COMPOSITIONS AND METHODS FOR ALTERING AMYLOID PRECURSOR PROTEIN (APP) PROCESSING
20250074951 ยท 2025-03-06
Inventors
Cpc classification
A61P25/28
HUMAN NECESSITIES
C12N2710/16622
CHEMISTRY; METALLURGY
C12N2710/16033
CHEMISTRY; METALLURGY
International classification
Abstract
The present invention relates to the discovery of compositions and methods for altering Amyloid Precursor Protein (APP) processing. Alerting APP processing is aids the treatment of neuropathological disorders such as those associated with HIV infection and Alzheimer's disease (AD). The invention includes fusion protein constructs that include an effector protein and an HSV US9 protein or functionally active fragment thereof that reduce the amount of amyloid -protein produced in a cell.
Claims
1. A construct comprising: an effector protein or a functionally active fragment thereof; a Herpes Simplex Virus (HSV) US9 protein or a functionally active fragment thereof, and wherein the effector protein or the functionally active fragment thereof is covalently coupled to the HSV US9 protein or the functionally active fragment thereof.
2. The construct of claim 1, wherein at least one of the following applies: (a) the effector protein comprises a non-amyloidogenic Amyloid Precursor Protein (APP)-cleaving protease; (b) the effector protein comprises a phosphotyrosine binding domain (PTB) of X11; (c) the effector protein or functionally active fragment thereof is covalently coupled to the N-terminus of the HSV US9 protein; or (d) the effector protein or functionally active fragment thereof is covalently coupled to the C-terminus of the HSV US9 protein.
3. The construct of claim 2, wherein the effector protein comprises a peptidase domain of A disintegrin and metalloproteinase (ADAM10).
4. (canceled)
5. The construct of claim 1, wherein the HSV US9 protein fragment comprises a HSV US9 transmembrane domain (TM).
6. (canceled)
7. (canceled)
8. The construct of claim 5, wherein at least one of the following applies: (a) the effector protein or functionally active fragment thereof is covalently coupled to the N-terminus of the TM; or (b) the effector protein or functionally active fragment thereof is covalently coupled to the C-terminus of the TM.
9. (canceled)
10. The construct of claim 1, wherein the effector protein or functionally active fragment thereof is covalently coupled to the HSV US9 protein or functionally active fragment thereof through a linker.
11. The construct of claim 10, wherein the linker comprises a polyethylene glycol (PEG) chain, a peptide, or a peptide nucleic acid (PNA).
12. The construct of claim 11, wherein the peptide comprises less than 50 amino acids.
13. The construct of claim 1, wherein the construct reduces APP -amyloidogenic processing.
14. The construct of claim 13, wherein at least one of the following applies: (a) the APP -amyloidogenic processing is reduced by promoting APP -cleavage; (b) the APP -amyloidogenic processing is reduced in a cell by targeting APP away from APP cleaving enzyme 1 (BACE1)-enriched domains and towards the plasma membrane of the cell to promote APP -cleavage by endogenous ADAM10.
15. (canceled)
16. The construct of claim 1, wherein at least one of the following applies: (a) the effector protein or functionally active fragment thereof is exposed on the luminal/extracellular side of a cell, or (b) the effector protein or functionally active fragment thereof is exposed on the cytoplasmic side of a cell.
17. (canceled)
18. An expression vector encoding the construct of claim 1.
19. The expression vector of claim 18, wherein the expression vector is selected from the group consisting of cosmids, plasmids, and viruses.
20. A method of reducing levels of amyloid -peptide or treating a neuropathological condition in a subject in need thereof, the method comprising administering a therapeutically effective amount of a pharmaceutical composition comprising the construct of claim 1 to the subject.
21. (canceled)
22. The method of claim 20, wherein the neuropathological condition comprises an Alzheimer's-associated disorder, an HIV-associated neurocognitive disorders, or combinations thereof.
23. The method of claim 20, wherein the subject is a mammal.
24. The method of claim 20, wherein the subject is human.
25. (canceled)
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0009] The following detailed description of specific embodiments of the invention will be better understood when read in conjunction with the appended drawings. For the purpose of illustrating the invention, the drawings illustrate specific embodiments. It should be understood, however, that the invention is not limited to the precise arrangements and instrumentalities of the embodiments shown in the drawings.
[0010]
[0011]
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
DETAILED DESCRIPTION OF THE INVENTION
[0031] Misprocessing of the Amyloid Precursor Protein (APP) to form amyloid -protein is associated with neuropathological conditions such as Alzheimer's Disease and HIV-Associated Neurocognitive Disorders (HAND). In the amyloidogenic pathway, the APP fragment generated by the interaction of APP with APP cleaving enzyme 1 (BACE1) further undergoes additional processing by the -secretase presenilin-1 to yield amyloid -peptides. Therefore, reduced accumulation of -cleaved APP would reduce amyloid -peptides.
[0032] The intracellular trafficking of the Herpes Simplex Virus US9 protein overlaps with that of the enzymatic machinery responsible of APP processing, and therefore it was thought that US9 could enable targeting the functional cargos to cellular regions in which APP and (BACE1) interact. Hence, in the present invention US9-based constructs were designed to alter the APP processing leading to amyloid formation, in which either the full length US9 or its trans-membrane domain is covalently linked to an effector protein. These constructs localize to membrane rafts (where catabolic ceramide generation is believed to promote APP processing to amyloid -protein) and alter APP processing in the cell.
Definitions
[0033] As used herein, each of the following terms has the meaning associated with it in this section.
[0034] Unless defined otherwise, all technical and scientific terms used herein generally have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Generally, the nomenclature used herein and the laboratory procedures in animal pharmacology, pharmaceutical science, separation science and organic chemistry are those well-known and commonly employed in the art. It should be understood that the order of steps or order for performing certain actions is immaterial, so long as the present teachings remain operable. Moreover, two or more steps or actions can be conducted simultaneously or not.
[0035] As used herein, the articles a and an refer to one or to more than one (i.e., to at least one) of the grammatical object of the article. By way of example, an element means one element or more than one element.
[0036] As used herein, the term composition or pharmaceutical composition refers to a mixture of at least one compound useful within the invention with a pharmaceutically acceptable carrier. The pharmaceutical composition facilitates administration of the compound to a patient or subject. Multiple techniques of administering a compound exist in the art including, but not limited to, intravenous, oral, aerosol, parenteral, ophthalmic, nasal, pulmonary and topical administration.
[0037] A disease as used herein is a state of health of an animal wherein the animal cannot maintain homeostasis, and wherein if the disease is not ameliorated then the animal's health continues to deteriorate.
[0038] A disorder as used herein in an animal is a state of health in which the animal is able to maintain homeostasis, but in which the animal's state of health is less favorable than it would be in the absence of the disorder. Left untreated, a disorder does not necessarily cause a further decrease in the animal's state of health.
[0039] As used herein, the term effector protein refers to a protein capable of modulating enzyme activity, gene expression, and/or cell signaling.
[0040] As used herein, the term fragment, as applied to a nucleic acid, refers to a subsequence of a larger nucleic acid. A fragment of a nucleic acid can be at least about 15 nucleotides in length; for example, at least about 50 nucleotides to about 100 nucleotides; at least about 100 to about 500 nucleotides, at least about 500 to about 1000 nucleotides; at least about 1000 nucleotides to about 1500 nucleotides; about 1500 nucleotides to about 2500 nucleotides; or about 2500 nucleotides (and any integer value in between). As used herein, the term fragment, as applied to a protein or peptide, refers to a subsequence of a larger protein or peptide. A fragment of a protein or peptide can be at least about 20 amino acids in length; for example, at least about 50 amino acids in length; at least about 100 amino acids in length; at least about 200 amino acids in length; at least about 300 amino acids in length; or at least about 400 amino acids in length (and any integer value in between).
[0041] Encoding refers to the inherent property of specific sequences of nucleotides in a polynucleotide, such as a gene, a cDNA, or an mRNA, to serve as templates for synthesis of other polymers and macromolecules in biological processes having either a defined sequence of nucleotides (i.e., rRNA, tRNA and mRNA) or a defined sequence of amino acids and the biological properties resulting therefrom. Thus, a gene encodes a protein if transcription and translation of mRNA corresponding to that gene produces the protein in a cell or other biological system. Both the coding strand, the nucleotide sequence of which is identical to the mRNA sequence and is usually provided in sequence listings, and the non-coding strand, used as the template for transcription of a gene or cDNA, can be referred to as encoding the protein or other product of that gene or cDNA.
[0042] As used herein, the term functionally active as applied to a fragment of a protein or polypeptide refers to the fact that the fragment has substantially the same biological and/or functional activity as the protein or polypeptide itself. In certain embodiments, the functionally active fragment has at least and/or greater than about 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% of the functional activity of the protein or polypeptide.
[0043] As used herein, the term g9A10pep refers to a construct composed of a reporter gfp (green fluorescent protein), full length Herpes Simplex Virus (HSV) US9, and an effector protein composed of the peptidase domain of A disintegrin and metalloproteinase 10 (ADAM 10).
[0044] As used herein, the term gPTB9TM refers to a construct composed of a reporter gfp (green fluorescent protein), an effector protein composed of the phosphotyrosine binding domain (PTB) of X11, and the HSV US9 trans-membrane domain (TM).
