METHOD OF PURIFYING IMMUNOGLOBULIN G AND USES THEREOF
20250074970 ยท 2025-03-06
Inventors
- Roopsee ANAND (Coelbe, DE)
- Peter DOLLINGER (Weimar, DE)
- Laura HOLLER (Boca Raton, FL, US)
- Martin NEUENFELDT (Marburg, DE)
- Magdalena POLATYNSKA (Marburg, DE)
- Heike Nicole Wilka (Lahntal, DE)
- Katrin ANDERS (Marburg, DE)
- Norbert Schulze (Hattersheim, DE)
- David BOEREMA (Bourbonnais, IL, US)
Cpc classification
C07K1/22
CHEMISTRY; METALLURGY
C07K2317/22
CHEMISTRY; METALLURGY
International classification
Abstract
The present disclosure relates to methods of purifying immunoglobulin G (IgG) and other proteins, such as albumin, from plasma or a fraction thereof using an affinity chromatography resin comprising a ligand capable of specifically binding to a CH3 domain of human IgG. The present disclosure also relates to formulation and uses of plasma protein product produced from the method.
Claims
1. A method of purifying immunoglobulin G (IgG) from plasma or a fraction thereof using continuous affinity chromatography, the method comprising binding the IgG to an affinity chromatography resin comprising a ligand capable of specifically binding to a CH3 domain of human IgG and collecting the IgG.
2. A method of producing an immunoglobulin G (IgG) enriched preparation from plasma or a fraction thereof using continuous affinity chromatography, the method comprising binding the IgG to an affinity chromatography resin comprising a ligand capable of specifically binding to a CH3 domain of human IgG and collecting the IgG.
3. The method of claim 1, wherein the ligand comprises a camelid-derived single domain [VHH] antibody fragment.
4. The method of claim 1, wherein the resin comprises a matrix selected from the group consisting of a cross-linked poly(styrene-divinylbenzene) matrix and an agarose-based matrix.
5. (canceled)
6. The method of claim 1, wherein the method further comprises washing the resin with a wash buffer having a pH of between 5 and 10 and a dissociation constant (pKa) between 6.8 and 8.5 at 25 C.
7. The method of am claim 1, wherein the method further comprises eluting the bound IgG from the resin with an elution buffer having a pH of between 3 and 5.
8. The method of claim 1, wherein the plasma or fraction thereof contacts the resin for between 0.1 and 5 minutes.
9. The method of claim 1, wherein the plasma fraction is selected from a group consisting of cryo-rich plasma, cryo-poor plasma, Supernatant I (SN I), Cohn Fraction II (Fr II), Cohn Fraction II+III (Fr II+III), Cohn Fraction I+II+III (FrI+II+III), Kistler/Nitschmann Precipitate A (KN A), Kistler/Nitschmann Precipitate B (KN B), Kistler/Nitschmann Precipitate of Supernatant B (KN B+1), and combinations thereof.
10. The method of claim 1, wherein the plasma or fraction thereof is thawed at a temperature of at least 32 C.
11. The method of claim 1, wherein the plasma or fraction thereof is at a temperature in the range of from 2 C. to 28 C. before the continuous affinity chromatography.
12.-13. (canceled)
14. The method of claim 1, wherein the wash buffer comprises a buffering agent selected from a group consisting of sodium dihydrogen phosphate, imidazole, Tris, glycylglycine, 3-morpholinopropane-1-sulfonic acid (MOPS), piperazine-N,N-bis(2-ethanesulfonic acid) (PIPES), 2-[(2-Hydroxy-1,1-bis(hydroxymethyl)ethyl)amino]ethanesulfonic acid (TES), bis[(2-hydroxyethyl)amino]acetic acid (Bicine), 4-(2-hydroxyethyl)-1-piperazineethanesulfonic acid (HEPES), sulfurous acid, 4-(2-Hydroxyethyl)-1-piperazinepropanesulfonic acid (EPPS), N-(Hydroxyethyl)piperazine-N-2-hydroxypropanesulfonic acid (HEPPSO), 4-(N-Morpholino)butanesulfonic acid (MOBS), Piperazine-N,N-bis(2-hydroxypropanesulfonic acid) (POPSO), N-[Tris(hydroxymethyl)methyl]-3-amino-2-hydroxypropanesulfonic acid (TAPSO), Tricine, triethanolamine (TEA) and combinations thereof.
15. (canceled)
16. The method of claim 1, wherein the wash buffer further comprises sodium chloride and/or a divalent salt at a concentration of up to 1000 mM.
17. (canceled)
18. The method of claim 1, wherein the elution buffer is or comprises a phosphate buffer and/or an acetate buffer at a pH of between 3 and 5.
19. (canceled)
20. The method of claim 1, wherein the method further comprises equilibrating the resin with an equilibration buffer having a pH between 7 and 8.
21.-22. (canceled)
23. The method claim 1, wherein the method further comprises equilibrating the resin after stripping the resin with an equilibration buffer having a pH between 7 and 8.
24. The method of any claim 1, wherein the continuous affinity chromatography is selected from the group consisting of simulated moving bed (SMB) chromatography, periodic counter-current chromatography (PCC), continuous counter-current tangential chromatography (CCTC), and continuous counter-current spiral chromatography (CCSC).
25. The method of claim 1, wherein the resin is in the form of a slurry or the resin is packed into one or more column(s), wherein each column comprises one or more zones.
26. The method of claim 1, wherein the resin is in the form of a slurry or the resin is packed into one or more column(s), wherein each column comprises one or more zones chosen from an equilibration zone, a binding zone, a wash zone, an elution zone or a combination thereof.
27. The method of claim 1, wherein the resin is packed into one or more column(s) and wherein the columns are fluidly connected and separated by fluid conduits comprising inlet and outlet valves.
28. The method of claim 1, wherein the resin is packed into one or more column(s), and wherein the resin is packed into a series of three columns, wherein each column is a separate zone.
29. (canceled)
30. The method of claim 25, wherein at least one column is loaded with IgG at a concentration above the dynamic binding capacity (DBC) of the resin.
31.-33. (canceled)
34. The method of claim 1, wherein the resin has a total bed height of at between 2 cm and 30 cm.
35. The method of claim 1, wherein the method further comprises regenerating the resin.
36. The method of claim 1, wherein the method further comprises sanitizing the resin.
37. The method of claim 1, wherein the method further comprises one or more steps selected from a group consisting of ethanol precipitation, octanoic acid fractionation, ion exchange chromatography, viral inactivation, viral filtration and ultrafiltration/diafiltration.
38. The method of claim 1, wherein the method further comprises an ion exchange chromatography step, wherein the ion exchange chromatography step comprises anion exchange chromatography step using a strong anion exchange resin operated in flow through mode.
39.-43. (canceled)
44. The method of claim 1, wherein at least 75% of the IgG is recovered from the plasma or fraction thereof.
45. The method of claim 1, wherein the eluted IgG has a purity of at least 95%.
46. (canceled)
47. A method for purifying immunoglobulin G (IgG) from plasma or a fraction thereof using simulated moving bed (SMB) chromatography, the method comprising: a) equilibrating an affinity chromatography resin comprising a cross-linked poly(styrene-divinylbenzene) matrix and a ligand capable of specifically binding to a CH3 domain of human IgG with a 20 mM phosphate equilibration buffer having a pH of between 7 and 8; b) binding the IgG from the plasma or fraction thereof to the resin; c) washing the resin with a 20 mM phosphate wash buffer having a pH of between 7 and 8; and d) eluting the bound IgG with a 20 mM acetate or phosphate elution buffer having a pH of between 3 and 5; wherein steps a) to d) may be repeated on the affinity chromatography resin and wherein, the affinity chromatography resin is packed into a series of two or more fluidly-connected columns separated by fluid conduits comprising inlet and outlet valves, and optionally wherein the method does not comprise stripping the resin.
