with the SC.AAV2/9 reagent (
Example 2. Gene Augmentation Using the Self-Complementary Vector Preserves Retinal Structure
(84) Administering gene augmentation therapy to Nmnat1194/19M mice at two weeks of age using the self-complementary (SC) AAV2/9 (SC.AAV2/9) reagent stably preserved retinal structure in Nmnat1.sup.V9M/V9M mice in a dose-dependent manner. This finding was determined by photoreceptor layer thickness measurements collected in vivo using optical coherence tomography (OCT). For injected eyes, measurements were taken proximal to the injection site in the inferior retina where rescue was anticipated to be most robust and in the superior retina that was distal from the injection site. Measurements in the non-injected fellow eyes of the Nmnat1.sup.V9M/V9M mice and in the non-injected eyes of age-matched littermate controls were acquired in the inferior retina in the plane equivalent to where the measurements were taken in the injected eyes (
(85) Middle and high titer injection, 110.sup.8 (gc/L) and 210.sup.9 gc/L, respectively, both provided significant rescue across the injected retina (
(86) At 110.sup.7 (gc/L), the lowest dosage tested for this reagent, a modest rescue of photoreceptor layer thickness was observed in the inferior region (proximal to the injection site) of the Nmnat1.sup.V9M/V9M retina, as compared to the fellow non-injected retina. This finding reached statistical significance at four and six months only, showing differences of 25.8 m6.5 (p=0.014) and 30.2 m7.9 (p=0.035) from the inferior region of the fellow retina, respectively. The photoreceptor layer of the rescued region only had approximately half the thickness of the equivalent region of the non-injected wildtype littermate control retina, and at no timepoint did the retinal region distal to the injection site (i.e., superior retina) show evidence of rescue.
(87) Because the loss of NMNAT1 activity may differ greatly by mutation, understanding whether overexpression of NMNAT1 is important. For this purpose, wildtype mice were injected with the SC.AAV2/9 reagent at the same titers as the mutant littermates. Across all dosages and time points, photoreceptor layer thickness was typically unaffected, with differences that were statistically significant being noted in only three instances (
(88) The largest disparity was in the superior region of the injected retina at nine months following a 210.sup.9 gc/L injection in which a decrease of 17.9 m6.9 (p=0.039) was measured. However, given that the inferior region (proximal to the injection site) of the same retina was unaffected, the decrement was unlikely due to toxicity.
Example 3. Single-Stranded Vectors do not Rescue Disease Phenotype
(89) In contrast to the SC.AAV2/9 reagent, the SS.AAV2/9, AAV2/7m.sup.8, and AAV2/Anc80 reagents did not provide stable structural rescue of the Nmnat1.sup.V9M/V9M retina. At two months of age, the inferior region of mutant retinas injected with the SS.AAV2.9 reagent showed a very modest rescue of 11.4 m4.3 (p=0.033) over the same region of the non-injected fellow eye (
(90) The structural rescue of the NMNAT1.sup.V9M/V9M retina associated with the SC.AAV2 reagent, as observed by OCT, was confirmed ex vivo by light microscopy. Hematoxylin and eosin (H&E) staining confirmed that, in stark contrast to the untreated mutant retina, the well-transduced regions of rescued retinas had all cell types intact and had elaborated photoreceptor outer segments (
(91) Furthermore, the pan-retinal transgene expression often extended beyond two-thirds of the tissue (
Example 4. Gene Augmentation Using a Self-Complementary Vector Preserves Retinal Function
(92) To assess whether the structural rescue of the retina translated to preservation of function, rod, mixed rod/cone, and cone-isolated responses to light stimulation were measured in vivo by ERG, a non-invasive procedure used to measure the electrical response of the retina to light stimulation. Specifically, the magnitude of the ERG b-wave, which is mediated by ON bipolar cells,.sup.38,39 was used as an indirect indicator of the photoreceptor response.sup.40 as well as a measure of inner retinal function. For retinas treated with the SC.AAV2/9 reagent, the b-wave was significantly greater than that of the untreated fellow eye by age four months and remained so through age six months for phototopic stimuli and at least nine months for scotopic and mixed rod/cone stimuli. The photopic ERGs tended to be greater in the treated mutant retina at age nine months than in the untreated fellow retina (
(93) Moreover, the responses associated with rescue were consistently lower than those of the untreated wildtype retinas. This effect may have originated from two sources. First, the OCT and histological images showed that even the most robust structural rescue was incomplete.