[0045] The terms patient, subject or individual are used interchangeably herein, and refer to any animal, or cells thereof whether in vitro or in situ, amenable to the methods described herein. In a non-limiting embodiment, the patient, subject or individual is a human. In other embodiments, the patient is a non-human mammal including, for example, livestock and pets, such as ovine, bovine, porcine, canine, feline and murine mammals. In yet other embodiments, the patient is an avian animal or bird. Preferably, the patient, individual or subject is human.
[0046] As used herein, the term pharmaceutically acceptable refers to a material, such as a carrier or diluent, which does not abrogate the biological activity or properties of the compound, and is relatively non-toxic, i.e., the material may be administered to an individual without causing undesirable biological effects or interacting in a deleterious manner with any of the components of the composition in which it is contained.
[0047] As used herein, the term pharmaceutically acceptable carrier means a pharmaceutically acceptable material, composition or carrier, such as a liquid or solid filler, stabilizer, dispersing agent, suspending agent, diluent, excipient, thickening agent, solvent or encapsulating material, involved in carrying or transporting a compound useful within the invention within or to the patient such that it may perform its intended function. Typically, such constructs are carried or transported from one organ, or portion of the body, to another organ, or portion of the body. Each carrier must be acceptable in the sense of being compatible with the other ingredients of the formulation, including the compound useful within the invention, and not injurious to the patient. Some examples of materials that may serve as pharmaceutically acceptable carriers include: sugars, such as lactose, glucose and sucrose; starches, such as corn starch and potato starch; cellulose, and its derivatives, such as sodium carboxymethyl cellulose, ethyl cellulose and cellulose acetate; powdered tragacanth; malt; gelatin; talc; excipients, such as cocoa butter and suppository waxes; oils, such as peanut oil, cottonseed oil, safflower oil, sesame oil, olive oil, corn oil and soybean oil; glycols, such as propylene glycol; polyols, such as glycerin, sorbitol, mannitol and polyethylene glycol; esters, such as ethyl oleate and ethyl laurate; agar; buffering agents, such as magnesium hydroxide and aluminum hydroxide; surface active agents; alginic acid; pyrogen-free water; isotonic saline; Ringer's solution; ethyl alcohol; phosphate buffer solutions; and other non-toxic compatible substances employed in pharmaceutical formulations.
[0048] As used herein, the term pharmaceutically acceptable carrier means a pharmaceutically acceptable material, composition or carrier, such as a liquid or solid filler, stabilizer, dispersing agent, suspending agent, diluent, excipient, thickening agent, solvent or encapsulating material, involved in carrying or transporting a compound useful within the invention within or to the patient such that it may perform its intended function. Typically, such constructs are carried or transported from one organ, or portion of the body, to another organ, or portion of the body. Each carrier must be acceptable in the sense of being compatible with the other ingredients of the formulation, including the compound useful within the invention, and not injurious to the patient. Some examples of materials that may serve as pharmaceutically acceptable carriers include: sugars, such as lactose, glucose and sucrose; starches, such as corn starch and potato starch; cellulose, and its derivatives, such as sodium carboxymethyl cellulose, ethyl cellulose and cellulose acetate; powdered tragacanth; malt; gelatin; talc; excipients, such as cocoa butter and suppository waxes; oils, such as peanut oil, cottonseed oil, safflower oil, sesame oil, olive oil, corn oil and soybean oil; glycols, such as propylene glycol; polyols, such as glycerin, sorbitol, mannitol and polyethylene glycol; esters, such as ethyl oleate and ethyl laurate; agar; buffering agents, such as magnesium hydroxide and aluminum hydroxide; surface active agents; alginic acid; pyrogen-free water; isotonic saline; Ringer's solution; ethyl alcohol; phosphate buffer solutions; and other non-toxic compatible substances employed in pharmaceutical formulations. As used herein, pharmaceutically acceptable carrier also includes any and all coatings, antibacterial and antifungal agents, and absorption delaying agents, and the like that are compatible with the activity of the compound useful within the invention, and are physiologically acceptable to the patient. Supplementary active compounds may also be incorporated into the compositions. The pharmaceutically acceptable carrier may further include a pharmaceutically acceptable salt of the compound useful within the invention. Other additional ingredients that can be included in the pharmaceutical compositions used in the practice of the invention are known in the art and described, for example in Remington's Pharmaceutical Sciences (Genaro, Ed., Mack Publishing Co., 1985, Easton, PA), which is incorporated herein by reference.
[0049] As used herein, the language pharmaceutically acceptable salt refers to a salt of the administered compounds prepared from pharmaceutically acceptable non-toxic acids, including inorganic acids, organic acids, solvates, hydrates, or clathrates thereof.
[0050] The term prevent, preventing or prevention, as used herein, means avoiding or delaying the onset of symptoms associated with a disease or condition in a subject that has not developed such symptoms at the time the administering of an agent or compound commences.
[0051] A therapeutic treatment is a treatment administered to a subject who exhibits signs of pathology, for the purpose of diminishing or eliminating those signs.
[0052] As used herein, the term therapeutically effective amount refers to an amount that is sufficient or effective to prevent or treat (delay or prevent the onset of, prevent the progression of, inhibit, decrease or reverse) a disease or condition described or contemplated herein, including alleviating symptoms of such disease or condition.
[0053] As used herein, the term treatment or treating is defined as the application or administration of a therapeutic agent, i.e., a compound of the invention (alone or in combination with another pharmaceutical agent), to a patient, or application or administration of a therapeutic agent to an isolated tissue or cell line from a patient (e.g., for diagnosis or ex vivo applications), who has a condition contemplated herein, a symptom of a condition contemplated herein or the potential to develop a condition contemplated herein, with the purpose to cure, heal, alleviate, relieve, alter, remedy, ameliorate, improve or affect a condition contemplated herein, the symptoms of a condition contemplated herein or the potential to develop a condition contemplated herein. Such treatments may be specifically tailored or modified, based on knowledge obtained from the field of pharmacogenomics.
[0054] Ranges: throughout this disclosure, various aspects of the invention can be presented in a range format. It should be understood that the description in range format is merely for convenience and brevity and should not be construed as an inflexible limitation on the scope of the invention. Accordingly, the description of a range should be considered to have specifically disclosed all the possible sub-ranges as well as individual numerical values within that range. For example, description of a range such as from 1 to 6 should be considered to have specifically disclosed sub-ranges such as from 1 to 3, from 1 to 4, from 1 to 5, from 2 to 4, from 2 to 6, from 3 to 6 etc., as well as individual and partial numbers within that range, for example, 1, 2, 2.7, 3, 4, 5, 5.3, and 6. This applies regardless of the breadth of the range.
[0055] The following abbreviations are used herein: ADAM10=A disintegrin and metalloproteinase, APP-Amyloid Precursor Protein, BACE1= APP cleaving enzyme 1, AICD= APP Intr-Cellular Domain, HSV=Herpes Simplex Virus, PEG-polyethylene glycol, PNA=peptide nucleic acid, PTB=phosphotyrosine binding domain, TM=HSV US9's transmembrane domain.
Construct
[0056] In one embodiment, the invention provides a construct comprising an at least one effector protein or a functionally active fragment thereof and a Herpes Simplex Virus (HSV) US9 protein or a functionally active fragment thereof. In certain embodiments, the effector protein or the functionally active fragment thereof is covalently coupled to the HSV US9 protein or the functionally active fragment thereof. When an effector protein is covalently coupled to a second protein, in various embodiments, there is a covalent bond between a N- or C-terminal residue in the effector protein and the C- or N-terminal residue in a second protein, respectively.
[0057] In certain embodiments, the effector protein comprises a non-amyloidogenic APP-cleaving protease. In certain embodiments, the non-amyloidogenic APP-cleaving protease is the peptidase domain of A disintegrin and metalloproteinase (ADAM10).
[0058] In certain embodiments, the effector protein comprises a phosphotyrosine binding domain (PTB) of X11.
[0059] In certain embodiments, the HSV US9 protein fragment comprises the HSV US9 transmembrane domain (TM).
[0060] In certain embodiments, a fragment of the effector protein comprises a subsequence of the effector protein. In certain embodiments, the fragment comprising the subsequence of the effector protein is functionally active. In various embodiments, the fragment comprising the subsequence of the effector protein has at least, greater than, or less than about 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% of the functional activity of the effector protein.
[0061] In various embodiments, the HSV US9 or a functionally active fragment thereof targets the effector protein or a functionally active fragment thereof to a cellular membrane where pathologic APP processing occurs. In certain embodiments, the effector protein or a functionally active fragment thereof is coupled to the N-terminus of the HSV US9 protein. In certain embodiments, the effector protein or a functionally active fragment thereof is coupled to the C-terminus of the HSV US9 protein. In certain embodiments, the effector protein or a functionally active fragment thereof is coupled to the N-terminus of the TM. In certain embodiments, the effector protein or a functionally active fragment thereof is coupled to the C-terminus of the TM.
[0062] In certain embodiments, when the effector protein or a functionally active fragment thereof is attached to the C-terminus of the HSV US9 or a functionally active fragment thereof, the effector protein or functionally active fragment thereof is exposed on the luminal/extracellular side of a cell. In certain embodiments, when the effector protein or a functionally active fragment thereof is attached to the N-terminus of HSV US9 or a functionally active fragment thereof, the effector protein or a functionally active fragment thereof is exposed on the cytoplasmic side of the cell.
[0063] In certain embodiments, the effector protein or a functionally active fragment thereof is coupled through a linker to the HSV US9 protein or a functionally active fragment thereof. In certain embodiments, the linker comprises a polyethylene glycol (PEG) chain, or a peptide, or a peptide nucleic acid (PNA). In certain embodiments, the linker peptide comprises less than 50 amino acids.
