Anti-BCMA antibody and use thereof

Abstract

Provided are an antibody or antigen-binding fragment thereof that specifically binds to a B-cell maturation antigen (BCMA), a method of preparing the same, and use thereof. Accordingly, these can be utilized in effectively preventing or treating cancers.

Claims

1. An antibody or an antigen-binding fragment thereof that binds to B-cell maturation antigen (BCMA), wherein said antibody or antigen-binding fragment comprises: (a) a complementarity-determining region-H1 (CDR-H1) comprising the amino acid sequence of SEQ ID NO: 27, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 35, a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 46, a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 56, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 66, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 75; (b) a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 28, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 36, a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 47, a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 57, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 67, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 76; (c) a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 29, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 37, a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 48, a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 58, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 68, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 77; (d) a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 30, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 38, a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 49, a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 59, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 68, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 78; (e) a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 28, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 36, a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 47, a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 120, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 67, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 76; (f) a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 28, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 36, a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 47, a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 121, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 67, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 76; (g) a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 28, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 36, a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 47, a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 57, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 67, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 122; (h) a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 28, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 36, a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 47, a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 57, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 67, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 123; (i) a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 28, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 36, a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 47, a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 120, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 67, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 122; (j) a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 28, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 36, a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 47, a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 120, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 67, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 123; (k) a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 28, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 36, a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 47, a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 121, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 67, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 122; (l) a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 28, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 36, a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 47, a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 121, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 67, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 123; (m) a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 29, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 37, a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 48, a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 124, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 68, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 77, (n) a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 29, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 37, a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 48, a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 125, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 68, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 77; (o) a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 29, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 37, a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 48, a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 126, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 68, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 77; (p) a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 29, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 37, a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 48, a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 127, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 68, and a CDR-L3 comprising the amino acid sequence SEQ ID NO: 77; and (q) a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 29, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 37, a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 48, a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 128, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 68, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 77.

2. The antibody or antigen-binding fragment thereof of claim 1, wherein the antibody or antigen-binding fragment comprises a heavy chain variable region comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 5 to 8.

3. The antibody or antigen-binding fragment thereof of claim 1, wherein the antibody or antigen-binding fragment comprises a light chain variable region-includes comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 16 to 19 and 107 to 119.

4. The antibody or antigen-binding fragment thereof of claim 1, wherein the antibody or antigen-binding fragment inhibits binding between BCMA and a substance specifically binding to BCMA.

5. The antibody or antigen-binding fragment thereof of claim 4, wherein the substance specifically binding to BCMA is BAFF (B-cell activating factor belonging to the tumor necrosis factor family), APRIL (a proliferation inducing ligand), or a combination thereof.

6. The antibody or the antigen-binding fragment thereof of claim 1, wherein the antigen-binding fragment is scFv, (scFv).sub.2, Fv, Fab, Fab, F(ab).sub.2, or a combination thereof.

7. The antibody or the antigen-binding fragment thereof of claim 1, wherein the antibody or the antigen-binding fragment is conjugated with an anti-cancer drug.

8. A pharmaceutical composition, comprising the antibody or the antigen-binding fragment thereof of claim 1.

9. A method for treating multiple myeloma in an individual in need thereof, the method comprising: administering the antibody or the antigen-binding fragment thereof of claim 1 to the individual.

Description

BRIEF DESCRIPTION OF DRAWINGS

(1) FIG. 1A is a graph showing results of measuring, by enzyme-linked immunosorbent assay (ELISA), the binding ability of antibodies 1H, 2G, and 5G to human B-cell maturation antigen (BCMA) or monkey BCMA, and FIG. 1B is a graph showing results of measuring, by ELISA, the binding ability of antibodies B58, 2C6, 5C3, 5B5, 5A6, 5D5, 2F8, and 4H9 to human BCMA.

(2) FIG. 2A is a graph showing results of measuring, by fluorescence activated cell sorting (FACS), the binding ability of selected antibodies to cell-surface BCMA in H929 (multiple myeloma cells), OPM-2 (multiple myeloma cells), and human BCMA-overexpressed CHOK1-hBCMA cell lines, and FIG. 2B is a graph showing results of measuring, by FACS, the binding ability of selected antibodies to cell-surface BCMA in Raji (B-lymphocyte cancer cell lines), which do not express BCMA, and CHOK1 cell lines.

(3) FIG. 3 is a graph showing results of measuring, by ELISA, the binding ability of antibodies B58, 5A6, 5D5, and 5B5 to human, monkey, mouse, and rat BCMA.

(4) FIG. 4 is a graph showing results of measuring, by ELISA, the binding ability of antibodies B58, 5A6, 5D5, and 5B5 to human BCMA, human TACI, and human BAFF-receptors.

(5) FIGS. 5A, 5B, 5C and 5D are graphs showing results of competitive binding of antibodies B58, 5A6, 5D5, and 5B5 to other antibodies and human BCMA (Ref. Ab: J6MO antibody).

(6) FIG. 6A is a graph showing results of competitive binding of an APRIL ligand and an antibody to human BCMA, and FIG. 6B is a graph showing results of competitive binding of a BAFF ligand and an antibody to human BCMA.

(7) FIG. 7 is a graph showing results of an evaluation of antibody-dependent cell-mediated cytotoxicity (ADCC) of antibodies B58, 5A6, 5D5, 5B5, and 5A6 (DANA) to H929 cells and Raji cells.

(8) FIGS. 8A, 8B and 8C are graphs showing tumor size (mm.sup.2), tumor size (mm.sup.2) per antibody, and tumor weight (g) per antibody, respectively, according to time (days) after injection of multiple myeloma cancer cell line H929.

(9) FIGS. 9A, 9B and 9C are graphs showing tumor size (mm.sup.2), tumor size (mm.sup.2) per antibody, and tumor weight (g) per antibody, respectively, according to time (days) after injection of multiple myeloma cancer cell line OPM-2.

(10) FIGS. 10A and 10B are graphs showing the binding ability of mutant antibodies 5A6 and 5D5 and wild-type antibodies thereof to target antigens, and FIGS. 10C and 10D are graphs showing results of measuring, by FACS, the binding ability of selected antibodies to mutant antibodies 5A6 and 5D5 and wild-type antibodies to cell-surface BCMA.

(11) FIG. 11 is a graph showing the binding ability of mutant antibodies 5A6 LM6 and 5D5 LM4 and wild-type antibodies thereof to recombinant human BCMA antigens.

(12) FIG. 12 is a graph showing results of an evaluation of antibody-dependent cell-mediated cytotoxicity (ADCC) of mutant antibodies 5A6 LM6 and 5D5 LM4 and wild-type antibodies thereof.

(13) FIG. 13 is a graph of tumor size (mm.sup.2) according to time (days) when mutant antibodies 5A6 LM6 and 5D5 LM4 and wild-type antibodies thereof were administered to mice into which the multiple myeloma cancer cell line H929 was injected.

DETAILED DESCRIPTION

(14) One or more embodiments of the present disclosure will now be described in detail with reference to the following examples. However, these examples are only for illustrative purposes and are not intended to limit the scope of the one or more embodiments of the present disclosure.