48. A pharmaceutical composition comprising IgG purified or produced by the method of claim 1.
49.-50. (canceled)
51. The pharmaceutical composition of claim 48, wherein the pharmaceutical composition comprises a purity of at least 98% immunoglobulin G (IgG).
52.-56. (canceled)
57. The pharmaceutical composition of claim 48, wherein the pharmaceutical composition comprises an IgA content of 0.05 mg/mL.
58. The pharmaceutical composition of claim 48, wherein the pharmaceutical composition comprises a Prekallikrein activator (PKA) level of 35 IU/mL.
59.-60. (canceled)
61. A method of treating, preventing and/or delaying progression of a condition in a subject, the method comprising administering the pharmaceutical composition of claim 48 to the subject.
62. The method of claim 61, wherein the condition is selected from a group consisting of primary immunodeficiency disease (PI), chronic inflammatory demyelinating polyneuropathy (CIDP), and chronic immune thrombocytopenic purpura (ITP).
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0522]
[0523]
[0524]
[0525]
[0526]
[0527]
[0528]
[0529]
[0530]
[0531]
[0532]
KEY TO SEQUENCE LISTING
[0533] SEQ ID NO: 1 is an amino acid sequence of VHH fragment [0534] SEQ ID NO: 2 is an amino acid sequence of CDR1 of the VHH fragment [0535] SEQ ID NO: 3 is an amino acid sequence of CDR2 of the VHH fragment [0536] SEQ ID NO: 4 is an amino acid sequence of CDR3 of the VHH fragment
DETAILED DESCRIPTION
General
[0537] Throughout this specification, unless specifically stated otherwise or the context requires otherwise, reference to a single step, composition of matter, group of steps or group of compositions of matter shall be taken to encompass one and a plurality (i.e. one or more) of those steps, compositions of matter, groups of steps or groups of compositions of matter.
[0538] Those skilled in the art will appreciate that the present disclosure is susceptible to variations and modifications other than those specifically described. It is to be understood that the disclosure includes all such variations and modifications. The disclosure also includes all of the steps, features, compositions and compounds referred to or indicated in this specification, individually or collectively, and any and all combinations or any two or more of said steps or features.
[0539] The present disclosure is not to be limited in scope by the specific examples described herein, which are intended for the purpose of exemplification only. Functionally-equivalent products, compositions and methods are clearly within the scope of the present disclosure.
[0540] Any example of the present disclosure herein shall be taken to apply mutatis mutandis to any other example of the disclosure unless specifically stated otherwise.
[0541] Unless specifically defined otherwise, all technical and scientific terms used herein shall be taken to have the same meaning as commonly understood by one of ordinary skill in the art (for example, in cell culture, molecular genetics, immunology, immunohistochemistry, protein chemistry, and biochemistry).
[0542] The term and/or, e.g., X and/or Y shall be understood to mean either X and Y or X or Y and shall be taken to provide explicit support for both meanings or for either meaning.
[0543] Throughout this specification the word comprise, or variations such as comprises or comprising, will be understood to imply the inclusion of a stated element, integer or step, or group of elements, integers or steps, but not the exclusion of any other element, integer or step, or group of elements, integers or steps.
[0544] As used herein the term derived from shall be taken to indicate that a specified integer may be obtained from a particular source albeit not necessarily directly from that source.
[0545] Furthermore, as used herein the singular forms of a, and and the include plural references unless the context clearly dictates otherwise.
Selected Definitions
[0546] The term purify or purifying or purification shall be taken to mean the removal, whether completely or partially, of at least one impurity present in the plasma or fraction thereof, which thereby improves the level of purity of IgG in solution.
[0547] The term impurity or impurities shall be taken to include one or more components in the plasma or fraction thereof other than IgG. For example, impurities may include albumin (-globulins and/or -globulins), plasma lipids, plasma proteins, proteases (e.g. serine proteases, kallikrein, plasmin and FXa), serine protease inhibitors (e.g. C1 inhibitor, alpha-1-antitrypsin and anti-thrombin), IgA and IgM, factor VIII, fibrinogen, von Willebrand factor, activated clotting factors (e.g. FXa, FIXa, FVIIa and thrombin), factor XIII, contact system factors (e.g. FXIa, FXIIa and plasma kallikrein), PKA, factor IX, prothrombin complex, C1 esterase inhibitor, protein C, anti-thrombin III, a RhD immunoglobulin and platelet membrane microparticles.
[0548] The term immunoglobulin G (IgG), also known as gamma globulin or immune globulin, shall be taken to mean antibody of isotype G. There are several subclasses of IgG, for example, IgG1, IgG2, IgG3 and IgG4.
[0549] The term plasma shall refer to the straw-coloured/pale yellow component of blood obtained from one or more blood donor(s). Methods of obtaining plasma from a donor will be apparent to a skilled person and/or described herein. For example, plasma is obtained by removing red blood cells from donated blood. For example, plasma is obtained by plasmapheresis.
[0550] The term plasma fraction or fraction thereof shall refer to plasma which has been fractionated to isolate one or more desirable protein components from the plasma.
[0551] For example, plasma may be fractionated to isolate cryo-precipitates (proteins that precipitate out of solution when a unit of fresh frozen plasma is slowly thawed in the cold) and cryosupernatant (also known as cryo-poor plasma). For example, plasma may be fractionated by ethanol precipitation to produce IgG-containing Oncley fractions, Cohn fractions, ammonium sulphate precipitates, or Precipitates A (KN A), B (KN B), and the Precipitate of Supernatant B (KN B+1) from plasma as described in U.S. Pat. No. 3,301,842. Plasma fractions include II+III precipitate produced according to Cohn methods such as Method 6, Cohn et. al. J. Am; Chem. Soc., 68 (3), 459-475 (1946), Method 9, Oncley et al. J. Am; Chem. Soc., 71, 541-550 (1946), or the I+II+III precipitate, Method 10, Cohn et. al. J. Am; Chem. Soc., 72, 465-474 (1950); as well as the method of Deutsch et. al. J. Biol. Chem. 164, 109-118 (1946) or the Precipitate-A, B and the Precipitate of Supernatant B of Nitschmann and Kistler Vox Sang. 7, 414-424 (1962); Helv. Chim. Acta 37, 866-873 (1954). For example, the plasma may be fractionated by octanoic acid fractionation as described in European application 893450. Typically, Cohn Fractions, and Kistler/Nitschmann Precipitate's A (KN A), B (KN B) and the Precipitate of Supernatant B (KN B+1) exist as a suspended paste. Other purification techniques including chromatography may be used.
[0552] The term cryo-precipitate or cryo-precipitates refers to proteins in plasma that precipitate out of solution when a unit of fresh frozen plasma is slowly thawed in the cold. Cryo-precipitates include factor VIII, fibrinogen, von Willebrand factor, factor XIII and platelet membrane microparticles.
[0553] The term cryo-poor plasma shall be taken to mean plasma removed of cryo-precipitates.
[0554] The term cryo-rich plasma shall be taken to mean plasma comprising components typically found in cryo-precipitates.
[0555] The term clarified or clarifying shall be taken to mean a process of passing a plasma or fraction thereof through a suitable filter (e.g. depth filter and/or 1.2 and 0.45/0.22 m membrane filter) to remove one or more impurities prior to use in a method described herein.
[0556] The term dissociation constant shall refer to the pKa of a buffer. pKa=log.sub.10 (Ka), wherein Ka is the acid dissociation constant of the buffering agent of the buffer. For example, a wash buffer of 20 mM sodium dihydrogen phosphate, 40 mM sodium chloride at a pH of 7.4 comprises sodium dihydrogen phosphate as the buffering agent. Phosphoric acid has three dissociation constants (pKa1: 2.16, pKa2: 7.21, pKa3: 12.32).