[0064] In various embodiments, the construct reduces APP -amyloidogenic processing. In certain embodiments, and without being bound by theory, the construct reduces APP -amyloidogenic processing by promoting APP -cleavage, thereby reducing the production of amyloid -peptides and AICD ( APP Intr-Cellular Domain). In certain embodiments, the construct reduces APP -amyloidogenic processing by withdrawing APP from cellular locations in which -secretase activity occurs, thereby increasing the plasma membrane localization of APP, where APP can undergo APP -cleavage by interacting with endogenous ADAM10.
[0065] In another embodiment, the constructs of the invention are encoded in an expression vector. In certain embodiments, the expression vector is selected from the group consisting of cosmids, plasmids, and viruses.
Methods
[0066] In further embodiments, the invention provides a method of reducing levels of amyloid- peptide by administering a composition that includes the construct of the invention to a subject in need thereof. In another aspect the invention provides a method of treating a neuropathological condition in a subject, by administering a composition that includes the construct of the invention to the subject in need thereof.
[0067] In one embodiment, the construct includes g9A10pep in which the ADAM10 peptidase domain is fused to the C-terminus of full length HSV US9, and the reduction of APP -amyloidogenic processing is achieved by targeting -secretase activity (peptidase domain) in cellular regions where -secretase BACE1 is predominantly active (, and where endogenous ADAM10 is absent, such as for example, in endosomes. The g9A10pep shows more APP-specific effect than ADAM10 over-expression and therefore a higher impact on reducing amyloid -protein production.
[0068] In another embodiment, the construct includes gPTB9TM, in which the PTB of X11 is fused to N-terminal of HSV US9 TM. In certain embodiments, the effector protein has no enzymatic activity, and without being bound by theory, the construct reduces APP -amyloidogenic processing by withdrawing APP from cellular locations in which -secretase activity occurs, thereby increasing the plasma membrane localization of APP, where APP can undergo APP -cleavage by endogenous ADAM10. Advantageously, since no additional enzymatic activity is introduced into cells upon administering the gPTB9TM construct to the subject, the cellular function of cells in the subject are not affected adversely.
[0069] In certain embodiments, the construct is administered as part of a pharmaceutical composition that includes at least one pharmaceutically acceptable carrier.
[0070] In certain embodiments, the neuropathological conditions include, but are not limited to, Alzheimer's-associated or HIV-associated neurocognitive disorders.
[0071] In certain embodiments, the subject is a mammal. In other embodiments, the subject is human.
Kit
[0072] In yet further aspect, the invention provides a kit comprising the pharmaceutical composition of the invention and an instructional material for use thereof, wherein the instructional material comprises instructions for using the pharmaceutical composition to reduce amyloid- peptide formation in vivo.
[0073] In certain embodiments, the pharmaceutical composition of the invention is as describe elsewhere, herein.
Pharmaceutical Compositions and Formulations
[0074] The invention also encompasses the use of pharmaceutical compositions of the invention to practice the methods of the invention.
[0075] Such pharmaceutical compositions may be provided in a form suitable for administration to a subject, and may comprise one or more pharmaceutically acceptable carriers, one or more additional ingredients, or some combination of these. The compositions of the invention may comprise a physiologically acceptable salt, such as a compound contemplated within the invention in combination with a physiologically acceptable cation or anion, as is well known in the art.
[0076] In certain embodiments, the pharmaceutical compositions useful for practicing the method of the invention may be administered to deliver a dose of between 1 ng/kg/day and 100 mg/kg/day. In other embodiments, the pharmaceutical compositions useful for practicing the invention may be administered to deliver a dose of between 1 ng/kg/day and 500 mg/kg/day.
[0077] The relative amounts of the active ingredient, the pharmaceutically acceptable carrier, and any additional ingredients in a pharmaceutical composition of the invention will vary, depending upon the identity, size, and condition of the subject treated and further depending upon the route by which the composition is to be administered. By way of example, the composition may comprise between 0.1% and 100% (w/w) active ingredient.
[0078] Pharmaceutical compositions that are useful in the methods of the invention may be suitably developed for inhalational, oral, rectal, vaginal, parenteral, topical, intracranial, transdermal, pulmonary, intranasal, buccal, ophthalmic, intrathecal, intravenous or another route of administration. Other contemplated formulations include projected nanoparticles, liposomal preparations, resealed erythrocytes containing the active ingredient, and immunologically-based formulations. The route(s) of administration will be readily apparent to the skilled artisan and will depend upon any number of factors including the type and severity of the disease being treated, the type and age of the veterinary or human patient being treated, and the like.
[0079] The formulations of the pharmaceutical compositions described herein may be prepared by any method known or hereafter developed in the art of pharmacology. In general, such preparatory methods include the step of bringing the active ingredient into association with a carrier or one or more other accessory ingredients, and then, if necessary or desirable, shaping or packaging the product into a desired single-or multi-dose unit.
[0080] As used herein, a unit dose is a discrete amount of the pharmaceutical composition comprising a predetermined amount of the active ingredient. The amount of the active ingredient is generally equal to the dosage of the active ingredient that would be administered to a subject or a convenient fraction of such a dosage such as, for example, one-half or one-third of such a dosage. The unit dosage form may be for a single daily dose or one of multiple daily doses (e.g., about 1 to 4 or more times per day). When multiple daily doses are used, the unit dosage form may be the same or different for each dose.
[0081] Although the descriptions of pharmaceutical compositions provided herein are principally directed to pharmaceutical compositions that are suitable for ethical administration to humans, it will be understood by the skilled artisan that such compositions are generally suitable for administration to animals of all sorts. Modification of pharmaceutical compositions suitable for administration to humans in order to render the compositions suitable for administration to various animals is well understood, and the ordinarily skilled veterinary pharmacologist can design and perform such modification with merely ordinary, if any, experimentation. Subjects to which administration of the pharmaceutical compositions of the invention is contemplated include, but are not limited to, humans and other primates, mammals including commercially relevant mammals such as cattle, pigs, horses, sheep, cats, and dogs.
[0082] In certain embodiments, the compositions of the invention are formulated using one or more pharmaceutically acceptable excipients or carriers. In certain embodiments, the pharmaceutical compositions of the invention comprise a therapeutically effective amount of at least one construct of the invention and a pharmaceutically acceptable carrier.
[0083] Formulations may be employed in admixtures with conventional excipients, i.e., pharmaceutically acceptable organic or inorganic carrier substances suitable for oral, parenteral, nasal, intravenous, subcutaneous, enteral, or any other suitable mode of administration, known to the art. The pharmaceutical preparations may be sterilized and if desired mixed with auxiliary agents, e.g., lubricants, preservatives, stabilizers, wetting agents, emulsifiers, salts for influencing osmotic pressure buffers, coloring, flavoring and/or aromatic substances and the like. They may also be combined where desired with other active agents, e.g., other analgesic agents.
[0084] As used herein, additional ingredients include, but are not limited to, one or more of the following: excipients; surface active agents; dispersing agents; inert diluents; granulating and disintegrating agents; binding agents; lubricating agents; sweetening agents; flavoring agents; coloring agents; preservatives; physiologically degradable compositions such as gelatin; aqueous vehicles and solvents; oily vehicles and solvents; suspending agents; dispersing or wetting agents; emulsifying agents, demulcents; buffers; salts; thickening agents; fillers; emulsifying agents; antioxidants; antibiotics; antifungal agents; stabilizing agents; and pharmaceutically acceptable polymeric or hydrophobic materials. Other additional ingredients that may be included in the pharmaceutical compositions of the invention are known in the art and described, for example in Genaro, ed. (1985, Remington's Pharmaceutical Sciences, Mack Publishing Co., Easton, PA), which is incorporated herein by reference.
[0085] Liquid suspensions may be prepared using conventional methods to achieve suspension of the active ingredient in an aqueous or oily vehicle. Aqueous vehicles include, for example, water, and isotonic saline. Oily vehicles include, for example, almond oil, oily esters, ethyl alcohol, vegetable oils such as arachis, olive, sesame, or coconut oil, fractionated vegetable oils, and mineral oils such as liquid paraffin. Liquid suspensions may further comprise one or more additional ingredients including, but not limited to, suspending agents, dispersing or wetting agents, emulsifying agents, demulcents, preservatives, buffers, salts, flavorings, coloring agents, and sweetening agents. Oily suspensions may further comprise a thickening agent. Known suspending agents include, but are not limited to, sorbitol syrup, hydrogenated edible fats, sodium alginate, polyvinylpyrrolidone, gum tragacanth, gum acacia, and cellulose derivatives such as sodium carboxymethylcellulose, methylcellulose, hydroxypropylmethylcellulose. Known dispersing or wetting agents include, but are not limited to, naturally-occurring phosphatides such as lecithin, condensation products of an alkylene oxide with a fatty acid, with a long chain aliphatic alcohol, with a partial ester derived from a fatty acid and a hexitol, or with a partial ester derived from a fatty acid and a hexitol anhydride (e.g., polyoxyethylene stearate, heptadecaethyleneoxycetanol, polyoxyethylene sorbitol monooleate, and polyoxyethylene sorbitan monooleate, respectively). Known emulsifying agents include, but are not limited to, lecithin, and acacia. Known preservatives include, but are not limited to, methyl, ethyl, or n-propyl para-hydroxybenzoates, ascorbic acid, and sorbic acid. Known sweetening agents include, for example, glycerol, propylene glycol, sorbitol, sucrose, and saccharin. Known thickening agents for oily suspensions include, for example, beeswax, hard paraffin, and cetyl alcohol.