Example 1. Preparation of Anti-BCMA Antibody

(15) 1. Preparation of Antigen

(16) Antigens were prepared as follows for the preparation of anti-BCMA antibodies. Antigens containing amino acid residues 5-54, 1-51, 1-54, and 4-48, respectively, from the N-terminus of the amino acid sequence of human BCMA (GenBank Accession No. NP_001183.2, SEQ ID NO: 1) were used.

(17) Specifically, an antigen containing amino acid residues 5-54 of human BCMA (GENSCRIPT, Z02731) (human BCMA (5-54)); an antigen containing amino acid residues 1-51 of human BCMA (made in house, expressed in CHO cells) fused to the Fc region of the human IgG1 (human BCMA-Fc (1-51)); an antigen containing amino acid residues 1-51 of human BCMA fused to the Fc region and His tag to the C-terminus thereof (10620-H03H, Sino Biological Inc.) (human BCMA-Fc/His (1-51)); and an antigen containing amino acid residues 4-48 of human BCMA (made in house, expressed in HEK293 cells) fused to the Fc region (human BCMA-Fc (4-48)) were prepared.

(18) Human BCMA-Fc (4-48) was prepared as follows. Polynucleotides encoding amino acid residues 4-48 of human BCMA were cloned into pAB1-Fc which is an animal cell expression vector including a CMV promoter. The cloned vector was transformed into HEK293E cells, and human BCMA-Fc (4-48) was purified using Protein A affinity chromatography. Human BCMA-Fc (1-51) was prepared in the same manner as described above.

(19) In addition, in order to confirm cross-reactivity between species, monkey (Rhesus) BCMA (1-53) (90103-C02H, Sino Biological Inc.), mouse BCMA (1-49) (50076-M01H, Sino Biological Inc.), and rat BCMA (1-49) (80156-R01H, Sino Biological Inc.), in which the Fc region of human IgG1 is fused, were used. The amino acid sequences of monkey BCMA (1-53), mouse BCMA, and rat BCMA are shown in Table 1 below.

(20) TABLE-US-00001 TABLE 1 SEQ ID Antigen Amino acid sequence (N->C) NO: Monkey MLQMARQCSQNEYFDSLLHDCKPCQLRCSS 2 BCMA (1-53) TPPLTCQRYCNASMTNSVKGMNA Mouse MAQQCFHSEYFDSLLHACKPCHLRCSNPPA 3 BCMA (1-49) TCQPYCDPSVTSSVKGTYT Rat BCMA MAQRCFHSEYFDSLLHACKPCRLRCSNPPA 4 (1-49) PCQPYCDPSMTSSVRGTYT
2. Library Phage Preparation and Phage-Display Panning

(21) Human-derived single-chain fragment variable (ScFv) phage library cells (Mol. Cells OT, 225-235, Feb. 28, 2009), which are able to bind to various antigens, were prepared. The prepared phage library was infected with the helper phage, and then, phage packing was induced. Thereafter, the culture product was centrifuged at 4,500 rpm for 15 minutes at 4 C., and then, 4% (w/v) PEG 6000 (Fluka, 81253) and 3% (w/v) NaCl (Sigma, S7653) were added to the supernatant and dissolved well, followed by incubating on ice for 1 hour. The resultant product was centrifuged at 4 C. at 8,000 rpm for 20 minutes, pellets were suspended in PBS, and then centrifused again at 4 C. at 12,000 rpm for 10 minutes to obtain a supernatant containing a library phage. The obtained library phage was stored at 4 C. until use.

(22) Panning was performed a total of three times in the following manner to screen for antibodies that are reactive to human BCMA or cross-reactive to human BCMA and monkey BCMA. 5 g of the antigen prepared according to Example 1-1 was added to an immunotube (maxisorp 444202) and incubated at 4 C. for 16 hours to coat the surface of the test tube with a protein. The supernatant was removed therefrom, and bovine serum albumin (BSA) was added thereto to block nonspecific binding.

(23) 10.sup.12 CFU of the phage library of prepared according to Example 1.2 was mixed with 1.5% (w/v) BSA, and the mixture was added to the target protein-coated immunoassay tube and reacted at 37 C. for 1 hour to allow a BCMA-specific phage to bind to the target protein. Subsequently, after multiple washing with a PBS-T (phosphate buffered saline including 0.05% (v/v) Tween 20) solution, phages bound to BCMA were recovered by using a 100 mM triethylamine solution. The recovered phages were neutralized with 1M Tris buffer (pH 7.4), and then, K12 ER2738 Escherichia coli was infected therewith, and the phages were recovered again. This cycle was repeatedly performed 4 times for phase panning. As the panning round progressed, the number of washes using PBS-T was increased to amplify and concentrate the antigen-specific phage.
3. Single Clone Phage Antibody Screening

(24) A single clone phase antibody screening procedure was performed to select, from a phage pool, a monoclonal antibody that specifically binds to BCMA.

(25) Specifically, the phage pool obtained according to Example 1.2 was sequentially diluted, and cultured on a solid medium containing LB-tetracycline/cabenicillin to obtain single colonies. Each colony was cultured on a 96-deep well plate so that OD600 was from 0.5 to 0.7. 20 MOI of helper phage was added to the culture, and reacted at 37 C. for 1 hour. Thereafter, kanamycin was added to the culture and incubated overnight at 30 C. On the next day, the culture was centrifuged and the supernatant thereof was collected, and then, ELISA was performed to select BCMA-specific phages. Each well of the ELISA plate was coated with 100 ng of recombinant BCMA, and then coated with 3% BSA to prevent nonspecific binding. Thereafter, the plate was washed with PBS. The prepared single clone phages was added to each well and incubated at 37 C. for 1 hour, and the plate was washed three times with PBS-T. ELISA was performed using horseradish peroxidase (HRP) conjugated anti-hemagglutinin (HA) antibody and tetramethylbenzidine (TMB, Sigma, T0440). Clones, which have an absorbance of 0.5 or more at a wavelength of 450 nm and also an absorbance of at least 5 times greater than that of the control which is anti-HA HRP alone, were selected. Eleven antibody clones (B58, 5A6, 5D5, 5B5, 2C6, 2F8, 4H9, 1H, 2G, 5G, and 5C3), which specifically bind to human BCMA, were selected.

(26) From the nucleotide sequences encoding the selected antibodies, the amino acid sequences of the heavy chain variable region (SEQ ID NOs: 5 to 15) and the amino acid sequences of the light chain variable region (SEQ ID NOs: 16 to 26) were analyzed, and complementarity-determining regions (CDR) were determined according to Kabat definition. The determined CDR amino acid sequences (N.fwdarw.C) of the heavy chains and light chains are shown in Tables 2 and 3, respectively.