(94) Second, the injection itself appeared to dampen ERG signals since the injected wildtype retinas generated ERGs with amplitudes that tended to be smaller than those of the fellow retinas.
(95) Regardless, for each stimulation condition, the structure and implicit times of the rescued ERG waveforms were normal (
Example 5. Self-Complementary Vector Activates NMNAT1 Expression Earlier than Single-Stranded Vectors
(96) To understand why retinal structural and function was preserved to a greater extent when the transgene was delivered via the SC.AAV2/9 vector, we characterized early NMNAT1 expression profiles. At fourteen days post-injection, immunolabeling of NMNAT1 delivered by SC.AAV2/9 was detectable in all retinal layers with particularly high density in the outer nuclear layer (ONL) (
Example 9. A Successful Intervention Requires Transduction of Photoreceptors
(97) Furthermore, to determine whether an earlier intervention would produce better efficacy from the AAV2/Anc80 reagent, injections were performed in neonatal mice at postnatal day 0 (P0) through P2. While most cell types showed strong NMNAT1 expression, including cone photoreceptors, expression in rod photoreceptors was overwhelmingly weak (
REFERENCES
(98) 1. Chiang, P W, Wang, J, Chen, Y, Fu, Q, Zhong, J, Chen, Y, et al. (2012). Exome sequencing identifies NMNAT1 mutations as a cause of Leber congenital amaurosis. Nat Genet 44:972-974. 2. Koenekoop, R K, Wang, H, Majewski, J, Wang, X, Lopez, I, Ren, H, et al. (2012). Mutations in NMNAT1 cause Leber congenital amaurosis and identify a new disease pathway for retinal degeneration. Nat Genet 44:1035-1039. 3. Perrault, I, Hanein, S, Zanlonghi, X, Serre, V, Nicouleau, M, Defoort-Delhemmes, S, et al. (2012). Mutations in NMNAT1 cause Leber congenital amaurosis with early-onset severe macular and optic atrophy. Nat Genet 44:975-977. 4. Falk, M J, Zhang, Q, Nakamaru-Ogiso, E, Kannabiran, C, Fonseca-Kelly, Z, Chakarova, C, et al. (2012). NMNAT1 mutations cause Leber congenital amaurosis. Nat Genet 44:1040-1045. 5. Nash, B M, Symes, R, Goel, H, Dinger, M E, Bennetts, B, Grigg, J R, et al. (2018). NMNAT1 variants cause cone and cone-rod dystrophy. Eur J Hum Genet 26:428-433. 6. Garavaglia, S, D'Angelo, I, Emanuelli, M, Carnevali, F, Pierella, F, Magni, G, et al. (2002). Structure of human NMN adenylyltransferase. A key nuclear enzyme for NAD homeostasis. J Biol Chem 277:8524-8530. 7. Belenky, P, Bogan, K L, and Brenner, C (2007). NAD.sup.+ metabolism in health and disease. Trends Biochem Sci 32:12-19. 8. Lau, C, Niere, M, and Ziegler, M (2009). The NMN/NaMN adenylyltransferase (NMNAT) protein family. Front Biosci (Landmark Ed) 14:410-431. 9. Chiarugi, A, Dolle, C, Felici, R, and Ziegler, M (2012). The NAD metabolomea key determinant of cancer cell biology. Nat Rev Cancer 12:741-752. 10. Sasaki, Y, Margolin, Z, Borgo, B, Havranek, J J, and Milbrandt, J (2015). Characterization of Leber's Congenital Amaurosis-associated NMNAT1 Mutants. J Biol Chem. 11. Coppieters, F, Todeschini, A L, Fujimaki, T, Baert, A, De Bruyne, M, Van Cauwenbergh, C, et al. (2015). Hidden Genetic Variation in LCA9-Associated Congenital Blindness Explained by 5UTR Mutations and Copy-Number Variations of NMNAT1. Hum Mutat 36:1188-1196. 