[0557] The term affinity chromatography resin shall be taken to mean a resin comprising an affinity chromatography ligand (e.g. camelid-derived single domain [VHH] antibody fragment) attached to a matrix such as, e.g., those described herein. Exemplary affinity chromatography resins used in a method described herein include POROS CaptureSelect FcXP affinity resin (Thermo Fisher) and CaptureSelect FcXP agarose affinity resin (Thermo Fisher). Further exemplary affinity chromatography resins include a resin having an amino acid sequence encoded by SEQ ID NO: 1 or variants thereof that specifically bind to the CH3 domain of human IgG. Exemplary affinity chromatography resins are also described in U.S. Ser. No. 10/259,886.
[0558] The term specifically binds, specifically binding or binds specifically shall be taken to mean that a protein of the disclosure reacts or associates more frequently, more rapidly, with greater duration and/or with greater affinity with a particular antigen or cell expressing same than it does with alternative antigens or cells. For example, a ligand capable of specifically binding to a CH3 domain of human IgG with materially greater affinity (e.g., 1.5 fold or 2 fold or 5 fold or 10 fold or 20 fold or 40 fold or 60 fold or 80 fold to 100 fold or 150 fold or 200 fold) than it does to other antigens. Generally, but not necessarily, reference to binding means specific binding, and each term shall be understood to provide explicit support for the other term.
[0559] The term ligand shall be taken to mean a molecule immobilised to a matrix of the affinity chromatography resin which specifically binds to the CH3 domain of human IgG. For example, the ligand is a camelid-derived single domain [VHH] antibody fragment.
[0560] The term enriched preparation shall be taken to include an eluate, solution or pharmaceutical composition described herein. The enriched preparation of the present disclosure comprises IgG at greater purity compared to IgG in the plasma or fraction thereof.
[0561] The term camelid-derived single domain [VHH] antibody fragment shall be taken to mean a VHH domain of a camelidae antibody. The camelidae antibody is an antibody produced from camels and llamas and has no CH1 domain normally present in human immunoglobulins and only one VHH domain. Exemplary affinity chromatography resins comprising the camelid-derived [VHH] antibody fragment include CaptureSelect antibody affinity chromatography resins (Thermo Fisher). For example, CaptureSelect FcXL affinity resin, POROS CaptureSelect FcXP affinity resin, CaptureSelect IgG-CH1 affinity resin, and CaptureSelect FcXP agarose affinity resin. Further exemplary affinity chromatography resins include IgSelect affinity resin (Cytiva), HiTrap IgSelect affinity resin (Cytiva), Pierce Protein G agarose affinity resin (Thermo Fisher), and Protein G sepharose 4 fast flow affinity resin (Cytiva).
[0562] The term matrix shall be taken to mean a support to which the ligand is immobilised. Exemplary matrices are cross-linked poly(styrene-divinylbenzene) matrix and agarose-based matrix.
[0563] The term dynamic binding capacity or DBC of a chromatography resin shall be taken to refer to the maximum amount of IgG that the resin will bind under operating conditions before significant breakthrough of unbound IgG occurs.
[0564] The term per mL of resin shall be taken to refer to per mL of wet packed volume of resin.
[0565] The term bed height shall be taken to mean the height at which the affinity chromatography resin is packed into a column. It will be apparent to the skilled person that reference to total bed height refers to the bed height of all columns in the continuous chromatography set-up.
[0566] The term non-loading phase shall be taken to mean a phase other than the loading phase of the continuous chromatography method. For example, a non-loading phase can refer to an equilibration phase, a wash phase, an elution phase, a strip phase and/or a re-equilibration phase.
[0567] The term cycle shall be taken to mean one round of equilibrating, IgG loading, binding, elution, stripping, sanitising, and/or regenerating performed on the resin.
[0568] The term purity shall refer to the portion of IgG relative to the total protein content of purified IgG, IgG enriched preparation and pharmaceutical composition expressed as a percentage.
[0569] The term industrial or commercial scale or large scale or manufacturing scale shall refer to the amount of product that would be produced in a batch that was designed for clinical testing, formulation, sale and/or distribution to the public. For example, industrial scale refers to large scale purification of IgG from the plasma or fraction thereof to produce the plasma protein product.
[0570] The term plasma protein product shall refer to a preparation, composition and/or protein product comprising a plasma protein (e.g. IgG or impurity such as albumin) derived from the purification of the plasma or fraction thereof. Typically, the plasma protein is the predominant protein in the plasma protein product.
[0571] The term pharmaceutical composition shall be taken to mean a formulation of IgG with compounds generally accepted in the art for the delivery of IgG to mammals. Exemplary compounds include all pharmaceutically acceptable carriers, diluents or excipients thereof.
[0572] The term treat or treatment or treating shall be taken to mean administering a therapeutically effective amount of IgG such that one or more symptoms or characteristics of the condition is reduced in the subject or that the subject is no longer clinically diagnosed with the condition.
[0573] The term preventing, prevent or prevention includes providing prophylaxis with respect to occurrence or recurrence of a specified condition in a subject. A subject may be predisposed to or at risk of developing a condition but has not yet been diagnosed with the condition.
[0574] As used herein, the phrase delaying progression of includes reducing or slowing down the progression of a condition in a subject and/or at least one symptom of the condition.
[0575] The term condition shall be taken to mean a state of being or health status of a subject in need of treatment with IgG. Exemplary conditions include but are not limited to primary immunodeficiency disease (PI), chronic inflammatory demyelinating polyneuropathy (CIDP), and chronic immune thrombocytopenic purpura (ITP).
[0576] The term subject shall be taken to mean any animal including humans, for example a mammal. Exemplary subjects include but are not limited to humans and non-human primates. For example, the subject is a human.
Continuous Affinity Chromatography
[0577] The present disclosure provides a method of purifying IgG from plasma or a fraction thereof using continuous affinity chromatography.
[0578] The term continuous affinity chromatography shall be taken to mean a chromatographic method comprising one or more column(s) packed with identical affinity resins, wherein each column comprises one or more zones. A zone is a column, or a region of a column, comprising the resin where one or more chromatography steps can be performed. For example, a zone is selected from a group consisting of an equilibration zone, a binding zone, a wash zone, an elution zone, a stripping zone, or a combination thereof. In one example, a zone is selected from a group consisting of an equilibration zone, a binding zone, a wash zone, an elution zone, or a combination thereof.
[0579] Continuous affinity chromatography comprising more than one column involves the columns being connected in an arrangement that allows the columns to be operated in series and/or in parallel. In principle, IgG may be loaded on a first and/or subsequent columns while other columns (or other zones of a column) are going through an equilibration, wash, elution, and/or regeneration simultaneously. Examples of continuous affinity chromatography will be apparent to the skilled person and/or described herein.
[0580] Examples of columns which may be used to perform the continuous chromatography method will be apparent to the skilled person and/or described herein. For example, the continuous chromatography method may be performed using Tricorn 5/100 (Cytiva). In another example, the continuous chromatography method may be performed using BioSMB PD System (Sartorius).
Simulated Moving Bed (SMB) Chromatography
[0581] In one example, the continuous affinity chromatography is simulated moving bed (SMB) chromatography. The term simulated moving bed chromatography or SMB chromatography refers to a chromatography method first described in U.S. Pat. No. 2,985,589. Examples of SMB chromatography setup and/or apparatus will be apparent to the skilled person and/or described herein. The concept of simulated moving bed involves the use of multiple smaller columns (rather than one large column) containing a solid absorbent (e.g. affinity resin) and performing one or more continuous chromatography steps (i.e. equilibration, binding, washing, eluting or stripping) simultaneously on different columns in a continuous loop.