(27) TABLE-US-00002 TABLE2 Antibody CDR-H1 CDR-H2 CDR-H3 B58 NYDMS(SEQIDNO:27) WIYPSDSSIYYADSVKG RGPFANKYRQFDY(SEQID (SEQIDNO:35) NO:46) 5A6 NYGVH(SEQIDNO:28) YISYSGGTYYNPSLKS RDSDDFGFDY(SEQIDNO: (SEQIDNO:36) 47) 5D5 DYGLS(SEQIDNO:29) LIDSSGSSTFYADSVKG KEHGLFDS(SEQIDNO:48) (SEQIDNO:37) 5B5 GHYWS(SEQIDNO:30) TVSGSGGDTFYADSVKG RGHSVMDV(SEQIDNO: (SEQIDNO:38) 49) 2C6 NYGMS(SEQIDNO:31) SIDYNGSTYYNPSLKS KEHGLFDS(SEQIDNO:48) (SEQIDNO:39) 2F8 NYGMS(SEQIDNO:31) EIIPIFDTSNYAQKFQG KIPGNRHDY(SEQIDNO: (SEQIDNO:40) 50) 4H9 GYSMS(SEQIDNO:32) SIYHTGYTYYNPSLKS RYKSGAFDI(SEQIDNO: (SEQIDNO:41) 51) 1H NYAMS(SEQIDNO:33) GISHSGSSTYYADSVKG HVYIIEFESLDI(SEQIDNO: (SEQIDNO:42) 52) 2G NYAMS(SEQIDNO:33) AISSSGSTIYYADSVKG AGYYGSIYAFDY(SEQID (SEQIDNO:43) NO:53) 5G NYAMS(SEQIDNO:33) GISQSGSSTYYADSVKG HAYIIEFESMDI(SEQIDNO: (SEQIDNO:44) 54) 5C3 DYYIH(SEQIDNO:34) AISGSGGSTYYADSVKG SDLGDTTFDS(SEQIDNO: (SEQIDNO:45) 55)

(28) TABLE-US-00003 TABLE3 Antibody CDR-L1 CDR-L2 CDR-L3 B58 SGSSSNIGSNSVS(SEQ ADSKRPS(SEQIDNO: GSWDYSLSGYV(SEQID IDNO:56) 66) NO:75) 5A6 QGDSLRSYYVN(SEQID DHSKRPT(SEQIDNO: QSYDSSTV(SEQIDNO: NO:57) 67) 76) 5D5 KASQDIDDDIN(SEQID DASLRAT(SEQIDNO: QQSLRTPI(SEQIDNO:77) NO:58) 68) 5B5 RASQGIDSYVA(SEQID DASLRAT(SEQIDNO: QQYNSWPI(SEQIDNO: NO:59) 68) 78) 2C6 RVSQSISSYLN(SEQID DASTRAI(SEQIDNO: QQVNSYPIT(SEQIDNO: NO:60) 69) 79) 2F8 TRMQRQSD(SEQID DNNKRPL(SEQIDNO: QSYDSNAYVV(SEQIDNO: NO:61) 70) 80) 4H9 RASQSVSRNLA(SEQID GVSS(SEQIDNO:71) QQYGSSPPT(SEQIDNO: NO:62) 81) 1H RASQSISNWLN(SEQID AASSLQS(SEQIDNO: QQSYSTPWT(SEQIDNO: NO:63) 72) 82) 2G RASQSISSYLN(SEQID ATSRLQS(SEQIDNO: QQSSSFPWT(SEQIDNO: NO:64) 73) 83) 5G RASQSISNWLN(SEQID AASSLQS(SEQIDNO: QQSYSTPWT(SEQIDNO: NO:63) 72) 82) 5C3 QASDDISNYLN(SEQID GVSNRAS(SEQIDNO: QQSYSTPPI(SEQIDNO: NO:65) 74) 84)

(29) Nucleotide sequences encoding heavy chain variable regions and nucleotide sequences encoding light chain variable regions are shown in Table 4 below.

(30) TABLE-US-00004 TABLE4 Nucleotidesequences nucleotidesequences Anti- encodingheavychain encodinglightchain body variableregions variableregions B58 SEQIDNO:85 SEQIDNO:96 5A6 SEQIDNO:86 SEQIDNO:97 5D5 SEQIDNO:87 SEQIDNO:98 5B5 SEQIDNO:88 SEQIDNO:99 2C6 SEQIDNO:89 SEQIDNO:100 2F8 SEQIDNO:90 SEQIDNO:101 4H9 SEQIDNO:91 SEQIDNO:102 1H SEQIDNO:92 SEQIDNO:103 2G SEQIDNO:93 SEQIDNO:104 5G SEQIDNO:94 SEQIDNO:105 5C3 SEQIDNO:95 SEQIDNO:106
4. Production of Anti-BCMA IgG Antibodies from Selected Anti-BCMA Phages

(31) Polynucleotides having nucleotide sequences encoding the antibodies selected according to Example 1.3 were synthesized. The prepared polynucleotides were cloned into animal cell expression vectors (heavy chain expression vector: pAB1-HC, and light chain expression vector: pAB1-LC). Prepared were a total of 22 vectors containing polynucleotides encoding heavy and light chains for each of the eleven antibody clones (B58, 5A6, 5D5, 5B5, 2C6, 2F8, 4H9, 1H, 2G, 5G, and 5C3). Each of the prepared vectors contained an IgG1-type sequence.

(32) CHOS cells were cultured in a CD-CHO (Gibco, 10743) medium, and the prepared vectors were introduced into the CHOS cells using polyethylenimine (PEI). Transduced CHOS cells were cultured in CD-CHO medium for about 7 days at 8% CO.sub.2, at 37 C. at 110 rpm.

(33) The prepared CHOS cell culture was passed through a MabSelect SuRe column (GE healthcare, 5 mL) equilibrated with equilibration buffer (50 mM Tris-HCl, pH7.5, and 100 mM NaCl) to allow the expressed antibody to bind to the column. The antibody was eluted with a solution of 50 mM Na-citrate (pH 3.4) and 100 mM NaCl, and then, neutralized using 1M Tris-HCl (pH 9.0) to obtain a final pH of 7.2. The buffer was then exchanged with PBS (pH 7.4) and the anti-BCMA IgG antibodies B58, 5A6, 5D5, 5B5, 2C6, 2F8, 4H9, 1H, 2G, 5G, and 5C3 were stored at 4 C. until use.

(34) 5. Preparation of Mutants of 5A6 and 5D5

(35) In order to improve the productivity of the selected 5A6 and 5D5 antibodies, mutated antibodies were prepared in accordance with the nucleotide sequences of Table 4 by mutating one or two amino acid residues in the light chain CDR of the antibody.

(36) The amino acid sequences of CDR-L1, CDR-L2, and CDR-L3 of the light chain variable region (SEQ ID NOS: 107 to 114) of the 5A6 mutant antibodies and the light chain variable region (SEQ ID NOS: 115 to 119) of the 5D5 mutant antibodies are shown in Table 5 and Table 6, respectively. In Tables 5 and 6, the underlined and bold amino acid residues are mutated moieties (WT: wild type, LM: light chain mutants).