[0086] Powdered and granular formulations of a pharmaceutical preparation of the invention may be prepared using known methods. Such formulations may be administered directly to a subject, used, for example, to form tablets, to fill capsules, or to prepare an aqueous or oily suspension or solution by addition of an aqueous or oily vehicle thereto. Each of these formulations may further comprise one or more of dispersing or wetting agent, a suspending agent, and a preservative. Additional excipients, such as fillers and sweetening, flavoring, or coloring agents, may also be included in these formulations.
[0087] A pharmaceutical composition of the invention may also be prepared, packaged, or sold in the form of oil-in-water emulsion or a water-in-oil emulsion. The oily phase may be a vegetable oil such as olive or arachis oil, a mineral oil such as liquid paraffin, or a combination of these. Such compositions may further comprise one or more emulsifying agents such as naturally occurring gums such as gum acacia or gum tragacanth, naturally-occurring phosphatides such as soybean or lecithin phosphatide, esters or partial esters derived from combinations of fatty acids and hexitol anhydrides such as sorbitan monooleate, and condensation products of such partial esters with ethylene oxide such as polyoxyethylene sorbitan monooleate. These emulsions may also contain additional ingredients including, for example, sweetening or flavoring agents.
[0088] Methods for impregnating or coating a material with a chemical composition are known in the art, and include, but are not limited to methods of depositing or binding a chemical composition onto a surface, methods of incorporating a chemical composition into the structure of a material during the synthesis of the material (i.e., such as with a physiologically degradable material), and methods of absorbing an aqueous or oily solution or suspension into an absorbent material, with or without subsequent drying.
Administration/Dosing
[0089] The regimen of administration may affect what constitutes an effective amount. The therapeutic formulations may be administered to the patient either prior to or after the manifestation of symptoms associated with the disease or condition. Further, several divided dosages, as well as staggered dosages may be administered daily or sequentially, or the dose may be continuously infused, or may be a bolus injection. Further, the dosages of the therapeutic formulations may be proportionally increased or decreased as indicated by the exigencies of the therapeutic or prophylactic situation.
[0090] Administration of the compositions of the present invention to a patient, such as a mammal, such as a human, may be carried out using known procedures, at dosages and for periods of time effective to treat a disease or condition in the patient. An effective amount of the therapeutic compound necessary to achieve a therapeutic effect may vary according to factors such as the activity of the particular compound employed; the time of administration; the rate of excretion of the compound; the duration of the treatment; other drugs, compounds or materials used in combination with the compound; the state of the disease or disorder, age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors well-known in the medical arts. Dosage regimens may be adjusted to provide the optimum therapeutic response. For example, several divided doses may be administered daily or the dose may be proportionally reduced as indicated by the exigencies of the therapeutic situation. A non-limiting example of an effective dose range for a therapeutic compound of the invention is from about 0.01 and 50 mg/kg of body weight/per day. One of ordinary skill in the art would be able to study the relevant factors and make the determination regarding the effective amount of the therapeutic compound without undue experimentation.
[0091] The compound can be administered to an animal as frequently as several times daily, or it may be administered less frequently, such as once a day, once a week, once every two weeks, once a month, or even less frequently, such as once every several months or even once a year or less. It is understood that the amount of compound dosed per day may be administered, in non-limiting examples, every day, every other day, every 2 days, every 3 days, every 4 days, or every 5 days. For example, with every other day administration, a 5 mg per day dose may be initiated on Monday with a first subsequent 5 mg per day dose administered on Wednesday, a second subsequent 5 mg per day dose administered on Friday, and so on. The frequency of the dose will be readily apparent to the skilled artisan and will depend upon any number of factors, such as, but not limited to, the type and severity of the disease being treated, the type and age of the animal, etc.
[0092] Actual dosage levels of the active ingredients in the pharmaceutical compositions of this invention may be varied so as to obtain an amount of the active ingredient that is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, without being toxic to the patient.
[0093] A medical doctor, e.g., physician or veterinarian, having ordinary skill in the art may readily determine and prescribe the effective amount of the pharmaceutical composition required. For example, the physician or veterinarian could start doses of the compounds of the invention employed in the pharmaceutical composition at levels lower than that required in order to achieve the desired therapeutic effect and gradually increase the dosage until the desired effect is achieved.
[0094] In particular embodiments, it is especially advantageous to formulate the compound in dosage unit form for ease of administration and uniformity of dosage. Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the patients to be treated; each unit containing a predetermined quantity of therapeutic compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical vehicle. The dosage unit forms of the invention are dictated by and directly dependent on (a) the unique characteristics of the therapeutic compound and the particular therapeutic effect to be achieved, and (b) the limitations inherent in the art of compounding/formulating such a therapeutic compound for the treatment of cancer in a patient.
[0095] In certain embodiments, the compositions of the invention are administered to the patient in dosages that range from one to five times per day or more. In other embodiments, the compositions of the invention are administered to the patient in range of dosages that include, but are not limited to, once every day, every two, days, every three days to once a week, and once every two weeks. It will be readily apparent to one skilled in the art that the frequency of administration of the various combination compositions of the invention will vary from subject to subject depending on many factors including, but not limited to, age, disease or disorder to be treated, gender, overall health, and other factors. Thus, the invention should not be construed to be limited to any particular dosage regime and the precise dosage and composition to be administered to any patient will be determined by the attending physical taking all other factors about the patient into account.
[0096] Compounds of the invention for administration may be in the range of from about 1 g to about 7,500 mg, about 20 g to about 7,000 mg, about 40 g to about 6,500 mg, about 80 g to about 6,000 mg, about 100 g to about 5,500 mg, about 200 g to about 5,000 mg, about 400 g to about 4,000 mg, about 800 g to about 3,000 mg, about 1 mg to about 2,500 mg, about 2 mg to about 2,000 mg, about 5 mg to about 1,000 mg, about 10 mg to about 750 mg, about 20 mg to about 600 mg, about 30 mg to about 500 mg, about 40 mg to about 400 mg, about 50 mg to about 300 mg, about 60 mg to about 250 mg, about 70 mg to about 200 mg, about 80 mg to about 150 mg, and any and all whole or partial increments therebetween.
[0097] In some embodiments, the dose of a compound of the invention is from about 0.5 g and about 5,000 mg. In some embodiments, a dose of a compound of the invention used in compositions described herein is less than about 5,000 mg, or less than about 4,000 mg, or less than about 3,000 mg, or less than about 2,000 mg, or less than about 1,000 mg, or less than about 800 mg, or less than about 600 mg, or less than about 500 mg, or less than about 200 mg, or less than about 50 mg. Similarly, in some embodiments, a dose of a second compound as described herein is less than about 1,000 mg, or less than about 800 mg, or less than about 600 mg, or less than about 500 mg, or less than about 400 mg, or less than about 300 mg, or less than about 200 mg, or less than about 100 mg, or less than about 50 mg, or less than about 40 mg, or less than about 30 mg, or less than about 25 mg, or less than about 20 mg, or less than about 15 mg, or less than about 10 mg, or less than about 5 mg, or less than about 2 mg, or less than about 1 mg, or less than about 0.5 mg, and any and all whole or partial increments thereof.
[0098] In certain embodiments, the present invention is directed to a packaged pharmaceutical composition comprising a container holding a therapeutically effective amount of a compound of the invention, alone or in combination with a second pharmaceutical agent; and instructions for using the compound to treat, prevent, or reduce one or more symptoms of a disease or disorder in a patient.
[0099] The term container includes any receptacle for holding the pharmaceutical composition. For example, in certain embodiments, the container is the packaging that contains the pharmaceutical composition. In other embodiments, the container is not the packaging that contains the pharmaceutical composition, i.e., the container is a receptacle, such as a box or vial that contains the packaged pharmaceutical composition or unpackaged pharmaceutical composition and the instructions for use of the pharmaceutical composition. Moreover, packaging techniques are well known in the art. It should be understood that the instructions for use of the pharmaceutical composition may be contained on the packaging containing the pharmaceutical composition, and as such the instructions form an increased functional relationship to the packaged product. However, it should be understood that the instructions may contain information pertaining to the compound's ability to perform its intended function, e.g., treating, preventing, or reducing a disease or disorder in a patient.
Routes of Administration
[0100] Routes of administration of any of the compositions of the invention include inhalational, oral, nasal, rectal, parenteral, sublingual, transdermal, transmucosal (e.g., sublingual, lingual, (trans) buccal, (trans) urethral, vaginal (e.g., trans-and perivaginally), (intra) nasal, and (trans) rectal), intravesical, intrapulmonary, intraduodenal, intragastrical, intrathecal, subcutaneous, intramuscular, intradermal, intra-arterial, intravenous, intrabronchial, inhalation, intracranial, and topical administration.
[0101] Suitable compositions and dosage forms include, for example, tablets, capsules, caplets, pills, gel caps, troches, dispersions, suspensions, solutions, syrups, granules, beads, transdermal patches, gels, powders, pellets, magmas, lozenges, creams, pastes, plasters, lotions, discs, suppositories, liquid sprays for nasal or oral administration, dry powder or aerosolized formulations for inhalation, compositions and formulations for intravesical administration and the like. It should be understood that the formulations and compositions that would be useful in the present invention are not limited to the particular formulations and compositions that are described herein.