[0582] An example of a SMB chromatography set up has columns arranged into four sections with one or more columns per section. Two inlet streams (feed and eluent) and two outlet streams (extract and raffinate) are directed in alternating order to and from the column ring. The inlet and outlet positions are switched at regular time intervals in the direction of the liquid flow, thus simulating counter-current movement of columns. A feed (containing adsorbable components (extract)) is loaded onto one or more columns of the SMB chromatography setup, and the extract binds to the resin within the columns. Meanwhile, less adsorbed components (raffinate) in the feed pass through the column. The raffinate may be loaded onto one or more subsequent column(s) or removed from the SMB chromatography system as waste. An eluent is loaded onto the column to collect the extract. For example, an eluate may be collected from a first column while more feed is loaded onto one or more subsequent column(s).
[0583] Suitable wash and elution buffers having the characteristics of the present disclosure will be apparent to the skilled person and/or described herein. In one example, the wash buffer comprises 20 mM sodium dihydrogen phosphate, 145 mM sodium chloride and is at a pH of 7.4. In one example, the wash buffer comprises 20 mM sodium dihydrogen phosphate, 500 mM sodium chloride and is at a pH of 7.4.
[0584] The resin in SMB chromatography may undergo multiple cycles (e.g. 50 cycles) of resin equilibration, IgG loading, binding, elution, stripping, sanitising, and/or regeneration per batch of plasma or fraction thereof used. Multiple batch runs (e.g. 4 to batches) may be performed using SMB chromatography. The total life time of the resin in SMB chromatography can be in the range of 200 to 500 cycles (if not more) before the resin is unusable. Resin regeneration is generally performed to allow multiple uses of the resin.
Periodic Counter-Current Chromatography (PCC)
[0585] In one example, the continuous affinity chromatography is periodic counter-current chromatography (PCC). Examples of PCC setup and/or apparatus will be apparent to the skilled person and/or described herein. The concept of PCC involves the use of multiple columns containing a solid absorbent (e.g. affinity resin) and performing the chromatography steps in parallel in a quasi-continuous manner. The buffers used in binding, washing, and/or elution steps flow counter-current to the affinity resin.
[0586] An example of PCC setup involves the use of two columns. In a first step, a sample is loaded onto a first column above the DBC of the resin so that unbound product (e.g. IgG) breaks through the first column and is captured by the second column. In a second step, the first column is washed, eluted, cleaned and/or re-equilibrated independently of the second column being loaded with a further sample. In a third step, an additional sample is loaded onto the second column above the DBC of the resin so that unbound product breaks through the second column and is captured by the first column. In a fourth step, the second column is washed, eluted, cleaned and/or re-equilibrated independently of the first column being loaded with a further sample. The process steps are continuously cycled between the two columns.
[0587] Another example of PCC setup involves the use of multiple columns. For example, a variation of the above PCC setup can involve use of multiple columns to capture unbound product which simulates use of a large column.
Continuous Counter-Current Tangential Chromatography (CCTC)
[0588] In one example, the continuous affinity chromatography is continuous counter-current tangential chromatography (CCTC). Examples of CCTC setup and/or apparatus will be apparent to the skilled person and/or described herein. The concept of CCTC involves using the affinity resin in a slurry form where the slurry is continuously directed through a number of static mixers and hollow fiber membranes which separate the fluid phase from the resin. CCTC is ordinarily performed at low pressures.
[0589] An example of a CCTC process involves binding, first wash, second wash, elution, stripping and/or equilibration steps. Another example of a CCTC process involves binding, first wash, second wash, elution and/or equilibration steps. For example, the CCTC process does not involve a stripping step. Sample (e.g. plasma or fraction thereof) and the affinity resin is passed through static mixers and hollow fiber membranes in a binding step. Impurities are removed in the flow through of the hollow fiber membranes in the washing step, while resin bound product (i.e. IgG) is retained by the membrane. The hollow fibres retain the resin and allow the product to flow through in the elution step. The resins are stripped and/or equilibrated and process repeated.
Continuous Counter-Current Spiral Chromatography (CCSC)
[0590] In one example, the continuous affinity chromatography is continuous counter-current spiral chromatography (CCSC). Examples of CCSC setup and/or apparatus will be apparent to the skilled person and/or described herein. The concept of CCSC involves the use of a compact rotating coil separation column mounted onto a centrifuge rotary frame. There are two separation column designs currently available: the spiral disk assembly and the spiral tube support assembly.
[0591] An exemplary CCSC process involves a coiled separation column revolving around a central axis of the centrifuge while it synchronously rotates about its own axis (at e.g., 1,000 to 1,200 rpm). A mobile phase can be passed through the centrifuge rotor without rotary seals, and a large amount of a stationary phase is retained while the two phases are mixed along the length of the column to produce a highly efficient solute separation.
Affinity Chromatography Resin
[0592] The present disclosure provides a method of purifying immunoglobulin G (IgG) from the plasma or fraction thereof using an affinity chromatography resin. The affinity resin of the present disclosure comprises a ligand capable of specifically binding to a CH3 domain of human IgG.
[0593] Suitable affinity chromatography resins will be apparent to the skilled person and/or described herein. In one example, the resin comprises a ligand of camelid-derived single domain [VHH] antibody fragments. The skilled person will be aware that ligands based on camelid-derived single domain [VHH] antibody fragments are capable of specifically binding to all subclasses of IgG (IgG1, IgG2, IgG3, IgG4). Exemplary resins are the CaptureSelect FcXP affinity chromatography resins (Thermo Fisher), CaptureSelect FcXL affinity resin (Thermo Fisher), CaptureSelect IgG-CH1 affinity resin (Thermo Fisher), and CaptureSelect FcXP agarose affinity resin (Thermo Fisher). Further exemplary affinity chromatography resins include IgSelect affinity resin (Cytiva), HiTrap IgSelect affinity resin (Cytiva), Pierce Protein G agarose affinity resin (Thermo Fisher), and Protein G sepharose 4 fast flow affinity resin (Cytiva).
[0594] In one example, the affinity chromatography resin comprises a camelid-derived single domain [VHH] antibody fragment and a cross-linked poly(styrene-divinylbenzene) matrix. For example, the affinity chromatography resin is POROS CaptureSelect FcXP affinity resin (Thermo Fisher). The cross-linked poly(styrene-divinylbenzene) matrix allows the resin to withstand pressures of up to 100 bar.
[0595] In one example, the affinity chromatography resin comprises a camelid-derived single domain [VHH] antibody fragment and an agarose-based matrix. For example, the affinity chromatography resin is CaptureSelect FcXP agarose affinity resin (Thermo Fisher).
[0596] In one example, the continuous affinity chromatography process is performed at a pressure in the range of about 2 to about 5 bar. For example, the continuous affinity chromatography process is performed at a pressure in the range of about 3 to about 4 bar. In one example, the continuous affinity chromatography process is performed at a pressure in the range of about 3.25 to about 3.5 bar.
Buffers
[0597] The present disclosure provides a continuous affinity chromatography method using buffers which enable efficient IgG binding to, and collection from, the resin. Generally, plasma or fraction thereof are at a neutral pH (pH of about 7.4). The resin is equilibrated with an equilibration buffer and/or washed with a wash buffer having a buffering range which covers the neutral pH. Suitable wash buffers comprise buffering agents having a dissociation constant (pKa) between 6.8 and 8.5 at 25 C.
[0598] An exemplary buffering agent of the equilibration and/or wash buffer is sodium dihydrogen phosphate, where the phosphoric acid component of sodium dihydrogen phosphate has three dissociation constants (pKa: 2.16, 7.21 and 12.32). Phosphoric acid has a dissociation constant at about the pH of an elution and/or stripping buffer used in the continuous affinity chromatography method. However, phosphoric acid does not have a dissociation constant between the pH of the equilibration and/or wash buffer (higher pH) and the elution and/or stripping buffer (lower pH) used in the continuous affinity chromatography method. This enables a fast switch between wash and elution steps, and stripping and equilibration steps, giving more defined peaks and shorter chromatography phases. An advantage of using such equilibration and/or wash buffers is that smaller buffer volumes can be used, thereby increasing the efficiency of the continuous affinity chromatography method.