(37) TABLE-US-00005 TABLE5 Antibody CDR-L1 CDR-L2 CDR-L3 5A6WT QGDSLRSYYVN(SEQID DHSKRPT(SEQIDNO: QSYDSSTV(SEQIDNO:76) NO:57) 67) 5A6LM1 QGESLRSYYVN(SEQID DHSKRPT(SEQIDNO: QSYDSSTV(SEQIDNO:76) NO:120) 67) 5A6LM2 QGDALRSYYVN(SEQID DHSKRPT(SEQIDNO: QSYDSSTV(SEQIDNO:76) NO:121) 67) 5A6LM3 QGDSLRSYYVN(SEQID DHSKRPT(SEQIDNO: QSYESSTV(SEQIDNO:122) NO:57) 67) 5A6LM4 QGDSLRSYYVN(SEQID DHSKRPT(SEQIDNO: QSYDASTV(SEQIDNO:123) NO:57) 67) 5A6LM5 QGESLRSYYVN(SEQID DHSKRPT(SEQIDNO: QSYESSTV(SEQIDNO:122) NO:120) 67) 5A6LM6 QGESLRSYYVN(SEQID DHSKRPT(SEQIDNO: QSYDASTV(SEQIDNO:123) NO:120) 67) 5A6LM7 QGDALRSYYVN(SEQID DHSKRPT(SEQIDNO: QSYESSTV(SEQIDNO:122) NO:121) 67) 5A6LM8 QGDALRSYYVN(SEQID DHSKRPT(SEQIDNO: QSYDASTV(SEQIDNO:123) NO:121) 67)

(38) TABLE-US-00006 TABLE6 Antibody CDR-L1 CDR-L2 CDR-L3 5D5WT KASQDIDDDIN(SEQID DASLRAT(SEQIDNO:68) QQSLRTPI(SEQIDNO: NO:58) 77) 5D5LM1 KASQDIDNDIN(SEQID DASLRAT(SEQIDNO:68) QQSLRTPI(SEQIDNO: NO:124) 77) 5D5LM2 KASQDIDEDIN(SEQID DASLRAT(SEQIDNO:68) QQSLRTPI(SEQIDNO: NO:125) 77) 5D5LM3 KASQDIDADIN(SEQID DASLRAT(SEQIDNO:68) QQSLRTPI(SEQIDNO: NO:126) 77) 5D5LM4 KASQDIDDAIN(SEQID DASLRAT(SEQIDNO:68) QQSLRTPI(SEQIDNO: NO:127) 77) 5D5LM5 KASQDIDDEIN(SEQID DASLRAT(SEQIDNO:68) QQSLRTPI(SEQIDNO: NO:128) 77)

Example 2. Kinetic Analysis of Anti-BCMA IgG Antibody

(39) 1. Determination of Binding Ability of Anti-BCMA IgG Antibody to BCMA

(40) (1) Determination of Binding Ability to Recombinant BCMA

(41) Specific binding abilities of the anti-BCMA IgG antibodies isolated in Example 1.4 to recombinant BCMA protein were analyzed by ELISA.

(42) Using recombinant human BCMA or monkey BCMA as an antigen, and HRP-conjugated Fab polychronal antibody reagent (Pierce, 31414) as a secondary antibody, ELISA was performed as described in Example 1.3. Absorbancies at 450 nm according to the concentrations of the antibodies are shown in FIGS. 1A and 1B. FIG. 1A illustrates graphs of the binding affinities of antibodies 1H, 2G, and 5G to human or monkey BCMA, and FIG. 1B illustrates graphs of the binding abilities of antibodies B58, 2C6, 5C3, 5B5, 5A6, 5D5, 4H9, and 2F8 to human BCMA.

(43) As shown in FIG. 1A, antibodies 1H, 2G, and 5G bound to human BCMA and monkey BCMA in a concentration-dependent manner. The binding ability to human BCMA was higher in the order of antibodies 2G, 1H, and 5G, and the binding ability to monkey BCMA was highest for antibody 1H, and was similar for antibodies 2G and 5G. As shown in FIG. 1B, it was found that all the eight anti-BCMA antibodies (B58, 2C6, 5C3, 5B5, 5A6, 5D5, 4H9, and 2F8) bound to human BCMA in a concentration-dependent manner.

(44) (2) Determination of Binding Ability to BCMA on Cell Surface

(45) The degrees of binding of the screened anti-BCMA IgG antibodies expressed on cell surfaces were analyzed using a fluorescence-activated cell sorting (FACS) system.

(46) Multiple myeloma cancer cells H929 (ATCC, CRL9068) and OPM-2 cell line (DSMZ, ACC 50), which are known to express BCMA, were prepared, and human BCMA-overexpressed CHOK1-hBCMA cell line (constructed by ABIBio) were prepared. As control groups, CHOK1 (ATCC, CRL-9618) and Raji (B-lymphocyte cancer cell line) (ATCC, CCL-86) cell lines that do not express BCMA were used.

(47) 10 g/ml of the seven IgG antibodies (B58, 5A6, 5D5, 5B5, 1H, 2G, and 5G) purified in Example 1.4 was added to the prepared cells, incubated at 4 C. for 1 hour, and then washed two times with a PBS buffer solution. The anti-human Fc-FITC was diluted in 1:400, incubated at 4 C. for 1 hour, and then washed with a PBS buffer solution. These processes were repeated. The fluorescence intensities of the cells were measured using a FACSCalibur, and are shown in FIGS. 2A and 2B. In FIGS. 2A and 2B, MFI indicates mean fluorescence intensity.

(48) As shown in FIGS. 2A and 2B, it was found that all the selected antibodies specifically bound to BCMA expressed on cell surfaces, but not to the cells in which BCMA is not expressed. Accordingly, it was confirmed that the selected antibody has a binding ability specific to the extracellular domain of BCMA expressed on the cell surface as well as to the recombinant BCMA protein, and it is possible to specifically target the BCMA-expressing cancer cell line using this anti-BCMA antibody.

(49) 2. Affinity Analysis of Anti-BCMA IgG Antibody to Human BCMA and Monkey BCMA

(50) The affinities of the selected 11 anti-BCMA antibodies to human BCMA and monkey BCMA were analyzed.

(51) A 96-well black microplate was mounted on a Biosensor tray case, 200 l of 1XKB was added to each of the 8 wells, and then 8 Ni-NTA biosensors (Fortebio) were inserted thereto for hydration for 10 minutes. For antigen fixation, 5 g/ml of recombinant human BCMA-His (Sino Biological Inc.) was diluted using 1XKB. Experiments were performed with a threshold of 0.5 to 1.0 nm, and Octet Data Acquisition 9.0 software was activated to create an Octet program template. The first step was for Baseline 1, the second step was for loading, and the threshold was fixed to 0.5 to 1.0 nm. In the third step, which was for Baseline 2, association for 5 minutes and dissociation for 20 minutes were performed. A plate temperature was fixed to 30 C., and the prepared buffer solution was placed in order into a new 96-well black microplate according to the Octet program template. 200 l of 1XKB used as Baseline 1 and recombinant human BCMA-Fc/His which is an antigen to be loaded were diluted to 5 g/ml, and 200 l of the dilution was added thereto. After adding 200 l of 1XKB used as Baseline 2, 200 l of the antibody to be reacted with the antigen was dispensed, and the instrument was operated. After completion of the experiment, an association constant (kon), a dissociation constant (kdis), and an equilibrium dissociation constant (KD) for each antibody were analyzed and calculated with Octet Analysis 9.0 software. The results thereof are shown in Table 7.