Oral Administration
[0102] For oral application, particularly suitable are tablets, dragees, liquids, drops, suppositories, or capsules, caplets and gelcaps. Other formulations suitable for oral administration include, but are not limited to, a powdered or granular formulation, an aqueous or oily suspension, an aqueous or oily solution, a paste, a gel, toothpaste, a mouthwash, a coating, an oral rinse, or an emulsion. The compositions intended for oral use may be prepared according to any method known in the art and such compositions may contain one or more agents selected from the group consisting of inert, non-toxic pharmaceutically excipients which are suitable for the manufacture of tablets. Such excipients include, for example an inert diluent such as lactose; granulating and disintegrating agents such as cornstarch; binding agents such as starch; and lubricating agents such as magnesium stearate.
[0103] Tablets may be non-coated or they may be coated using known methods to achieve delayed disintegration in the gastrointestinal tract of a subject, thereby providing sustained release and absorption of the active ingredient. By way of example, a material such as glyceryl monostearate or glyceryl distearate may be used to coat tablets. Further by way of example, tablets may be coated using methods described in U.S. Pat. Nos. 4,256,108; 4,160,452; and 4,265,874 to form osmotically controlled release tablets. Tablets may further comprise a sweetening agent, a flavoring agent, a coloring agent, a preservative, or some combination of these in order to provide for pharmaceutically elegant and palatable preparation.
Parenteral Administration
[0104] As used herein, parenteral administration of a pharmaceutical composition includes any route of administration characterized by physical breaching of a tissue of a subject and administration of the pharmaceutical composition through the breach in the tissue. Parenteral administration thus includes, but is not limited to, administration of a pharmaceutical composition by injection of the composition, by application of the composition through a surgical incision, by application of the composition through a tissue-penetrating non-surgical wound, and the like. In particular, parenteral administration is contemplated to include, but is not limited to, subcutaneous, intravenous, intraperitoneal, intramuscular, intrasternal injection, and kidney dialytic infusion techniques.
[0105] Formulations of a pharmaceutical composition suitable for parenteral administration comprise the active ingredient combined with a pharmaceutically acceptable carrier, such as sterile water or sterile isotonic saline. Such formulations may be prepared, packaged, or sold in a form suitable for bolus administration or for continuous administration. Injectable formulations may be prepared, packaged, or sold in unit dosage form, such as in ampules or in multi-dose containers containing a preservative. Formulations for parenteral administration include, but are not limited to, suspensions, solutions, emulsions in oily or aqueous vehicles, pastes, and implantable sustained-release or biodegradable formulations. Such formulations may further comprise one or more additional ingredients including, but not limited to, suspending, stabilizing, or dispersing agents. In one embodiment of a formulation for parenteral administration, the active ingredient is provided in dry (i.e., powder or granular) form for reconstitution with a suitable vehicle (e.g., sterile pyrogen-free water) prior to parenteral administration of the reconstituted composition.
[0106] The pharmaceutical compositions may be prepared, packaged, or sold in the form of a sterile injectable aqueous or oily suspension or solution. This suspension or solution may be formulated according to the known art, and may comprise, in addition to the active ingredient, additional ingredients such as the dispersing agents, wetting agents, or suspending agents described herein. Such sterile injectable formulations may be prepared using a non-toxic parenterally-acceptable diluent or solvent, such as water or 1,3-butanediol, for example. Other acceptable diluents and solvents include, but are not limited to, Ringer's solution, isotonic sodium chloride solution, and fixed oils such as synthetic mono-or diglycerides. Other parentally-administrable formulations which are useful include those which comprise the active ingredient in microcrystalline form, in a liposomal preparation, or as a component of a biodegradable polymer system. Compositions for sustained release or implantation may comprise pharmaceutically acceptable polymeric or hydrophobic materials such as an emulsion, an ion exchange resin, a sparingly soluble polymer, or a sparingly soluble salt.
Additional Administration Forms
[0107] Additional dosage forms of this invention include dosage forms as described in U.S. Pat. Nos. 6,340,475, 6,488,962, 6,451,808, 5,972,389, 5,582,837, and 5,007,790. Additional dosage forms of this invention also include dosage forms as described in U.S. Patent Applications Nos. 20030,147952, 20030104062, 20030104053, 20030044466, 20030039688, and 20020051820. Additional dosage forms of this invention also include dosage forms as described in PCT Applications Nos. WO 03/35041, WO 03/35040, WO 03/35029, WO 03/35177, WO 03/35039, WO 02/96404, WO 02/32416, WO 01/97783, WO 01/56544, WO 01/32217, WO 98/55107, WO 98/11879, WO 97/47285, WO 93/18755, and WO 90/11757.
Controlled Release Formulations and Drug Delivery Systems
[0108] Controlled-or sustained-release formulations of a pharmaceutical composition of the invention may be made using conventional technology. In some cases, the dosage forms to be used can be provided as slow or controlled-release of one or more active ingredients therein using, for example, hydropropylmethyl cellulose, other polymer matrices, gels, permeable membranes, osmotic systems, multilayer coatings, microparticles, liposomes, or microspheres or a combination thereof to provide the desired release profile in varying proportions. Suitable controlled-release formulations known to those of ordinary skill in the art, including those described herein, can be readily selected for use with the pharmaceutical compositions of the invention. Thus, single unit dosage forms suitable for oral administration, such as tablets, capsules, gelcaps, and caplets, which are adapted for controlled-release are encompassed by the present invention.
[0109] Most controlled-release pharmaceutical products have a common goal of improving drug therapy over that achieved by their non-controlled counterparts. Ideally, the use of an optimally designed controlled-release preparation in medical treatment is characterized by a minimum of drug substance being employed to cure or control the condition in a minimum amount of time. Advantages of controlled-release formulations include extended activity of the drug, reduced dosage frequency, and increased patient compliance. In addition, controlled-release formulations can be used to affect the time of onset of action or other characteristics, such as blood level of the drug, and thus can affect the occurrence of side effects.
[0110] Most controlled-release formulations are designed to initially release an amount of drug that promptly produces the desired therapeutic effect, and gradually and continually release of other amounts of drug to maintain this level of therapeutic effect over an extended period of time. In order to maintain this constant level of drug in the body, the drug must be released from the dosage form at a rate that will replace the amount of drug being metabolized and excreted from the body.
[0111] Controlled-release of an active ingredient can be stimulated by various inducers, for example pH, temperature, enzymes, water, or other physiological conditions or compounds. The term controlled-release component in the context of the present invention is defined herein as a compound or compounds, including, but not limited to, polymers, polymer matrices, gels, permeable membranes, liposomes, or microspheres or a combination thereof that facilitates the controlled-release of the active ingredient.
[0112] In certain embodiments, the formulations of the present invention may be, but are not limited to, short-term, rapid-offset, as well as controlled, for example, sustained release, delayed release and pulsatile release formulations.
[0113] The term sustained release is used in its conventional sense to refer to a drug formulation that provides for gradual release of a drug over an extended period of time, and that may, although not necessarily, result in substantially constant blood levels of a drug over an extended time period. The period of time may be as long as a month or more and should be a release which is longer that the same amount of agent administered in bolus form.
[0114] For sustained release, the compounds may be formulated with a suitable polymer or hydrophobic material which provides sustained release properties to the compounds. As such, the compounds for use the method of the invention may be administered in the form of microparticles, for example, by injection or in the form of wafers or discs by implantation.
[0115] In certain embodiments of the invention, the compounds of the invention are administered to a patient, alone or in combination with another pharmaceutical agent, using a sustained release formulation.
[0116] The term delayed release is used herein in its conventional sense to refer to a drug formulation that provides for an initial release of the drug after some delay following drug administration and that mat, although not necessarily, includes a delay of from about 10 minutes up to about 12 hours.
[0117] The term pulsatile release is used herein in its conventional sense to refer to a drug formulation that provides release of the drug in such a way as to produce pulsed plasma profiles of the drug after drug administration.
[0118] The term immediate release is used in its conventional sense to refer to a drug formulation that provides for release of the drug immediately after drug administration.
[0119] As used herein, short-term refers to any period of time up to and including about 8 hours, about 7 hours, about 6 hours, about 5 hours, about 4 hours, about 3 hours, about 2 hours, about 1 hour, about 40 minutes, about 20 minutes, or about 10 minutes and any or all whole or partial increments thereof after drug administration after drug administration.
[0120] As used herein, rapid-offset refers to any period of time up to and including about 8 hours, about 7 hours, about 6 hours, about 5 hours, about 4 hours, about 3 hours, about 2 hours, about 1 hour, about 40 minutes, about 20 minutes, or about 10 minutes, and any and all whole or partial increments thereof after drug administration.
[0121] Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, numerous equivalents to the specific procedures, embodiments, claims, and examples described herein. Such equivalents were considered to be within the scope of this invention and covered by the claims appended hereto. For example, it should be understood, that modifications in reaction and assaying conditions with art-recognized alternatives and using no more than routine experimentation, are within the scope of the present application.
[0122] It is to be understood that wherever values and ranges are provided herein, all values and ranges encompassed by these values and ranges, are meant to be encompassed within the scope of the present invention. Moreover, all values that fall within these ranges, as well as the upper or lower limits of a range of values, are also contemplated by the present application.
[0123] The following examples further illustrate aspects of the present invention. However, they are in no way a limitation of the teachings or disclosure of the present invention as set forth herein.