[0599] Other suitable buffering agents of the equilibration and/or wash buffer include imidazole (pKa: 7.0), Tris (pKa: 8.30), glycylglycine (pKa: 8.40), MOPS (pKa: 7.2), PIPES (pKa: 6.8), TES (pKa: 7.40), Bicine (pKa: 8.35), HEPES (pKa: 7.55), EPPS (pKa: 8.00), HEPPSO (pKa: 7.85), MOBS (pKa: 7.60), POPSO (pKa: 7.78), TAPSO (pKa: 7.61), Tricine (pKa: 8.05), TEA (pKa: 7.76).
Analysis of IgG Composition
[0600] Methods of determining yield, purity and IgG subclass distribution will be apparent to the skilled person and/or described herein.
[0601] In one example, purity is determined by SDS-PAGE and MALDI-TOF-MS peptide fingerprint analysis. Briefly, purified IgG, an IgG-enriched preparation or IgG-containing pharmaceutical composition described herein is loaded onto a suitable SDS-PAGE gel (e.g. 8-16% TRIS-glycine), along with a protein size marker and a positive control for IgG (e.g. Privigen) under reduced and non-reduced conditions. Proteins are separated based on size and protein bands of interest are isolated, processed and analysed by MALDI-TOF-MS.
[0602] In another example, impurities in the IgG-enriched preparation or IgG-containing pharmaceutical composition described herein are measured in an Enzyme-Linked Immunosorbent Assay (ELISA) using impurity (e.g. IgA) specific antibodies. For example, the ELISA is performed using commercially available methods. In one example, purity, yield and/or subclass distribution of IgG is determined by nephelometry. In one example, purity of IgG is determined by nephelometry. In one example, yield of IgG is determined by nephelometry. In one example, subclass distribution of IgG is determined by nephelometry. For example, the light scattering patterns of purified IgG, an IgG-enriched preparation or IgG-containing pharmaceutical composition described herein is measured by nephelometry and compared to light scattering profiles of compositions with known IgG subclass distributions.
Stability of Plasma and Fractions Thereof
[0603] The stability of the plasma or fraction thereof for loading onto an affinity resin described herein can be determined by assessing the pro-coagulant activity, proteolytic activity and particle size of the plasma or fraction thereof. Methods for assessing pro-coagulant activity, proteolytic activity and particle size will be apparent to a skilled person and/or described herein. Briefly, the plasma or fraction thereof is freeze/thawed in one or more cycles, stored at between 2 C. and 32 C. (e.g. 2 C., 10 C., 18 C., 21 C., 28 C. or 32 C.) for 24 or up to 48 hrs and analysed using one or more of the methods described below. In one example, the plasma or fraction thereof is thawed in one or more cycles at a temperature of 32 C., stored for 24 or up to 48 hours and analysed using one or more of the methods described below. In another example, the plasma or fraction thereof is thawed in one or more cycles at a temperature of 32 C., stored for 24 or up to 48 hours and analysed using one or more of the methods described below and then cooled and stored at a temperature of 21 C. In one example, the plasma or fraction thereof is thawed at a temperature of 32 C. and at a temperature of 21 C. before the continuous affinity chromatography.
[0604] In one example, the pro-coagulant activity in the plasma or fraction thereof can be determined using an in vitro coagulation assay, e.g., activated partial thromboplastin time (NaPTT) assay. The NaPTT assay measures the rate at which one or more coagulation factors (e.g., fibrinogen, prothrombin, proaccelerin, anti-hemophilic factor, Stuart-Prower factor, plasma thromboplastin antecedent and Hegeman factor) are activated or form in plasma, or a fraction thereof, when coagulation activators (e.g. silica, kaolin, ellagic acid) are added to the assay.
[0605] In one example, proteolytic activity in the plasma or fraction thereof can be assessed by measuring the activity of thrombin, general serine proteases, kallikrein, plasmin and FXa e.g. using commercially available kits, such as thrombin activity assay kit (S-2238), general serine protease assay kit (S-2288), kallikrein activity assay kit (S-2302), plasmin activity assay kit (S-2251) and FXa activity kit (S-2765).
[0606] In one example, the size of any particles in the plasma or fraction thereof is assessed by microflow imaging (MFI) and polydispersity index is calculated. Calculation of the polydispersity index will be apparent to the skilled person.
Additional Purification Steps
[0607] Additional purification steps may be performed before or after the continuous chromatography step. In one example, additional purification steps may be performed before the continuous chromatography step. In one example, additional purification steps may be performed after the continuous chromatography step.
[0608] In one example, the method further comprises one or more steps selected from a group consisting of ethanol precipitation, octanoic acid fractionation, ion exchange chromatography, viral inactivation, viral filtration and ultrafiltration/diafiltration. Additional purification steps will be apparent to the skilled person and/or described herein.
[0609] In one example, the method further comprises ethanol precipitation. For example, cold ethanol may be used to isolate and enrich IgG by removing albumin and - and -globulins from the plasma or fractions thereof. For example, as described in WO2011/149472.
[0610] In one example, the method further comprises immunoaffinity chromatography. For example, the method further comprises isoagglutinin affinity chromatography using Eshmuno anti-A and anti-B resin. For example, isoagglutinin affinity chromatography may be used to remove isoagglutinins A and B.
[0611] In one example, the method further comprises octanoic acid fractionation. Octanoic acid may be used to remove of plasma lipids and plasma proteins (other than IgG). For example, as described in WO2011/131787.
[0612] In one example, the method further comprises ion exchange chromatography. In one example, the ion exchange chromatography is anion exchange chromatography. For example, anion exchange chromatography may be used to remove IgA, remaining IgM and other plasma components (other than IgG).
[0613] The anion exchanger can be a resin-based anion exchanger, an anion exchange membrane adsorber, or any other format of anion exchanger with a positively charged substrate for capturing negatively charged particles. In one example, the anion exchanger is an anion exchange membrane adsorber. In another example, the anion exchanger is a resin-based anion exchanger. In a further example, the anion exchanger is a monolithic anion exchanger.
[0614] In one example, the method further comprises anion exchange chromatography using a resin-based anion exchanger. For example, the anion exchange chromatography resin is a strong anion exchanger. In one example, the strong anion exchange resin comprises a matrix consisting of a poly(styrene-divinylbenzene) matrix. In one example, the strong anion exchanger comprises a quaternized polyethyleneimine functional group. Suitable resin-based anion exchanges will be apparent to the skilled person and include, for example, POROS HQ 50.
[0615] In one example, the anion exchange chromatography step is performed in flow through mode. In another example, the anion exchange chromatography step is performed in bind-and-elute mode.
[0616] In one example, the anion exchange chromatography step comprises a buffer selected from the group consisting of sodium citrate, 2-(N-morpholino)ethanesulfonic acid (MES) buffer, sodium dihydrogen phosphate, Bis-Tris, phosphate, L-histidine and combinations thereof. In one example, the anion exchange chromatography step comprises a buffer comprising MES buffer. In another example, the anion exchange chromatography step comprises phosphate buffer.
[0617] In one example, the method further comprises viral inactivation. For example, viral inactivation may be effected by adjusting the solution to low pH. Low pH may be a pH of between 2 to 4. In one example, low pH viral inactivation is performed in the presence of caprylate. In another example, viral inactivation may be effected by contacting the plasma or fraction thereof, or an IgG-enriched preparation or IgG-containing pharmaceutical composition with n-Octyl--D-Glucopyranoside (OG), thereby forming an OG-IgG mixture. In a further example, low pH viral inactivation is performed in the presence of N,N-Dimethylmyristylamine N-oxide (TDAO).