(52) TABLE-US-00007 TABLE 7 Antibody KD(M) kon(1/Ms) kdis(1/s) Chi R.sup.2 B58 2.73E11 7.35E+05 2.00E05 0.932 0.996 2C6 3.70E10 1.09E+06 4.03E04 1.227 0.989 2F8 1.04E07 1.47E+05 1.52E02 0.097 0.951 4H9 1.29E09 1.38E+06 1.79E03 1.256 0.895 1H 1.45E09 4.09E+05 5.92E04 0.317 0.988 2G 1.08E09 7.20E+05 7.80E04 0.933 0.982 5G 3.61E07 3.97E+04 1.43E02 0.177 0.948 5A6 2.12E11 5.09E+05 1.08E05 0.147 0.995 5B5 2.02E10 1.24E+06 2.50E04 0.929 0.991 5D5 1.14E10 9.19E+05 1.05E04 0.587 0.993 5C3 1.64E08 5.91E+05 9.66E03 0.269 0.936

(53) As shown in Table 7, the affinities of antibodies B58 and 5A6 had a KD value of about 10.sup.11, and those of antibodies 2C6, 5B5, and 5D5 had a KD value of about 10.sup.10. Thus it was confirmed that the selected antibodies have high binding ability to human BCMA protein. Affinities to monkey BCMA were additionally confirmed with three antibodies (5A6, 5B5, and 5D5) among the above antibodies, other than antibody 2C6 having insignificant binding ability to human BCMA on cell surface, and antibody B58 having no affinity to monkey BCMA, and the results are shown in Table 8.

(54) TABLE-US-00008 TABLE 8 Antibody KD(M) kon(1/Ms) kdis(1/s) Chi R.sup.2 5A6 4.51E09 3.61E+05 1.63E03 0.526 0.9943 5B5 4.61E10 4.79E+06 2.21E03 0.0652 0.9685 5D5 3.46E10 1.69E+06 5.85E04 0.0477 0.9945

(55) As shown in Table 8, it was confirmed that antibodies 5A6, 5B5, and 5D5 have high affinity for monkey BCMA as well as to human BCMA.

(56) 3. Analysis of Species Cross-Reactivity of Anti-BCMA Antibodies

(57) Whether or not antibodies B58, 5A6, 5D5, and 5B5 among the selected antibodies have cross-species binding ability was analyzed by ELISA.

(58) 100 ng of human, monkey, mouse, and rat BCMA antigens prepared in Example 1.1 were coated on the bottom of the plate, and then coated with 3% BSA to block nonspecific binding. Using the selected anti-BCMA IgG antibodies as primary antibodies, and the anti-human Fab HRP (1:20000 dilution) as a secondary antibody, ELISA assay was performed as described in Example 1.3.

(59) Absorbancies at 450 nm measured with a microplate reader are shown in FIG. 3, and half maximal effective concentrations (EC.sub.50) (nM) are shown in Table 9.

(60) TABLE-US-00009 TABLE 9 Antigen 5A6 antibody B58 antibody 5D5 antibody 5B5 antibody Human BCMA 100 79 140 63 Monkey BCMA 153 94 82 Mouse BCMA 150 110 Rat BCMA 98 65

(61) As shown in FIG. 3 and Table 9, antibody B58 had binding ability only to human BCMA, and antibody 5A6 had binding ability to human and monkey BCMA. It was confirmed that antibodies 5D5 and 5B5 have binding ability to all BCMAs of the assayed species (human, monkey, mouse, and rat).

(62) 4. Determination of Specificity of Anti-BCMA IgG to BCMA

(63) BCMA is known to be involved in the maturation process of B cells, and TACI and BAFF-receptors are known to be involved in this maturation process. Whether or not the selected antibodies bind to BCMA-related protein was analyzed by ELISA assay.

(64) Specifically, human BCMA-Fc (R&D system, 193-BC-050), TACI-Fc (R&D system, 174-TC), and BAFF-receptors (R&D system, 1162-BR) were diluted using a PBS buffer. Then, 100 ng per well was coated on the ELISA plate. Using the selected anti-BCMA IgG antibodies as primary antibodies, and the anti-human Fab HRP (1:20000 dilution) as a secondary antibody, ELISA assay was performed as described in Example 1.4(1). As a comparative group, anti-BCMA monoclonal antibody J6MO (GSK) was used. Absorbancies at 450 nm measured with a microplate reader are shown in FIG. 4.

(65) As shown in FIG. 4, antibodies B58, 5A6, 5D5, and 5B5 did not bind to TACI and BAFF-receptors, but bind only to BCMA. Therefore, it was confirmed that the selected four anti-BCMA antibodies B58, 5A6, 5D5, and 5B5 specifically bind to BCMA.

(66) 5. Relative Comparison of Epitopes for Each Anti-BCMA Antibody

(67) For relative comparison of binding sites to BCMA using the selected four antibodies (IgG), competitive binding abilities to human BCMA among the selected antibodies were analyzed.

(68) As described in Example 2.2, the binding abilities among the antibodies were analyzed using an Octet analysis system. In the Octet program template, the first step was baseline1, the second step was loading, and the threshold was fixed to 0.3 nm. The third step was set as the Baseline. In the fourth and fifth steps, each antibody was allowed to react, and the time was set to 10 minutes. The prepared buffer was placed in order into a new 96-well black microplate according to the Octet program template. 200 l of 1XKB used as Baseline 1 was added. Recombinant human BCMA (Fc and His tag fused), which is an antigen to be loaded, was diluted to 5 g/ml, and 200 l was added to each well. 200 l of 1XKB used as Baseline 1 was added. 200 l of the first antibody which binds first to the antigen was added to each well. 200 l of the second antibody was added to each well. The temperature of the test plate was fixed at 30 C. After all the samples were added, the instrument was operated. After the experiment was finished, competition between the first antibody and the second antibody was analyzed with Octet analysis 9.0 software, and the results are shown in FIGS. 5A to 5D (Ref. Ab: J6MO antibody).

(69) As shown in FIGS. 5A to 5D, it was confirmed that antibodies B58 and 5A6 had different binding sites on the antigen, that is, epitopes to which the antibodies bind, and antibodies 5B5 and 5D5 had the same epitopes. In addition, it was confirmed that the epitopes of antibodies 5B5 and 5D5 antibody were partially identical to that of antibody B58. Therefore, it was confirmed that the selected four types of antibodies have various binding sites to the antigen BCMA.

Example 3. Effect of Anti-BCMA IgG Antibodies on Cancer Cells

(70) 1. Neutralizing Effect of Anti-BCMA IgG Antibody

(71) Whether or not the selected anti-BCMA bodies could interrupt the binding of BCMA and ligands (APRIL and BAFF) was confirmed by ELISA-based solution competition assay.

(72) Specifically, human BCMA-Fc (R&D system, 193-BC-050) was diluted using a PBS buffer, and then 100 ng of the dilution per well was coated on the ELISA plate. After the coating, the plate was emptied, and 100 l of PBST containing 1% BSA was added to each well and incubated at 37 C. for 2 hours. The antibodies diluted at a concentration of 50 g/ml to 0.00028 g/ml were mixed with 10 ng/ml of APRIL protein (R&D, 5860-AP-010/CF) or 200 ng/ml of BAFF (R&D, 2149-BF-010/CF). An IgG1 antibody was used as a negative control, and a J6MO antibody was used as a comparative group.

(73) Using anti-HA-HRP (Roche, 12013819001) or anti-His-HRP (Roche, 11965085001) as secondary antibodies, ELISA assay was performed as described in Example 1.4(1). As a comparative group, anti-BCMA monoclonal antibody J6MO (GSK) was used. Absorbance was measured at 450 nm, and the results are shown in FIGS. 6A and 6B.

(74) As shown in FIGS. 6A and 6B, it was confirmed that B58 antibody effectively inhibits the binding of BCMA and BAFF, and also inhibits the binding of BCMA and APRIL. It was found that antibodies 5A6, 5B5, and 5D5 are unable to inhibit the binding ability of APRIL, but partially inhibit the binding ability of BAFF. Therefore, it was confirmed that the selected antibodies differ in the degree of inhibition of binding ability of BCMA with ligands, due to different binding sites for the target antigen BCMA, but there is a possibility of effectively inhibiting the growth of cancer cells by controlling and inhibiting the binding of the ligands.