12. Conforti, L, Janeckova, L, Wagner, D, Mazzola, F, Cialabrini, L, Di Stefano, M, et al. (2011). Reducing expression of NAD+ synthesizing enzyme NMNAT1 does not affect the rate of Wallerian degeneration. FEBS J 278:2666-2679. 13. Berger, F, Lau, C, Dahlmann, M, and Ziegler, M (2005). Subcellular compartmentation and differential catalytic properties of the three human nicotinamide mononucleotide adenylyltransferase isoforms. J Biol Chem 280:36334-36341. 14. Carvalho, L S, and Vandenberghe, L H (2015). Promising and delivering gene therapies for vision loss. Vision Res 111:124-133. 15. Ong, T, Pennesi, M E, Birch, D G, Lam, B L, and Tsang, S H (2019).
Adeno-Associated Viral Gene Therapy for Inherited Retinal Disease. Pharm Res 36:34. 16. McCarty, D M (2008). Self-complementary AAV vectors; advances and applications. Mol Ther 16:1648-1656. 17. Lloyd, A, Piglowska, N, Ciulla, T, Pitluck, S, Johnson, S, Buessing, M, et al. (2019). Estimation of impact of RPE65-mediated inherited retinal disease on quality of life and the potential benefits of gene therapy. Br J Ophthalmol 103:1610-1614. 18. Lam, B L, Davis, J L, Gregori, N Z, MacLaren, R E, Girach, A, Verriotto, J D, et al. (2019). Choroideremia Gene Therapy Phase 2 Clinical Trial: 24-Month Results. Am J Ophthalmol 197:65-73. 19. Ghazi, N G, Abboud, E B, Nowilaty, S R, Alkuraya, H, Alhommadi, A, Cai, H, et al. (2016). Treatment of retinitis pigmentosa due to MERTK mutations by ocular subretinal injection of adeno-associated virus gene vector: results of a phase I trial. Hum Genet 135:327-343. 20. Cukras, C, Wiley, H E, Jeffrey, B G, Sen, H N, Turriff, A, Zeng, Y, et al. (2018). Retinal AAV8-RS1 Gene Therapy for X-Linked Retinoschisis: Initial Findings from a Phase I/IIa Trial by Intravitreal Delivery. Mol Ther 26:2282-2294. 21. Dyka, F M, Molday, L L, Chiodo, V A, Molday, R S, and Hauswirth, W W (2019). Dual ABCA4-AAV Vector Treatment Reduces Pathogenic Retinal A2E Accumulation in a Mouse Model of Autosomal Recessive Stargardt Disease. Hum Gene Ther 30:1361-1370. 22. Mccullough, K T, Boye, S L, Fajardo, D, Calabro, K, Peterson, J J, Strang, C E, et al. (2019). Somatic Gene Editing of GUCY2D by AAV-CRISPR/Cas9 Alters Retinal Structure and Function in Mouse and Macaque. Hum Gene Ther 30:571-589. 23. Alves, C H, and Wijnholds, J (2018). AAV Gene Augmentation Therapy for CRB1-Associated Retinitis Pigmentosa. Methods Mol Biol 1715:135-151. 24. Ofri, R, Averbukh, E, Ezra-Elia, R, Ross, M, Honig, H, Obolensky, A, et al. (2018). Six Years and Counting: Restoration of Photopic Retinal Function and Visual Behavior Following Gene Augmentation Therapy in a Sheep Model of CNGA3 Achromatopsia. Hum Gene Ther. 25. Greenwald, S H, Charette, J R, Staniszewska, M, Shi, L Y, Brown, S D, Stone, L, et al. (2016). Mouse Models of NMNAT1-Leber Congenital Amaurosis (LCA9) Recapitulate Key Features of the Human Disease. Am J Pathol 186:1925-1938. 