[0618] In a further example, viral inactivation may be effected by exposing the plasma or fraction thereof, or an IgG-enriched preparation or IgG-containing pharmaceutical composition to a solvent-detergent inactivation step. Suitable solvent-detergent treatments would be apparent to the skilled person and include, for example environmentally friendly detergents. Exemplary environmentally friendly detergents suitable for use in the present disclosure and in particular for use in inactivating lipid enveloped viruses include N,N-Dimethylmyristylamine N-oxide (TDAO), polysorbate 80 (PS80), polyoxyethylene (10) isooctylcyclohexyl ether (TRITON X-100-reduced), and a non-ionic surfactant prepared from glucose and alcohol (e.g., Simulsol formulations). In one example, the detergent is N,N-Dimethylmyristylamine N-oxide (TDAO). In one example, the detergent is polysorbate 80. In another example, the detergent is polyoxyethylene (10) isooctylcyclohexyl ether (TRITON X-100-reduced). In a further example, the detergent is a non-ionic surfactant prepared from glucose and alcohol.
[0619] In one example, the OG concentration in the OG-IgG mixture is in the range of 25 mM to 80 mM. For example, the OG concentration in the OG-IgG mixture is in the range of 25 mM to 50 mM, or 50 mM to 80 mM, or 30 mM to 60 mM. For example, OG concentration in the OG-IgG mixture is 25 mM, or 30 mM, or 35 mM, or 40 mM, or 45 mM, or 50 mM, or 55 mM, or 60 mM, or 65 mM, or 70 mM, or 75 mM, or 80 mM.
[0620] In one example, the OG concentration in the OG-IgG mixture is 30 mM.
[0621] In one example, the plasma or fraction thereof, or the IgG-enriched preparation or IgG-containing pharmaceutical composition is contacted with OG for up to 15 minutes. For example, the plasma or fraction thereof, or the IgG-enriched preparation or IgG-containing pharmaceutical composition is contacted with OG for up to 0.5 minutes, or 1 minute, or 1.5 minutes, or 2 minutes, or 2.5 minutes, or 3 minutes, or 3.5 minutes, or 4 minutes, or 4.5 minutes, or 5 minutes, or 5.5 minutes, or 6 minutes, or 6.5 minutes, or 7 minutes, or 7.5 minutes, or 8 minutes, or 8.5 minutes, or 9 minutes, or 9.5 minutes, or 10 minutes, or 10.5 minutes, or 11 minutes, or 11.5 minutes, or 12 minutes, or 12.5 minutes, or 13 minutes, or 13.5 minutes, or 14 minutes, or 14.5 minutes, or 15 minutes.
[0622] In one example, the plasma or fraction thereof, or the IgG-enriched preparation or IgG-containing pharmaceutical composition is contacted with OG at a temperature in the range of from 2 C. to 28 C. For example, the plasma or fraction thereof, or the IgG-enriched preparation or IgG-containing pharmaceutical composition is contacted with OG at a temperature in the range of from 2 C. to 8 C., or 2 C. to 28 C., or 2 C. to 25 C., or 2 C. to 20 C., or 2 C. to 18 C., or 2 C. to 15 C., or 2 C. to 10 C. For example, the plasma or fraction thereof, or the IgG-enriched preparation or IgG-containing pharmaceutical composition is contacted with OG at a temperature of 2 C., or 3 C., or 4 C., or 5 C., or 6 C., or 7 C., or 8 C., or 9 C., or 10 C., or 11 C., or 12 C., or 13 C., or 14 C., 15 C., or 16 C., or 17 C., or 18 C., or 19 C., or 20 C., or 21 C., or 22 C., or 23 C., or 24 C., or 25 C., or 26 C., or 27 C., or 28 C.
[0623] In one example, the plasma or fraction thereof, or the IgG-enriched preparation or IgG-containing pharmaceutical composition is contacted with OG at a temperature of 2 C.
[0624] In one example, the plasma or fraction thereof, or the IgG-enriched preparation or IgG-containing pharmaceutical composition is contacted with OG at a temperature of 8 C.
[0625] In one example, the plasma or fraction thereof, or the IgG-enriched preparation or IgG-containing pharmaceutical composition is contacted with OG at a temperature of 10 C.
[0626] In one example, the plasma or fraction thereof, or the IgG-enriched preparation or IgG-containing pharmaceutical composition is contacted with OG at a temperature of 18 C.
[0627] In one example, the plasma or fraction thereof, or the IgG-enriched preparation or IgG-containing pharmaceutical composition is contacted with OG at a temperature of 28 C.
[0628] In one example, the method further comprises viral filtration. For example, viral filtration membranes of pore sizes from 15-20 nm may be used to remove microbes and viruses from a solution or eluate or pharmaceutical composition. Exemplary nanofilters include Planova S20N (Asahi), Virosart HC (Sartorius) and Planova 20N (Asahi).
[0629] In one example, the method further comprises ultrafiltration/diafiltration. An exemplary ultrafiltration/diafiltration membrane is Pellicon 2 Cassettes (Millipore) or Polyethersulfone or Hydrosart cassettes (Sartorius).
Pharmaceutical Compositions
[0630] Purified IgG of the disclosure (syn. active ingredients) are useful for formulations into a pharmaceutical composition for parenteral, such as intravenous administration or subcutaneous administration, for therapeutic and prophylactic treatment.
[0631] The compositions for administration will commonly comprise a solution of the purified IgG of the disclosure dissolved in a pharmaceutically acceptable carrier, such as an aqueous carrier. A variety of aqueous carriers can be used, e.g., buffered saline and the like. The compositions may contain pharmaceutically acceptable carriers as required to approximate physiological conditions such as pH adjusting and buffering agents, toxicity adjusting agents and the like, for example, sodium acetate, sodium chloride, potassium chloride, calcium chloride, sodium lactate and the like.
[0632] The concentration of the purified IgG of the present disclosure in these formulations can vary widely, and will be selected primarily based on fluid volumes, viscosities, body weight and the like in accordance with the particular mode of administration selected and the patient's needs. The vehicles may contain minor amounts of additives that enhance isotonicity and chemical stability, e.g., buffers and preservatives. For example, the pharmaceutical composition comprises proline as a stabilising agent.
[0633] Suitable pharmaceutical compositions in accordance with the disclosure will generally include an amount of the purified IgG of the present disclosure admixed with an acceptable pharmaceutical carrier, such as a sterile aqueous solution, to give a range of final concentrations, depending on the intended use. The techniques of preparation are generally known in the art as exemplified by Remington's Pharmaceutical Sciences, 16th Ed. Mack Publishing Company, 1980.
[0634] For example, the IgG concentration of the pharmaceutical composition is 1 to 5% w/v, 5 to 15% w/v, or 8 to 12% w/v. For example, the IgG concentration of the pharmaceutical composition is 1%, 2%, 3%, 4%, 5%, or 6%, or 7%, or 8%, or 9%, or 10%, or 11%, or 12%, or 13%, or 14%, or 15% w/v. For intravenous use, 1% w/v (i.e. 10 g IgG/L) may be used. For intravenous use, 10% w/v (i.e. 100 g IgG/L) may be used.
[0635] For subcutaneous administration, a higher concentration may be used. For example, 15 to 35% w/v, or 20 to 30% w/v. In one example, the IgG concentration of the pharmaceutical composition is 16%, or 17%, or 18%, or 19%, or 20%, or 21%, or 22%, or 23%, or 24%, or 25%, or 26% w/v.
Method of Use
[0636] As discussed herein, the present disclosure provides a method of treating, preventing and/or delaying progression of a condition in a subject, comprising administering IgG or a pharmaceutical formulation to the subject.