(75) 2. Evaluation of Antibody-Dependent Cell-Mediated Cytotoxicity (ADCC)

(76) Antibody-dependent cell-mediated cytotoxicities (ADCC) of the selected antibodies were measured using an ADCC bioassay core kit (Promega, G0718).

(77) Specifically, H929 (ATCC, CRL9068) which greatly expresses human BCMA and Raji (ATCC, CCL86) which expresses less human BCMA were used as target cells. Antibodies B58, 5A6, 5D5, and 5B5 were prepared as anti-BCMA antibodies.

(78) In addition, in order to induce functional inhibition in the Fc part involved in antibody-dependent cytotoxicity and use the same as a negative control, 5A6 DANA mutant antibodies in which the aspartic acid amino acid residue at position 265 of the 5A6 Fc part was substituted with alanine (D265A), and the asparagine residue at the position 297 was substituted with alanine (N297A) were prepared (Cancer Cell, vol. 19, issue 1, pp. 101-113).

(79) An ADCC assay buffer was prepared by adding RPMI/1640 (Promega, G708A) and 4% low-IgG serum (Promega, AX20A). H929 and Raji cell lines resuspended in the ADCC assay buffer were added to 96 well plates (white, flat bottom, Corning, CLS3917) at 5000 cells per well (25 l). Anti-BCMA antibodies were prepared by serially diluting to from 133.3 nM (20 g/ml) with the ADCC assay buffer. 25 l of the prepared antibodies were added per well. After 3.6 ml of the ADCC assay buffer was placed in a 15-ml tube, the ADCC Bioassay Effector cell (Promega, G701A) was taken out of a liquid nitrogen tank, rapidly dissolved in a 37 C.-water bath, and then poured into the 15-ml tube containing the ADCC assay buffer. After being mixed well, 25 l of the effector cells were carefully added each time to the tube and cultured at 37 C. under 5% CO.sub.2 conditions for about 6 hours. Meanwhile, a Bio-Glo luciferase assay buffer (Promega, G720A) was dissolved at room temperature, and then added to a Bio-Glo luciferase assay substrate (Promega, G719A) and mixed well to prepare a BIO-GLO luciferase assay reagent. After cell culture, the 96-well plate was left at room temperature for about 10 minutes, and then 25 l of the BIO-GLO luciferase assay reagent was carefully added to each well. After the 96-well plate was left to stand at room temperature for 5 minutes, the intensity of luminescence was measured using a PHERAstar FS (from BMG LABTECH). The results were analyzed by non-linear regression (Curve fit) using a GraphPad Prism. The results are shown in FIG. 7.

(80) As shown in FIG. 7, in H929 cells with high expression of BCMA, the selected anti-BCMA antibodies induced antibody-dependent cell-mediated cytotoxicity (ADCC) in a concentration-dependent manner (B58>5A6=5D5>5B5). In the case of the 5A6 DANA mutant antibody in which the function of the Fc region was inhibited, ADCC was not induced, and it was confirmed that ADCC was caused by the Fc region of the antibody. For Raji where expression of BCMA was not observed, ADCC was not caused. Therefore, it was confirmed that the selected antibodies B58, 5A6, 5D5, and 5B5 can specifically bind to BCMA-expressing cancer cells, and thus may induce antibody cytotoxicity through Fc function.

(81) 3. Evaluation of Tumor Growth Inhibition of Anti-BCMA IgG Antibody Mouse Model Transplanted with Cancer Cell Line

(82) (1) Evaluation of Tumor Growth Inhibition in Multiple Myeloma Cancer Cell Line H929-Transplant Mouse Model

(83) 6-week-old male CB17-SCID mice were used for animal experiments after 7 days of acclimation. Before cell transplantation, hair was removed from the mouse cell transplant site, and an ear tag for individual identification was attached to the ear.

(84) Multiple myeloma cancer cell line H929 cultured according to cell transplantation conditions were collected on the cell transplanting date, and a cell count/viability was measured in PBS with a Beckman coulter device. Finally, the cell suspension was prepared such that the number of cells to be administered per 100 l of PBS was 110.sup.7 cells/each subject. Matrigel (BD) was added in the same volume as the cell suspension and mixed with a pipette. After inhalation anesthesia of the mice with isoflurane, 200 l of the cell suspension was subcutaneously administered to the right dorsum. The mice were placed in cages, and it was finally confirmed if there was no problem with activity after the mice were awaken from anesthesia. The tumor size was obtained by measuring the long and short axes of tumors by using a caliper, and calculating a final tumor size using the following equation.
Tumor size (mm.sup.3)=(0.5)(long axis)(short axis).sup.2

(85) Drug administration was started when the tumor size reached 269 mm.sup.3 on average. Administration drugs were administered to 5 groups (n=7 each) of the control group (PBS) and four anti-BCMA IgG antibodies (B58, 5A6, 5D5, and 5B5). Drugs were prepared at 2 mg/ml (based on 20 g; 100 l/head). The administration dose was 10 mg/kg, and the drug was administered twice a week, a total of 5 times, by intravenous tail injection. Body weight was measured using an animal scale. The body weight and tumor size were measured twice a week. On the 21st day after drug administration, the body weight and tumor size were measured, and the mice were euthanized to extract tumors from each mouse to measure the tumor weight.

(86) Tumor size (mm.sup.3) according to time (days) after tumor injection, tumor size (mm.sup.3) for each antibody, and tumor weight (g) for each antibody are shown in FIGS. 8A to 8C, in which arrows indicate drug administration time points. Table 10 shows the volume reduction rate (%) and the weight reduction rate (%) for each antibody compared to the control group (p<0.001).

(87) TABLE-US-00010 TABLE 10 Antibody Volume reduction rate (%) Weight reduction rate (%) 5B5 51.7 51.2 5D5 65.7 63.9 5A6 67.4 66.8 B58 63.8 60.2

(88) As shown in FIGS. 8A to 8C and Table 10, a tumor growth inhibitory effect was observed in the groups administered with four anti-BCMA IgG antibodies (B58, 5A6, 5D5, and 5B5), compared to the control group (PBS), in the H929-transplant mouse model. As a result of the final analysis of the tumor size of each group, the tumors of the antibody treatment groups of the present application were reduced by about 51.7% to about 67.4%, compared to the tumor size of the control group. As a result of one-way analysis of variance, statistical significance was found in the four anti-BCMA IgG antibodies compared to the control group (PBS) (p<0.001). Therefore, it was verified that when multiple myeloma was treated with the selected antibodies, the growth of tumors was significantly inhibited. In addition, according to evaluation results of the antibody-dependent cytotoxicity or BCMA to ligand binding interference, antibodies 5D5 and 5A6 showed lower activities than antibody B58. However, antibodies 5D5 and 5A6 showed an equivalent or greater effect than antibody B58 in in vivo efficacy evaluation. This means that the two antibodies may recognize epitopes that are advantageous for tumor growth inhibition, or the antibodies themselves may have excellent physical properties.