Sequences
[0124] In various embodiments, a reporter gfp has the sequence of SEQ ID NO: 1:
TABLE-US-00001 MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATY GKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMK QHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTL VNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKN GIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNH YLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKS GLRSRAQASNSAVDGTAGPGSTGSR
[0125] In various embodiments, an HSV US9 (HSV-1, strain 17) has the sequence of SEQ ID NO: 2:
TABLE-US-00002 MTSRLSDPNSSARSDMSVPLYPTASPVSAEAYYSESEDEAANDFLVRMGR QQSVLRRRRRRTRCVGMVIACLLVAVLSGGFGALLMWLLR.
[0126] In various embodiments, a peptidase (enzymatic) domain of ADAM10 (homo sapiens) has the sequence of SEQ ID NO: 3:
TABLE-US-00003 NTCQLYIQTDHLFFKYYGTREAVIAQISSHVKAIDTIYQTT DFSGIRNISFMVKRIRINTTADEKDPTNPFRFPNIGVEKF LELNSEQNHDDYCLAYVFTDRDFDDGVLGLAWVGAPSGSS GGICEKSKLYSDGKKKSLNTGIITVQNYGSHVPPKVSHIT FAHEVGHNFGSPHDSGTECTPGESKNLGQKENGNYIMYAR ATSGDKLNNNKFSLCSIRNISQVLEKKRNNCFVESGQPI.
[0127] In various embodiments, ADAM10 (homo sapiens) has the sequence of SEQ ID NO: 4:
TABLE-US-00004 MVLLRVLILLLSWAAGMGGQYGNPLNKYIRHYEGLSYNVD SLHQKHQRAKRAVSHEDQFLRLDFHAHGRHFNLRMKRDTS LFSDEFKVETSNKVLDYDTSHIYTGHIYGEEGSFSHGSVI DGRFEGFIQTRGGTFYVEPAERYIKDRTLPFHSVIYHEDD INYPHKYGPQGGCADHSVFERMRKYQMTGVEEVTQIPQEE HAANGPELLRKKRTTSAEKNTCQLYIQTDHLFFKYYGTRE AVIAQISSHVKAIDTIYQTTDFSGIRNISFMVKRIRINTT ADEKDPTNPFRFPNIGVEKFLELNSEQNHDDYCLAYVFTD RDFDDGVLGLAWVGAPSGSSGGICEKSKLYSDGKKKSLNT GIITVQNYGSHVPPKVSHITFAHEVGHNFGSPHDSGTECT PGESKNLGQKENGNYIMYARATSGDKLNNNKFSLCSIRNI SQVLEKKRNNCFVESGQPICGNGMVEQGEECDCGYSDQCK DECCFDANQPEGRKCKLKPGKQCSPSQGPCCTAQCAFKSK SEKCRDDSDCAREGICNGFTALCPASDPKPNFTDCNRHTQ VCINGQCAGSICEKYGLEECTCASSDGKDDKELCHVCCMK KMDPSTCASTGSVQWSRHFSGRTITLQPGSPCNDFRGYCD VFMRCRLVDADGPLARLKKAIFSPELYENIAEWIVAHWWA VLLMGIALIMLMAGFIKICSVHTPSSNPKLPPPKPLPGTL KRRRPPQPIQQPQRQRPRESYQMGHMRR.
[0128] In various embodiments, a phosphotyrosine binding domain of X11 has the sequence of SEQ ID NO: 5:
TABLE-US-00005 PEDLIDGIIFAANYLGSTQLLSDKTPSKNVRMMQAQEAV SRIKMAQKLAKSRKKAPEGESQPMTEVDLFISTQRIKVLN ADTQETMMDHPLRTISYIADIGNIVVLMARRRMPRSNSQE NVEASHPSQDGKRQYKMICHVFESEDAQLIAQSIGQAFSV AYQEFLRANGINP.
[0129] In various embodiments, X11 has the sequence of SEQ ID NO: 6:
TABLE-US-00006 MNHLEGSAEVEVTDEAAGGEVNESVEADLEHPEVEEEQQQ PPQQQHYVGRHQRGRALEDLRAQLGQEEEERGECLARSAS TESGFHNHTDTAEGDVIAAARDGYDAERAQDPEDESAYAV QYRPEAEEYTEQAEAEHAEATHRRALPNHLHFHSLEHEEA MNAAYSGYVYTHRLFHRGEDEPYSEPYADYGGLQEHVYEE IGDAPELDARDGLRLYEQERDEAAAYRQEALGARLHHYDE RSDGESDSPEKEAEFAPYPRMDSYEQEEDIDQIVAEVKQS MSSQSLDKAAEDMPEAEQDLERPPTPAGGRPDSPGLQAPA GQQRAVGPAGGGEAGQRYSKEKRDAISLAIKDIKEAIEEV KTRTIRSPYTPDEPKEPIWVMRQDISPTRDCDDQRPMDGD SPSPGSSSPLGAESSSTSLHPSDPVEASTNKESRKSLASF PTYVEVPGPCDPEDLIDGIIFAANYLGSTQLLSDKTPSKN VRMMQAQEAVSRIKMAQKLAKSRKKAPEGESQPMTEVDLF ISTQRIKVLNADTQETMMDHPLRTISYIADIGNIVVLMAR RRMPRSNSQENVEASHPSQDGKRQYKMICHVFESEDAQLI AQSIGQAFSVAYQEFLRANGINPEDLSQKEYSDLLNTQDM YNDDLIHFSKSENCKDVFIEKQKGEILGVVIVESGWGSIL PTVIIANMMHGGPAEKSGKLNIGDQIMSINGTSLVGLPLS TCQSIIKGLKNQSRVKLNIVRCPPVTTVLIRRPDLRYQLG FSVQNGIICSLMRGGIAERGGVRVGHRIIEINGQSVVATP HEKIVHILSNAVGEIHMKTMPAAMYRLLTAQEQPVYI.
[0130] In various embodiments, a trans-membrane domain of HSV US9 (HSV-1, strain 17) has the sequence of SEQ ID NO: 7:
TABLE-US-00007 VIACLLVAVLSGGFGALLMWL.
[0131] SEQ ID NO: 8-SEQ ID NO: 22 are sequences for regions joining different elements (gfp, mCherry, TEV protease, targeting domain) of the construct. These sequences correspond to the sequences shown in
TABLE-US-00008 SEQIDNO:8 KSGLRSISSSSFEFMAYPYDVPDYASLGGHMAMGM SEQIDNO:9 RRILQSTVPRARDPPVATM SEQIDNO:10 RRSAAALVM SEQIDNO:11 RRSAAAE SEQIDNO:12 MAYPYDVPDYASLGGHMAMGM SEQIDNO:13 RRSGSENLYFQGGLVM SEQIDNO:14 NSSSSFEFMAYPYDVPDYASLGGHMAMGM SEQIDNO:15 KSGLRSISSGSENLYFQGEFMAYPYDVPDYASLGGHMAMGM SEQIDNO:16 KSGLRSISSGSENLYFQGEFATMT SEQIDNO:17 KSGLRSISSGSENLYFQGEFATMD SEQIDNO:18 ERSAAALVM SEQIDNO:19 NRSAAALVM SEQIDNO:20 KSGLRSISSGSENLYFQGEFE SEQIDNO:21 QRSAAALVM SEQIDNO:22 NSSSSFEFE
[0132] In various embodiments, sequences having at least about 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence homology to any of the sequences of SEQ ID NO: 1 to SEQ ID NO:7 can also be used to form the constructs described herein.
[0133] In various embodiments, two or more proteins with sequences of SEQ ID NO:1 to SEQ ID NO: 7 can be connected end-to-end by fusion of the terminal residues of the N- and C-termini of the proteins to provide the constructs described herein. In various embodiments, fusion of the N- and C-termini includes a linker between the terminal residues of the N- and C-termini of the proteins. Suitable linkers include polyethylene glycol (PEG), a peptide, or a peptide nucleic acid (PNA). The length of the linker is chosen so that the functional activity of the fused proteins is not adversely affected. The PEG chain can be of formula O(CH.sub.2CH.sub.2O).sub.n, where n is an integer from 1 to 100. In various embodiments, n is 1, 2, 3, 4, 5, 6, 7, 8,9 or 10. Peptide linkers include poly-glycine linkers containing up to 50 glycine residues, poly-proline linkers containing up to 50 proline residues, or combinations thereof. Peptide linkers are not limited to glycine and proline residues, and any amino acid or sequence of amino acids can be used provided the functional activity of the fused proteins is not adversely affected.
EXAMPLES
[0134] The invention is now described with reference to the following Examples. These Examples are provided for the purpose of illustration only, and the invention is not limited to these Examples, but rather encompasses all variations that are evident as a result of the teachings provided herein.
Materials and Methods
Cells Cultures and Transfections.
[0135] Rat cortical neurons (RNs) were obtained from the brains of 17-18 day old rat embryos and cultured in Neurobasal medium containing B27 supplement (Gibco) as detailed by Sengupta et al. (Sengupta, R. et al., 2009 J. Neurosci. Off. J. Soc. Neurosci. 29, 2534-2544). and originally described by Brewer et al (Brewer, G. J et al, 1993, J. Neurosci. Res. 35, 567-576).
[0136] For transfections, RNs were seeded on poly-L-Lysine coated glass coverslips (35,000 cells/coverslip) in Neurobasal/B27 medium containing 2% horse serum for 2 hours. Coverslips were then washed and media replaced with Neurobasal/B27 media containing GlutaMAX supplement, Glutamic Acid and Gentamycin. After 4 days, fresh medium not containing L-Glutamic acid was used to replace old medium. At 5 days in vitro (DIV5), half volume was removed and stored at 37 C., and replaced with fresh medium. After 6 hours, the medium was reduced to 0.6 mL and the removed volume pooled with the previously stored medium to make conditioned medium. Lipofectamine 2000 transfection reagent (Invitrogen)DNA complexes (2 L of Lipofectamine 2000 transfection reagent per transfection) were prepared in OptiMEM medium (Gibco) according to manufacturer directions, incubated for 5 min at room temperature in the dark, and transferred dropwise on coverslips. After 1 hour incubation at 37 C., transfection medium was removed and replaced with conditioned medium.