26. Burgess-Brown, N A, Sharma, S, Sobott, F, Loenarz, C, Oppermann, U, and Gileadi, O (2008). Codon optimization can improve expression of human genes in Escherichia coli: A multi-gene study. Protein Expr Purif 59:94-102. 27. Gustafsson, C, Govindarajan, S, and Minshull, J (2004). Codon bias and heterologous protein expression. Trends Biotechnol 22:346-353. 28. Ill, C R, and Chiou, H C (2005). Gene therapy progress and prospects: recent progress in transgene and RNAi expression cassettes. Gene Ther 12:795-802. 29. Foster, H, Sharp, P S, Athanasopoulos, T, Trollet, C, Graham, I R, Foster, K, et al. (2008). Codon and mRNA sequence optimization of microdystrophin transgenes improves expression and physiological outcome in dystrophic mdx mice following AAV2/8 gene transfer. Mol Ther 16:1825-1832. 30. Sack, B K, Merchant, S, Markusic, D M, Nathwani, A C, Davidoff, A M, Byrne, B J, et al. (2012). Transient B cell depletion or improved transgene expression by codon optimization promote tolerance to factor VIII in gene therapy. PLOS One 7: e37671. 31. McCarty, D M, Monahan, P E, and Samulski, R J (2001). Self-complementary recombinant adeno-associated virus (scAAV) vectors promote efficient transduction independently of DNA synthesis. Gene Ther 8:1248-1254. 32. Patricio, M I, Barnard, A R, Orlans, H O, McClements, M E, and MacLaren, R E (2017). Inclusion of the Woodchuck Hepatitis Virus Posttranscriptional Regulatory Element Enhances AAV2-Driven Transduction of Mouse and Human Retina. Mol Ther Nucleic Acids 6:198-208. 33. Kim, J H, Lee, S R, Li, L H, Park, H J, Park, J H, Lee, K Y, et al. (2011). High cleavage efficiency of a 2A peptide derived from porcine teschovirus-1 in human cell lines, zebrafish and mice. PLOS One 6: e18556. 34. Zinn, E, Pacouret, S, Khaychuk, V, Turunen, H T, Carvalho, L S, Andres-Mateos, E, et al. (2015). In Silico Reconstruction of the Viral Evolutionary Lineage Yields a Potent Gene Therapy Vector. Cell Rep 12:1056-1068. 35. Dalkara, D, Byrne, L C, Klimczak, R R, Visel, M, Yin, L, Merigan, W H, et al. (2013). In vivo-directed evolution of a new adeno-associated virus for therapeutic outer retinal gene delivery from the vitreous. Sci Transl Med 5: 189ra176. 36. Zarranz-Ventura, J, Keane, P A, Sim, D A, Llorens, V, Tufail, A, Sadda, S R, et al. (2016). Evaluation of Objective Vitritis Grading Method Using Optical Coherence Tomography: Influence of Phakic Status and Previous Vitrectomy. Am J Ophthalmol 161:172-180 e171-174. 37. Saito, M, Barbazetto, I A, and Spaide, R F (2013). Intravitreal cellular infiltrate imaged as punctate spots by spectral-domain optical coherence tomography in eyes with posterior segment inflammatory disease. Retina 33:559-565. 38. Stockton, R A, and Slaughter, M M (1989). B-wave of the electroretinogram. A reflection of O N bipolar cell activity. J Gen Physiol 93:101-122. 39. Bush, R A, and Sieving, P A (1996). Inner retinal contributions to the primate photopic fast flicker electroretinogram. J Opt Soc Am A Opt Image Sci Vis 13:557-565. 