(89) (2) Evaluation of Tumor Growth Inhibition in Mouse Model Transplanted with Multiple Myeloma Cancer Cell Line OPM-2

(90) As described in Example 3.3(1), multiple myeloma cancer cell line OPM2 was transplanted into mice, and tumor growth inhibition by administration of antibodies was evaluated.

(91) Drug administration was started when the tumor size reached 172 mm.sup.3 on average. Drugs were administered to 4 groups (n=9 for each), including a control group (PBS) and three anti-BCMA IgG antibody groups (B58, 5A6, and 5D5). The administered drugs were prepared at 2 mg/ml (based on 20 g; 100 l/head) to reach an administration dose of 10 mg/kg. The administration dose was 10 mg/kg, and the drug was administered twice a week, a total of 5 times, by intravenous tail injection. On the 27th day after drug administration, the body weight and tumor size were measured, and the mice were euthanized to extract tumors from each mouse to measure the tumor weight.

(92) Tumor size (mm.sup.3), tumor size (mm.sup.3) for each antibody, and tumor weight (g) for each antibody according to time (days) after injection to tumors are shown in FIGS. 9A to 9C, in which arrows indicate drug administration time points. Table 11 shows the volume reduction rate (%) and the weight reduction rate (%) for each antibody compared to the control group (p<0.001).

(93) TABLE-US-00011 TABLE 11 Antibody Volume reduction rate (%) Weight reduction rate (%) 5D5 38.5 40.5 5A6 35.4 35.1 B58 42.5 41.4

(94) As shown in FIGS. 9A to 9C and Table 11, a tumor growth inhibitory effect was observed in the groups administered with three anti-BCMA IgG antibodies (B58, 5A6, and 5D5), compared to the control group (PBS), in the OPM-2-transplant mouse model. As a result of the final analysis of the tumor size of each group, the degree of tumor inhibition in each group, compared to the control group, was found to be 42.5% for antibody B58, 35.4% for antibody 5A6, and 38.5% for antibody 5D5. As a result of weight measurement, the weight reduction rate was 41.4% for antibody B58, 35.1% for antibody 5A6, and 40.5% for antibody 5D5, compared to the control group. As a result of one-way analysis of variance, anti-tumor effects of the three anti-BCMA IgG antibodies, as compared to the control group, were statistically significant (p<0.001), and the differences in tumor size and tumor weight between the three antibodies were not statistically significant. As shown in FIGS. 6 and 7, according to evaluation results of the antibody-dependent cytotoxicity or BCMA to ligand binding interference, antibodies 5D5 and 5A6 showed lower activities than antibody B58. However, antibodies 5D5 and 5A6 showed equivalent effects than antibody B58 in in vivo efficacy evaluation. This means that the two antibodies may recognize epitopes that are advantageous for tumor growth inhibition, or the antibodies themselves may be have excellent physical properties.

(95) 4. Confirmation of Binding Ability of Mutant Antibodies 5A6 and 5D5 to Target Antigen

(96) (1) Confirmation of Binding Ability of Wild-Type Antibodies 5A6 and 5D5 and Mutant Antibodies 5A6 and 5D5 to Recombinant BCMA

(97) As described in Example 1.5, anti-BCMA antibodies 5A6 and 5D5 were mutated to thereby prepare and purify eight mutant antibodies of 5A6 and five mutant antibodies of 5D5. Binding avidities of the mutated antibodies and wide-type antibodies to recombinant protein were analyzed, and the results are shown in FIGS. 10A and 10B.

(98) As shown in FIGS. 10A and 10B, 6 of the 8 mutant antibodies of 5A6 (5A6 LM1, 5A6 LM3, 5A6 LM4, 5A6 LM5, 5A6 LM7, and 5A6 LM8) had the same or lower binding activity, as compared to the wild-type antibody, whereas two antibodies (5A6 LM2 and 5A6 LM6) showed increased binding ability to antigen, as compared to the wild-type antibody. In the case of 5D5, two of the five mutant antibodies (5D5 LM1 and 5D5 LM2) had reduced antigen-binding activities as compared to wild type 5D5, whereas the other three mutant antibodies (5D5 LM3, 5D5 LM4, and 5D5 LM5) exhibited the antigen-binding activities equivalent to that of the wild type 5D5. The half maximal effective concentration (EC.sub.50) (nM) for each antibody is represented in Table 12.

(99) TABLE-US-00012 TABLE 12 Clone name EC.sub.50 (nM) 5A6 WT (Plate 1) 0.0631 5A6 WT (Plate 2) 0.0643 5A6 WT (Plate 3) 0.077 5A6 LM1 0.0818 5A6 LM2 0.0509 5A6 LM3 0.133 5A6 LM4 0.0823 5A6 LM5 0.103 5A6 LM6 0.0537 5A6 LM7 0.105 5A6 LM8 0.068 5D5 WT (Plate 1) 0.0708 5D5 WT (Plate 2) 0.0652 5D5 LM1 0.0939 5D5 LM2 0.0858 5D5 LM3 0.0593 5D5 LM4 0.0708 5D5 LM5 0.0763
(2) Confirmation of Binding Ability of Wild-Type 5A6, Wild-Type 5D5, and Mutants Thereof to BCMA on Cell Surface

(100) The binding avidities to cell-surface antigens were compared between wild-type antibodies and mutant antibodies thereof.

(101) Wild-type 5A6 antibody, wild-type 5D5 antibody, and mutant antibodies thereof were added to multiple myeloma cancer cells H929 (ATCC, CRL-9068) on which BCMA was highly expressed, and the binding levels of the antibodies to the cell surface were measured by fluorescence-activated cell sorting (FACS). The fluorescence intensities on the cell surface were measured, and the results are represented in FIGS. 10C and 10D. The mean fluorescence intensity (MFI) of each antibody is shown in Table 13.

(102) TABLE-US-00013 TABLE 13 Clone name MFI 5A6 WT 68.25 5A6 LM1 83.42 5A6 LM2 66.65 5A6 LM3 84.64 5A6 LM4 77.14 5A6 LM5 81.44 5A6 LM6 78.9 5A6 LM7 71.08 5A6 LM8 68.61 5D5 WT 36.35 5D5 LM1 32 5D5 LM2 29 5D5 LM3 31.5 5D5 LM4 62.3 5D5 LM5 73.6

(103) As shown in FIGS. 10C, 10D, and Table 13, in the case of antibody 5A6, the cell binding abilities of five mutant antibodies (5A6 LM1, 5A6 LM3, 5A6 LM4, 5A6 LM5, and 5A6 LM6) were increased as compared with the cell binding ability of wild-type antibody 5A6. In addition, the cell binding intensities of two mutant antibodies (5D5 LM4 and 5D5 LM5) were surely increased as compared to the cell binding ability of wild-type antibody 5D5. Therefore, it was found that due to partial changes in the CDR amino acids of the wild-type antibodies, the binding ability to recombinant BCMA and cell surface BCMA was partially improved.

(104) (3) Affinity Analysis of Mutant Antibodies 5A6 LM6 and 5D5 LM4 to Human BCMA

(105) Target antigen-binding affinities of mutant antibodies 5A6 LM6 and 5D5 LM4 and wild-type antibodies thereof to the human monomeric BCMA antigen were analyzed.