[0137] Human Embryonic Kidney Cells (HEK) 293T were grown in Dulbecco Modified Eagle Medium (DMEM) supplemented with 10% Fetal Calf Serum (FCS), and Gentamycin. For transfections, cells were seeded on 12 well plates, 160,000 cells/well, the day before treatment. Lipofectamine 2000 transfection reagent-DNA complexes were prepared and added to cells as described above for RNs, and incubated for 2.5 hours before replacement with fresh medium. For co-transfections with variable amounts of plasmids, the total amount of DNA in each sample was kept constant by adding the empty pcDNA3.1 vector.
Animals
[0138] Animals were used as a source of brain tissue to prepare neuronal cultures, following the recommendations in the Guide for the Care and Use of laboratory Animals of the National Institute of Health. This protocol for harvesting brain tissue was approved by the Institutional Animal Care and Use Committee of Drexel University (PHS Animals Welfare Assurance #A-3222-01), approved on Sep. 18, 2015 (permit #20439).
Fluorescence Microscopy Analysis and Immunodetection.
[0139] Cells were fixed in 4% paraformaldehyde 24 hours post transfection. For permeabilization, fixed cells were incubated with Phosphate Buffered Saline (PBS) containing 0.2% Triton X100, 1% Bovine Serum Albumine (BSA), 0.5% FCS for 30 minutes at Room Temperature. Non permeabilized cells were incubated with the same buffer without Triton X100. Permeabilized and non permeabilized cells were first incubated with the indicated antibodies for 40 min at RT, and subsequently with the appropriate secondary antibodies for 20 at RT. Nuclear counter-staining was done via incubation of fixed cells with Hoechst 33342 (Molecular Probes-Invitrogen). Primary antibodies used for immunodetection were the anti-mCherry Rabbit polyclonal Antibody from Abcam (ab 183528), 1:1000 dilution, and the anti-Hemagglutinin (HA) mouse monoclonal antibody from Santa Cruz Biotechnology (sc-7392), 1:500 dilution. Secondary antibodies (Life Technologies) were Alexa Fluor 488 goat anti-rabbit for detection of mCherry, and Alexa Fluor 568 goat anti-mouse for detection of HA.
[0140] Confocal images were taken under a Zeiss Axio Imager.Z1m microscope equipped with Plan-apochromat 63x/1.4 oil DIC objective. Acquisition software was the software that comes with the AxioPlan LSM 510 confocal microscope. All images were analyzed and assembled using Fiji. Images are representative of the original data and comply with the journal image processing policy.
Protein Electrophoretic Analysis and Western Blotting.
[0141] Cells were harvested and lysed in RIPA buffer (150 mM sodium chloride, 1% Triton X-100,0.5% sodium deoxycholate, 0.1% SDS (sodium dodecyl sulfate), 50 mM Tris, pH 8.0) containing proteases/phosphatases inhibitors for 15 on ice with occasional vortexing, and centrifuged for 10 min at 4 C. at 10,000 rpm. Protein extracts in the supernatants were separated on denaturing 10% polyacrylamide gels (SDS Page) and transferred to a PVDF membrane for immunoblotting. Primary antibodies used were: anti-mCherry Rabbit polyclonal from Abcam (ab 183528), 1:2000, anti-HA mouse monoclonal from Santa Cruz Biotechnology (sc-7392), 1:1000, anti-gfp Rabbit polyclonal from Santa Cruz Biotechnology. (sc-8334), 1:500, anti-human Transferrin Receptor (TfR) mouse monoclonal from Invitrogen (13-6800), 1:1000. Secondary antibodies and detection reagents were from Pierce (SuperSignal West Femto kit).
Lipid Raft Flotation Assay.
[0142] Identification of lipid rafts through flotation on Optiprep sucrose gradient is a standard procedure, widely described in the literature (Simons, K. et al., 1997, Nature 387, 569-572; Brown, D. A. et al., 1998 Annu. Rev. Cell Dev. Biol, 14, 111-136; Hooper, N. M. Mol., 1999, Membr. Biol. 16, 145-156; Lingwood, D. et al, 2007 Nat. Protoc. 2, 2159-2165). Here the protocol used to study the association of PRV US9 with lipid rafts from infected cells was followed (Lyman, M. G., et al, 2008, PLOS Pathog. 4, e1000065).
[0143] Briefly, cells were harvested, washed once on ice in PBS, lysed in 1 ml ice cold lysis buffer (1% Triton X100 in TNE: 25 mM Tris pH 6.8, 150 mM NaCl, 5 mM EDTA) with proteases/phosphatases inhibitors, homog-enized by passing 15 times through an 18-gauge needle, rocked for 30 min at 4 C., homogenized again (5 times through an 18-gauge needle), and finally mixed with 2 ml of ice-cold 60% Optiprep density gradient medium (Sigma-Aldrich). The gradient was prepared by placing the cells homogenate at the bottom of a Beckman SW41 ultracentrifuge tube and subsequently overlaying it with 5 ml of ice-cold 30% Optiprep in TNE and 4 ml of ice-cold 5% Optiprep in TNE. Samples were centrifuged at 34,200 rpm (200,000g) at 4 C. for 20 hours. 1 ml fractions were collected from top and analyzed by SDS Page.
Plasmid Construction.
[0144] A complete list of plasmids generated in this study is provided in
[0145] TEV protease sequence was amplified from plasmid mCherry_LD 0_TEV Daringer, N. M., 2014, ACS Synth. Biol. 3, 892-902). and inserted in g9nostop to generate g9t. 9t was subsequently obtained by collapsing the region comprising gfp in g9t. t9mC was obtained by replacing the gfp sequence in g9mC with the TEV protease amplified sequence. To construct the HSV US9-based TEV protease substrates, oligonucleotides coding the amino acid sequence GSENLYFQ/G (SEQ ID NO: 23) were annealed in vitro and inserted in g9mC (TEV protease cleavage site is underlined; cleavage occurs between Q/G). Convenient restriction sites were added at the oligonucleotides 5-and 3-ends to allow cloning between HSV US9 and mCherry in g9tcsmC, or gfp and HSV US9 in gtcs9mC. DNA sequences coding for BACE1 (aa 454-481) and APP (aa 694-729) regions comprising transmembrane domains were amplified from 293T cells genomic DNA and used to replace the HSV US9 sequence in gtes9mC, to obtain gtscBmC and gtesAmC, respectively. To generate gtcsA695TMmC, the sequence encompassing trans membrane and cytosolic domains of APP was amplified from plasmid pCAX APP 695 (Addgene #30137) and inserted into gtcs9mC to replace the HSV US9 sequence. APP amino acids numbers refer to APP770.
[0146] To generate gtcsCTMmCthe substrate based on HSV glycoprotein C (gC) trans membrane domain (CTM)the sequence coding for aa 478-504 (sequence reference GenBank: GU734771.1) of gC was amplified from viral DNA and cloned into gtcsBmC to replace the BACE1 TM portion of the substrate. The CTM-driven TEV protease was obtained by replacing the gfp-tcs sequence in gtcsCTMmC with the TEV protease sequence, and the resulting plasmid was named tCTMmC.
[0147] A detailed description of regions present between main elements in all these constructs is given in
Example 1: HSV US9 Efficiently Drives Recombinant Proteins to either Leaflet of Cellular Membranes
[0148] Modification of the HSV US9 N-terminus by the attachment of green fluorescent protein (gfp) does not alter its function in the context of viral infection. The gfp-HSV US9 fusion protein also retains its properties in the absence of other viral proteins and its natural cargo, the virion. Furthermore, HSV US9 from pseudorabies viruses (PRV) was found to associate with lipid rafts. To confirm that this property is maintained by gfp-HSV US9, its behavior on a sucrose gradient was analyzed (
[0149] Constructs were generated using the fluorescent reporter protein mCherry attached to the C-terminus of HSV US9 (named 9mC). The mCherry sequence was also fused to gfp-HSV US9, to yield a double reporter of HSV US9 distribution that harbors two different fluorescent probesi.e. on the N and C terminals of HSV US9 (g9mC). The topological organization of these constructs with respect to membrane insertion is shown in
[0150] The ability of HSV US9 to act as a transport protein independently of the side on which the exogenous sequence is attached is further reinforced by the results obtained with the gfp-HSV US9-mCherry chimera (
[0151] The correct orientation of the newly generated HSV US9-mCherry was additionally tested using immunofluorescence with an antibody directed against mCherry. In this orientation, mCherry is present on the non-cytosolic side of membranes, i.e. vesicle lumen and extracellular space. Therefore, if cells are not permeabilized, the plasma membrane should be labeled with fluorescent antibody while mCherry on vesicles should not be accessible. The results (
Example 2: Design, Construction and Analysis of a US9-Driven Functional Assay
[0152] The HSV US9 autonomous targeting properties described so far using confocal microscopy and biochemical means suggest that HSV US9 is well-suited for studies intended to analyze the intracellular trafficking and distribution of lipid-raft targeted proteins, such as those involved in APP processing. However, in order to demonstrate that HSV US9 can localize in close proximity of these proteins (i.e. sufficiently to interact with them as would be necessary for future interventional experiments using HSV US9-driven enzymes), a HSV US9-based functional assay was developed. In so doing, the HSV US9's ability to target a cargo that retains functional activity to specific cellular districts was also establish.