[0637] In one example, the condition is selected from a group consisting of primary immunodeficiency disease (PI), chronic inflammatory demyelinating polyneuropathy (CIDP), and chronic immune thrombocytopenic purpura (ITP).
EXAMPLES
Example 1: Affinity Resin
[0638] Affinity chromatography resins POROS CaptureSelect FcXP affinity resin (Thermo Fisher) and CaptureSelect FcXP agarose affinity resin (Thermo Fisher) were used to evaluate suitable resins for capturing IgG from plasma or a fraction thereof. Both affinity chromatography resins contain a ligand capable of binding to a CH3 domain of human IgG, specifically camelid-derived single domain [VHH] antibody fragment, and a matrix of either cross-linked poly(styrene-divinylbenzene) or agarose. The affinity chromatography resins were packed in Tricorn columns from Cytiva (diameter 5 mm) and chromatography performed on an kta avant 25 system (Cytiva).
[0639] Cryo-rich plasma (CRP) and cryo-poor plasma (CPP) (prepared by CSL Behring) were warmed to 37 C. and filtered through a 0.22 m bottle-top filter. The affinity chromatography resins were evaluated using chromatography running conditions and buffers provided by Thermo Fischer described in Table 1 below.
TABLE-US-00001 TABLE 1 Affinity Chromatography buffers used to evaluate FcXP resins for the purification of IgG from human CCP and CPP. Chromatography phase Buffer Equilibration 10 mM citric acid buffer, 150 mM sodium chloride, pH 7.4 Column Wash 10 mM citric acid buffer, 150 mM sodium chloride, pH 7.4 Elution 20 mM sodium acetate buffer, pH 4.0 Column stripping 100 mM citric acid buffer, pH 2.0 Eluate neutralization 1M Tris base stock, diluted to 20 mM in final sample
[0640] Purification of IgG from CRP and CPP using POROS CaptureSelect FcXP affinity resin resulted in higher yields of IgG recovered and slightly higher purity of eluent compared to use of CaptureSelect FcXP agarose affinity resin. Based on these initial results, the suitability of POROS CaptureSelect FcXP affinity resin for use in continuous affinity chromatography was further evaluated.
Example 2: Buffer Composition
[0641] A shortcoming of the wash buffer of Table 1 is that the buffering agent citric acid has three dissociation constants (pKa1: 3.13, pKa2: 4.76, pKa3: 6.4) and does not suitably buffer at a pH of 7.4 required for equilibration. Furthermore, the pH shift between washing and elution, and strip and equilibration using buffers comprising citric acid (as provided in Table 1) results in inefficient pH changes and elongated phases during chromatography.
[0642] To determine suitable buffer compositions to enable fast adjustment of pH during continuous affinity chromatography, experiments performed in Example 1 was repeated using POROS CaptureSelect FcXP affinity resin with chromatography buffers of Table 2 used instead of Table 1.
TABLE-US-00002 TABLE 2 Affinity Chromatography buffers used to evaluate POROS CaptureSelect FcXP affinity resin for the of IgG from human CRP and CPP. Chromatography phase Buffer Equilibration 20 mM sodium dihydrogen phosphate buffer, 145 mM sodium chloride, pH 7.4 Column Wash 20 mM sodium dihydrogen phosphate buffer, 145 mM sodium chloride, pH 7.4 Elution 20 mM sodium acetate buffer, pH 4.0 Column stripping 20 mM sodium dihydrogen phosphate buffer, pH 2.5
[0643] Sodium dihydrogen phosphate present in the wash buffer has three dissociation constants (pKa1: 2.16, pKa2: 7.21 and pKa3: 12.32) which covered the pH of 7.4 required for equilibration of the resin. Increasing the buffer concentration of sodium dihydrogen phosphate to 20 mM was found to excluded effects of insufficient buffering during the experiments. However, lower concentrations of sodium dihydrogen phosphate may be used in the wash buffer.
[0644] The results showed that use of sodium dihydrogen phosphate enables fast switching between low pH during elution and stripping and high pH during equilibration and wash giving more defined peaks and shorter phases with the continuous affinity chromatography runs.
[0645] No difference in the binding behaviour of IgG was observed between pH 7.4 and 7.8, allowing the CRP and CPP with pH residing with this range to be applied to the resin without pH adjustment.
Example 3: Bed Height and Flow Rates
[0646] To determine conditions that enable a reduction of loading and non-loading phases, bed heights and flow rates used in the chromatography process was evaluated. Experiments described in Example 2 were repeated at different bed heights of the resin and with different flow rates of the plasma or fraction thereof and elution buffer applied to the resin.
[0647] Bed heights of 20 cm showed significantly higher efficiency of the purification of IgG from the plasma or fraction thereof compared to lower bed heights, enabling short non-loading phases. The reduction of the flow rate to 150 cm/hr (5 minutes contact time) during elution showed no significant effect compared to elution at 2400 cm/h. Surprisingly, it was found that the loading flow rate at which the plasma or fraction thereof is applied to the resin was increased to 2400 cm/hr (0.5 minutes contact time) without significant reduction in IgG binding.
[0648] Optimised conditions for purifying IgG from the plasma or fraction thereof determined by the extensive experimentation is summarised in Table 3 below. The combination of buffer compositions, resin, bed height, and flow rates selected resulted in reduced volume of waste, flow through and product during each of the non-loading phases (i.e. equilibration, wash, elution, strip and re-equilibration).
TABLE-US-00003 TABLE 3 Optimized conditions for purifying IgG from human CRP and CPP using POROS CaptureSelect FcXP affinity resin. Column bed height in a 5 mm diameter column was approximately 20 cm. The contact time was 0.5 min, resulting in a flow rate of up to 2400 cm/hr. Chromatography phase Input Volumes Outlet Equilibration Equilibration buffer 0.5 CV Waste Load Clarified cryo 4.3 CV Flow through poor plasma (c[IgG] = 7 mg/ml) Wash Equilibration buffer 1.5 CV Flow through Wash 2 Elution buffer 0.5 CV Flow through Elution Elution buffer 1.8 CV Product Strip Strip buffer 1.8 CV Waste Re equilibration Equilibration buffer 2.5 CV Waste
[0649] Using columns of 20 cm bed height, the combined volume of the non-loading phases was 8.6 CV while the load volume of the clarified CPP was 4.3 CV. The non-load/load CV ratio was 2, enabling a SMB setup with just three columns. A similar result was observed using a column bed height of approximately 6 cm. The combined volume of the non-loading phases in experiments conducted in columns of approximately 6 cm bed height was 7 CV while the load volume of the clarified CPP was 3.8. The non-load/load CV ratio was 1.8, enabling a SMB setup of just three columns rather than 4 columns. The results demonstrate that irrespective of bed height, reducing the volume of the non-loading phases allows for the use of fewer columns in the purification method.
[0650] Furthermore, IgG was eluted in 1.8 CV giving a concentration factor of 2.4. The cycle time (excluding pump ramp-up and pump washes) was approximately 6.5 minutes.
[0651] Further densification is possible by overlapping elution and strip phases as for wash and elution phases. An increase of the buffer concentration or pH during re-equilibration would further reduce the buffer needed enabling a permanent non-load/load CV ratio below 2, even where the amount of the plasma or fraction thereof loaded is reduced due to resin aging.
Example 4: Eluate Profile
Purity
[0652] To determine the purity qualitatively of the eluate of Examples 2 and 3, SDS-PAGE gel electrophoresis was performed. Samples (8 g and 16 g) of IgG purified from clarified CPP using FcXP resin according to Examples 2 and 3 (FcXP) were run on 8-16% TRIS-glycine SDS-PAGE gel under reduced and non-reduced conditions (
[0653] To determine the impurity profile of the eluate of Examples 2 and 3, MALDI-TOF-MS peptide mass fingerprint were performed. Visible bands (marked by arrows in
TABLE-US-00004 TABLE 4 Impurities present in the eluate eluted from the POROS CaptureSelect FcXP affinity resin identified by MALDI-TOF-MS Bands Impurity A C1r subcomponent B IgM C HSA D C1r subcomponent subunit B E C1q subcomponent subunit C F Apolipoprotein A-1
[0654] SE-HPLC showed that an average monomer and dimer content of IgG in the eluate was 98.1% with 0.9% polymer and 1.0% fragment content.