40. Greenwald, S H, Kuchenbecker, J A, Roberson, D K, Neitz, M, and Neitz, J (2014). S-opsin knockout mice with the endogenous M-opsin gene replaced by an L-opsin variant. Vis Neurosci 31:25-37. 41. Carter-Dawson, L D, and La Vail, M M (1979). Rods and cones in the mouse retina. I I. Autoradiographic analysis of cell generation using tritiated thymidine. J Comp Neurol 188:263-272. 42. Carter, B J, Khoury, G, and Rose, J A (1972). Adenovirus-associated virus multiplication. I X. Extent of transcription of the viral genome in vivo. J Virol 10:1118-1125. 43. Sipo, I, Fechner, H, Pinkert, S, Suckau, L, Wang, X, Weger, S, et al. (2007). Differential internalization and nuclear uncoating of self-complementary adeno-associated virus pseudotype vectors as determinants of cardiac cell transduction. Gene Ther 14:1319-1329. 44. Wang, J, Xie, J, Lu, H, Chen, L, Hauck, B, Samulski, R J, et al. (2007). Existence of transient functional double-stranded DNA intermediates during recombinant AAV transduction. Proc Natl Acad Sci USA 104:13104-13109. 45. Petit, L, Ma, S, Cheng, S Y, Gao, G, and Punzo, C (2017). Rod Outer Segment Development Influences AAV-Mediated Photoreceptor Transduction After Subretinal Injection. Hum Gene Ther 28:464-481. 46. Xiong, W, MacColl Garfinkel, A E, Li, Y, Benowitz, L I, and Cepko, C L (2015). NRF2 promotes neuronal survival in neurodegeneration and acute nerve damage. J Clin Invest 125:1433-1445. 47. Geller, A M, Sieving, P A, and Green, D G (1992). Effect on grating identification of sampling with degenerate arrays. J Opt Soc Am A 9:472-477. 48. Geller, A M, and Sieving, P A (1993). Assessment of foveal cone photoreceptors in Stargardt's macular dystrophy using a small dot detection task. Vision Res 33:1509-1524. 49. Xiong, W, Wu, D M, Xue, Y, Wang, S K, Chung, M J, Ji, X, et al. (2019). AAV cis-regulatory sequences are correlated with ocular toxicity. Proc Natl Acad Sci USA 116:5785-5794. 50. Pawlyk, B S, Bulgakov, O V, Liu, X, Xu, X, Adamian, M, Sun, X, et al. (2010). Replacement gene therapy with a human RPGRIP1 sequence slows photoreceptor degeneration in a murine model of Leber congenital amaurosis. Hum Gene Ther 21:993-1004. 51. Turner, P V, and Albassam, M A (2005). Susceptibility of rats to corneal lesions after injectable anesthesia. Comp Med 55:175-182. 52. Koehn, D, Meyer, K J, Syed, N A, and Anderson, M G (2015).
(99) Ketamine/Xylazine-Induced Corneal Damage in Mice. PLOS One 10: e0132804. 53. Phifer, C B, and Terry, L M (1986). Use of hypothermia for general anesthesia in preweanling rodents. Physiol Behav 38:887-890. 54. Dunn, K C, Aotaki-Keen, A E, Putkey, F R, and Hjelmeland, L M (1996). ARPE-19, a human retinal pigment epithelial cell line with differentiated properties. Exp Eye Res 62:155-169.
OTHER EMBODIMENTS
(100) It is to be understood that while the invention has been described in conjunction with the detailed description thereof, the foregoing description is intended to illustrate and not limit the scope of the invention, which is defined by the scope of the appended claims. Other aspects, advantages, and modifications are within the scope of the following claims.