[0153] For the purpose of developing a functional assay, the 27 KDa catalytic domain of the Nuclear Inclusion a (NIa) protein from the Tobacco Etch Virus (TEV) was utilized. This enzymatic activity has been well-characterized in TEV and is not present in mammalian cells, providing a very clean system to detect HSV US9-driven activities. The short cleavage site recognized by the TEV protease is not targeted by other endogenous cellular enzymes, linking the generation of a cleaved product to the presence and close proximity of exogenous protease and substrate. The HSV US9-driven functional assay was assembled as described in
[0154] The same bands were absent from cell lysates in which only the substrate was present (lane 1). The larger cleaved products detected with the gfp antibody is composed of the N-terminal portion of the substrate, containing gfp fused to HSV US9 (HSV US9 yields multiple bands in polyacrylamide gels, probably due to post-translational modifications). The smaller fragment corresponds to the residual C-terminal mCherry. The appearance of the cleaved fragments correlates with the reduction of the full-length uncleaved substrate and with increased expression of TEV protease (
[0155] Cells were transfected with a constant amount of substrate and with increasing amounts of HSV US9-protease DNA (9t) ranging from 0 to 150 ng. No cleaved fragments were produced in the absence of the protease (first lane in
Example 3: HSV US9-Driven Enzymes are Active in the Vesicle Lumen and Observe Membrane Leaflet Specificity
[0156] Similar to the evidence indicating that the membrane leaflet orientation of fused fluorescent proteins is determined by their addition to the C- or N-terminal of HSV US9 (
Example 4: The HSV US9-Driven TEV Protease Activity occurs in Lipid Rafts
[0157] The HSV US9-dependent transport of virions or viral components in the context of viral infection relies on its ability to associate with lipid rafts. For HSV US9 to be used as an effective targeting tool, the chimeric molecules generated should functionally target lipid raft associated molecules. As a way to test that HSV US9 functionally localizes to relevant lipid raft-associated proteins, the HSV US9-driven protease from the functional assay was used in combination with protease substrates driven by the transmembrane domains of proteins involved in APP processing (i.e. APP and BACE1). APP processing to amyloid -protein through sequential cleavage of APP is modulated by dynamic association with lipid rafts, and is a pathway highly relevant to pathology in neurons.
[0158] Briefly, APP can be processed by a -secretase, BACE1, to produce a fragment that can then be cleaved by a -secretase to release amyloid -protein. APP cleavage by BACE1 is thought to occur mainly in lipid rafts and BACE1 was selected as an indicator of the HSV US9-driven functional ability to affect lipid rafts molecular events. Hence, the HSV US9-based substrate g9tcsmC was modified by replacing the HSV US9 domain of the chimeric protein with the trans-membrane domain of BACE1 (BACE1-TM), to determine if it was accessible to the activity of the HSV US9-driven protease. Transmembrane domains play a critical role in proper membrane partitioning and proteins sorting/localization. Unlike HSV US9, BACE1 is a type I membrane protein, with the C-terminal portion exposed on the cytosolic side of membranes. Therefore, the orientation of the cleavable reporter was inverted, with the TEV protease cleavage site inserted between gfp and BACE1-TM, to generate gtcsBmC, as described in
[0159] Cells were co-transfected with the BACE1-based substrate and increasing amounts of the HSV US9-driven protease, and the activity of the enzyme was assessed. As shown in
[0160] The other key component of the APP processing is APP itself. APP cleavage is a complex regulated process in which lipid rafts association seems to play a critical role. Attracted by the possibility that it might be possible to eventually modify the molecular machinery responsible for amyloid -protein production, further investigated was the ability of HSV US9 to functionally act on APP-based substrates. APP is a type I membrane protein, and therefore gtcs-BmC was used as a backbone to replace the BACE1-TM with the APP trans-membrane domain, without or with the APP C-terminal domain. The two new substrates were named gtcsAmC and gtcsA695TMmC, respectively, and their organization with respect to the APP sequence is exemplified in
[0161] To add further evidence that HSV US9 fusion proteins localize specifically with other lipid raft proteins, additional functional experiments were performed using glycoprotein C (gC) from HSV 1. The gC is a type I membrane protein, similarly to BACE1 and APP, that does not localize to lipid rafts, and its trans-membrane domain (gC-TM) has been used in chimeric reporters to show non lipid raft localization. As shown in
[0162] These constructs were then tested for their ability to act as substrates for the activity of the HSV US9-driven protease (
Example 5
[0163] Membrane microdomains (e.g. lipid rafts) and compartmentalization play a major role in numerous physiological and pathological processes, including HIV infection. Lipid rafts were recently suggested to also contribute to HIV neuropathogenesis. However, due to the limited availability of specific study tools, the exact contribution of lipid rafts to HAND is still unclear. The evidence that the lipid-raft dwelling protein HSV US9 can be used to investigate the contribution of lipid rafts-dependent changes induced by viral neurotoxins has been presented herein.
[0164] HSV US9 is an exogenous protein, with no known deleterious effect on mammalian cells. It is shown here that US9-driven recombinant cargos can be attached to either terminus of HSV US9 without altering its cellular distribution. Of note, HSV US9 distribution/trafficking behavior is maintained in different cell types, both primary cells (neurons) and various cell lines. The HSV US9-driven functional assay introduced here is based on the constitutively active exogenous proteolytic enzyme TEV protease. Interactions between the HSV US9-guided exogenous protease and recombinant proteins containing its cleavage sequence occurred predictably and relied on both protease and substrate sharing similar cellular compartmentalization, lateral membrane segregation, and membrane leaflet orientation. The observed cleavage of the substrates by the HSV US9-driven protease can only result from the close proximity of the two molecules. Therefore, cleavage represents the evidence of effective enzymatic processing, and provides corroborative functional evidence of lipidraft determination by biochemical means.
[0165] The HSV US9-based functional assay designed and tested was instrumental in demonstrating the ability of HSV US9 to target a functional cargo to the luminal leaflet of cellular vesicles, and to actively target molecules involved in APP processing. For this reason, an exogenous proteolytic activity not present in mammalian cells was selected, in order to provide unambiguous results exclusively dependent on the effect of the protease on its specific substrate. Nevertheless, based on data collected, the HSV US9 targeting capabilities can be used to directly manipulate the APP processing machinery, to help understand the contribution of individual steps in neuronal alterations depending on the presence of viral neurotoxins. Additionally, fluorescently tagged HSV US9 proteins such as g9, 9mC, and g9mC can provide a snapshot of targeted interaction/cleavage. Intr-neuronal accumulation of amyloid -protein has been widely reported in the HIV-infected brain. However, HIV is known to affect amyloidogenesis in different ways, and deposition of amyloid -protein plaques is also often found in aging HIV-infected individuals. As both HSV US9 and APP machinery can transiently accumulate on the plasma membrane, HSV US9-dependent functional activity can be used to study events that occur on the plasma membrane.
Example 6: HSV US9-based Strategies for Modulation of APP Processing
[0166] As stated elsewhere herein, the APP misprocessing to amyloid formation is associated with neuropathological conditions, such as Alzheimer's Disease and HIV-Associated Neurocognitive Disorders (HAND). The intracellular trafficking of the Herpes Simplex Virus HSV US9 protein overlaps with that of the enzymatic machinery responsible of APP processing, and HSV US9 is able to target functional cargos to cellular districts in which APP and BACE1 ( APP cleaving enzyme 1) interact. Both HSV US9 and APP processing machinery rely on their ability to shuttle between endosomes and plasma membranes, as well as on their lateral accumulation in lipid rafts.
[0167] With the intent of altering APP processing that leads to amyloid formation, a series of HSV US9-based chimeric proteins, in which either the full length HSV US9 or just its trans-membrane domain was fused to an effector protein, were generated.
[0168] The chimeric protein 99A10pepcomprising a reporter gfp (green fluorescent protein), full length HSV US9, and the peptidase domain of the cellular -secretase ADAM10 (A disintegrin and metalloproteinase 10)was studied. Expression of this construct dramatically reduces the production of the APP C-terminal fragments, which result from APP -cleavage by BACE1 (
[0169] Indeed, extracellular release of amyloid- from cells overexpressing APP and BACE1 in the presence of g9A10pep was almost undetectable (
Example 6: HSV US9-based Molecular Tools can Reduce APP -Amyloidogenic Processing by Exploiting Multiple Molecular Mechanisms
[0170] As shown in
[0171] In the gPTB9TM construct (wherein, the phosphotyrosine binding domain (PTB) of X11 fused to N-terminal HSV US9 trans-membrane domain (TM)), the effector protein has no enzymatic activity and the reduction of APP -amyloidogenic processing is achieved by driving APP away from BACE1-enriched domains as result of PTB binding. The gPTB9TM increases plasma membrane localization of APP (and maybe favor APP interaction with ADAM10 on the cell surface, thereby reducing the levels of amyloid- peptide by APP -cleavage from endogenous ADAM10).
[0172] The disclosures of each and every patent, patent application, and publication cited herein are hereby incorporated herein by reference in their entirety. While this invention has been disclosed with reference to specific embodiments, it is apparent that other embodiments and variations of this invention may be devised by others skilled in the art without departing from the true spirit and scope of the invention. The appended claims are intended to be construed to include all such embodiments and equivalent variations.