(106) In particular, the prepared antibodies were diluted with a 1HPS-EP buffer (GE Healthcare, BR-1006-69). The target antigen-binding affinity analysis was performed using a Biacore T200 (GE Healthcare). The antibodies were flowed onto a protein A chip at a contact time of 60 seconds, a stabilization time of 30 seconds, and a flow rate of 30 l/min until a capture level reached 128 RU (Response Unit), thereby preparing an antibody-captured protein A chip.

(107) The antigen was sequentially diluted with a 1HPS-EP buffer, by 2-fold each time, from 100 nM to 6.25 nM, thereby preparing a total of six samples. The 1HPS-EP buffer was used as a negative control group (blank).

(108) The prepared antigen was flowed across the antibody-captured protein A chip at a flow rate of 30 l/min for an association time of 60 seconds, followed by a disassociation phase for 180 seconds. Regeneration was performed with a 10-mM Glycine-HCL (pH 1.5) buffer (GE Healthcare, BR-1003-54) at a flow rate of 30 l/min for a contact time of 30 seconds.

(109) Graphs of response (in reaction unit (RU) with respect to reaction time (seconds) are represented in FIG. 11, and the target antigen-binding affinities of the antibodies calculated from the graphs are represented in Table 14.

(110) TABLE-US-00014 TABLE 14 Capture R.sub.maximum level (RU) Antibody Suitable (Target = ka kd K.sub.D (Target = name model 128 RU) (1/Ms) (1/s) (M) 12.5 RU) Chi.sup.2 5A6 WT 1:1 110.9~113.3 3.99 10.sup.5 2.49 10.sup.2 26.24 10.sup.8 10.45 0.0436 binding 5A6 LM6 1:1 120.6~122.6 5.09 10.sup.5 0.922 10.sup.2 1.81 10.sup.8 13.21 0.0304 binding 5D5 WT 1:1 107.6~108.1 2.632 10.sup.6 6.013 10.sup.2 2.284 10.sup.8 11.00 0.0186 binding 5D5 LM4 1:1 98.9~99.4 4.169 10.sup.6 5.937 10.sup.2 1.424 10.sup.8 11.62 0.0131 binding

(111) As shown in FIG. 11 and Table 14, the mutant antibody 5A6 LM6 exhibited a lower dissociation rate after bound to BCMA, as compared with wild-type 5A6. The mutant antibody 5D5 LM4 exhibited an increased rate of association to BCMA, as compared with wild-type 5A6. Therefore, it was found that the mutant antibodies 5A6 LM6 and 5D5 LM4 exhibited enhanced affinities to the target antigen, as compared with corresponding wild-type antibodies.

(112) 5. Evaluation of Antibody-Dependent Cell-Mediated Cytotoxicity (ADCC) of Mutant Antibodies 5A6 LM6 and 5D5 LM4

(113) In order to assess the antibody-dependent cell-mediated cytotoxicity (ADCC) of mutant antibodies 5A6 LM6 and 5D5 LM4 compared to the corresponding wild-type antibodies, measurement was performed according to the method described in Example 3.2. The measured ADCC results are represented in FIG. 12.

(114) As shown in FIG. 12, the mutant antibodies 5A6 LM6 and 5D5 LM4 exhibited an increased ADCC in BCMA-high expression cell line H929, as compared to the wild-type antibodies (see FIG. 12, left). Meanwhile, wild-type antibodies 5A6 WT and 5D5 WT, and mutant antibodies thereof were unable to induce antibody-dependent cell-mediated cytotoxicity (ADCC) in Jurkat cell lines in which BCMA was not expressed (see FIG. 12, right).

(115) In addition, mutant antibodies 5A6 NA and 5D5 NA in which the Fc region of the wild-type antibodies was functionally inhibited were unable to induce antibody-dependent cell-mediated cytotoxicity (ADCC) in BCMA-high expression H929 cell lines (see FIG. 12, left).

(116) Accordingly, mutant antibodies 5A6 LM6 and 5D5 LM4 exhibited an increased ability to induce BCMA-dependent cytotoxicity, as compared to the corresponding wild-type antibodies, which is consistent with an increase resulting from antigen-binding improvement, as proven in Example 3.4. Therefore, it was shown that mutant antibodies 5A6 LM6 and 5D5 LM4 are able to induce effective cancer cell growth inhibition, as compared with the corresponding wild-type antibodies.

(117) 6. Tumor Growth Inhibition Evaluation of Antibody 5A6 LM6 or 5D5 LM4 in Cancer Cell-Transplanted Mouse Model

(118) Human cancer-transplanted tumor mice were constructed by transplanting human myeloma NIH-H929 cell lines, in which BCMA is highly expressed, into a severe combined immunodeficiency (SCID) mouse model through the side of mice with 110.sup.7 cells/head for each. After the transplantation, when the tumor size reached 180 mm.sup.3 on average, the mice separated into groups (1st day).

(119) Five different antibodies, i.e., mutant antibodies 5A6 LM6 and 5D5 LM4, and the corresponding wild type antibodies 5A6 WT and 5D5 WT, and human IgG1 (InVivo Plus human IgG1 isotype control, BioXCell) as a negative control group were administered into tail veins of the mice, by 10 mg/kg each time with a 1-mL syringe, twice a week, a total of 4 times (1.sup.st day, 4.sup.th day, 7.sup.th day, and 11.sup.th day). After the first administration, the tumor sizes and weights in the tumor-transplanted mice were measured using a digital caliper, and an animal scale, twice a week (1.sup.st day, 4.sup.th day, 7.sup.th day, 11.sup.th day, 18.sup.th day, 22.sup.nd day, and 25th day).

(120) After 2 weeks from the last administration of the experimental materials, the mice were sacrificed using CO.sub.2 gas, tumors were extracted, and the volumes and weights of the extracted tumors were measured. The tumor volumes according to time are represented in FIG. 13, and the tumor volume reduction rate (%) and the tumor weight reduction rate (%) in the administration groups compared with the negative group are shown in Table 15.

(121) TABLE-US-00015 TABLE 15 Antibody Volume reduction rate (%) Weight reduction rate (%) 5A6 WT 90.3 84.1 5A6 LM6 81.5 71.1 5D5 WT 61.9 51.9 5D5 LM4 65.8 55.8

(122) As shown in FIG. 13, four different anti-BCMA antibodies (5A6 WT, 5A6 LM6, 5D5 WT, and 5D5 LM4) significantly reduce tumor growth compared to human IgG1 antibody which is a negative control group. In addition, as shown in Table 15, the four administered anti-BCMA antibodies showed statistical significance in the tumor growth inhibition rate (TGI %) compared to the negative control group (one-way analysis of variance, P-value<0.05). However, between the wild-type antibodies and their mutant antibodies (5A6 WT vs 5A6 LM6, and 5D5 WT vs 5D5 LM4), tumor size reduction was analyzed to be equivalent, and there was no statistical significance between the groups.

(123) As a result, it was found that mutant antibodies 5A6 LM6 and 5D5 LM4 showed increased in vitro activity (target antigen-binding ability and antibody-dependent cell-mediated cytotoxicity (ADCC) induction), and an equal level of tumor growth inhibitory ability to that of the respective wild type antibodies in an in vivo activity evaluation.

(124) This application contains references to amino acid sequences and/or nucleic acid sequences which have been submitted herewith as the sequence listing text file. The aforementioned sequence listing is hereby incorporated by reference in its entirety pursuant to 37 C.F.R. 1.52 (e).