[0655] To determine the isoelectric point (pI) of impurities in the eluate compared to IgG, 2D Difference Gel Electrophoresis (2D DIGE) was performed. Samples of purified IgG from clarified CPP (FcXP POROS eluate) were loaded with Sci5 and Sci3 dye respectively and loaded onto a 2D-SDS-PAGE. Separation of the samples by isoelectric point was performed between pH 3 and 10, followed by separation by size in the presence of SDS under reducing conditions (
[0656] The results suggest that removal of IgM and albumin from the eluate is possible using an ion exchange polishing step without loss of significant amounts of IgG.
IgG Subclass Distribution
[0657] To determine whether the affinity resin used in purification of IgG affects the subclass distribution of IgG in the eluate of Examples 2 and 3, immunonephelometry was performed. IgG subclass distribution was determined for CRP, CPP, purified IgG from CRP or CPP using POROS CaptureSelect FcXP (
Yield
[0658] Yield was determined using immunonephelometry. At least 95% of IgG was recovered in the eluate from plasma of Examples 2 and 3, which was as high as 96%.
Example 5: Purification Cycling
[0659] To determine the influence of purification cycling on POROS CaptureSelect FcXP affinity resin, multiple purification cycles were performed successively, and binding capacity of the resin was determined. At various points during the multiple purification cycles, the breakthrough behaviour of pure IgG was determined and used to calculate the remaining binding capacity of the resin. Loss of binding capacity may be attributed to aging of the resin.
[0660] CRP or CPP was applied to the resin (bed height of either 6 cm or 20 cm) to allow the plasma to contact the resin for 0.5 minutes for each phase and binding capacity of the resin was determined over time.
Example 6: Stability of Plasma and Fraction Thereof
[0661] The stability of the CRP and CPP for use in a method described herein was assessed. CRP and CPP were freeze thawed up to twice and/or filtered using a 0.22 m filter. The processed CRP and CPP were stored at 10 C., 18 C., or 28 C. for 24 or 48 hrs. IgG content, as well as IgG subclass distribution, of the samples was determined by immunonephelometry. The results of Tables 5 and 6 show that the IgG content and IgG subclass distribution of CRP and CPP were unaffected by filtration, temperature, time and freeze/thawing.
TABLE-US-00005 TABLE 5 IgG content of CRP with and without filtration, freeze/thaw and storage at set times and temperatures. Absolute values Subclass distribution IgG IgG1 IgG2 IgG3 IgG4 Sample (g/L) % % % % Plasma fresh before filtration 5.48 54 32 3 11 Plasma fresh after filtration 5.54 54 32 3 10 Plasma 24 hr 10 C. 5.47 54 32 3 10 Plasma 24 hr 18 C. 5.38 54 32 3 11 Plasma 24 hr 28 C. 5.5 54 32 3 11 Plasma 48 hr 10 C. 5.35 54 32 3 11 Plasma 48 hr 18 C. 5.47 54 32 3 11 Plasma 48 hr 28 C. 5.59 54 32 3 10 Plasma freeze/thaw 1x 5.53 53 33 3 11 Plasma freeze/thaw 2x 5.58 54 33 3 10
TABLE-US-00006 TABLE 6 IgG content of CPP with and without filtration, freeze/thaw and storage at set times and temperatures. Absolute values Subclass distribution IgG IgG1 IgG2 IgG3 IgG4 Sample (g/L) % % % % CPP fresh before filtration 6.42 65 25 4 6 CPP fresh after filtration 6.5 65 25 4 6 CPP 24 hr 10 C. 6.51 65 26 3 6 CPP 24 hr 18 C. 6.64 65 26 3 6 CPP 24 hr 28 C. 6.58 65 25 4 6 CPP 48 hr 10 C. 6.46 65 25 4 6 CPP 48 hr 18 C. 6.46 66 25 4 6 CPP 48 hr 28 C. 6.52 66 25 3 6 CPP freeze/thaw 1x 6.53 66 25 4 6 CPP freeze/thaw 2x 6.59 65 25 4 6
[0662] To determine clotting of proteins in plasma and CPP, pro-coagulant activity was determined using non-activated partial thromboplastin time (NaPTT) assay. The coagulation time was set at >150s in the NaPTT assay. Pro-coagulant activity was observed in plasma and CPP at 28 C. for 24 or 48 hours (
[0663] To determine proteolytic activity in plasma and CPP, the activity of thrombin, general serine proteases, kallikrein, plasmin and FXa was determined using chromogenic substrate assays (thrombin: S-2238; general serine proteases: S-2288; kallikrein: S-2302; plasmin: S-2251; and FXa: S-2765). Proteolytic activity was observed in plasma and CPP at 28 C. for 24 or 48 hours (
[0664] Stability of the CRP and CPP was also assessed by determining changes in particle size within the sample as determined by microflow imaging (MFI) and dynamic light scattering (DLS) and the polydispersity index of the samples were also calculated. Tables 8 and 9 show the samples were broad polydispersed (>0.4). Tables 7 and 8 show that there was no difference in the polydispersity index of samples at 10 C. and 18 C. at 4 hr or 24 hr but a clear increase at 48 hr. The propensity index of plasma was not significantly different over temperatures and time suggesting that plasma samples are more stable over time and temperature compared to CPP.
TABLE-US-00007 TABLE 7 Particle analysis of CPP with and without filtration and storage at set times and temperatures. Time Temperature Polydispersity Sample (hr) ( C.) index CPP before filtration 0 0.8022 CPP after filtration 0 0.5168 CPP 4 10 0.506 CPP 4 18 0.5216 CPP 4 28 0.5673 CPP 24 10 0.5268 CPP 24 18 0.5391 CPP 24 28 0.7055 CPP 48 10 0.8131 CPP 48 18 0.8005 CPP 48 28 0.667
TABLE-US-00008 TABLE 7 Particle analysis of CRP with and without filtration and storage at set times and temperatures. Time Temperature Polydispersity Sample (hr) ( C.) index Plasma before filtration 0 0.5271 Plasma after filtration 0 0.5399 Plasma 4 10 0.4952 Plasma 4 18 0.5407 Plasma 4 28 0.4904 Plasma 24 10 0.5088 Plasma 24 18 0.548 Plasma 24 28 0.6498 Plasma 48 10 0.4935 Plasma 48 18 0.5778 Plasma 48 28 0.5153
[0665] The results show that particle formation occurs within the CRP and CPP with storage at higher temperatures and over longer periods of time. A suitable temperature to store the plasma or fractions thereof can be between 10 C. and 18 C. for up to 48 hrs.
Example 7: Evaluation of Viral Inactivation Using n-Octyl--D-Glucopyranoside
[0666] N-Octyl--D-Glucopyranoside (OG) was evaluated to determine its virus reducing capacity in CRP prior to IgG purification. A thawed and homogenised CRP (50 mg/ml) and EMEM medium (control) was spiked with of Vesicular stomatitis virus (VSV) at 1:20 dilution. Aliquots of VSV spiked CRP and VSV spiked EMEM medium prior to OG addition were collected. OG was added to the VSV spiked CRP and VSV spiked EMEM medium such that the final OG concentration in the mixture was 30 mM, and mixed by pipetting for approximately 10 seconds. The mixture, along with the VSV spiked EDEM medium and VSV-contaminated plasma without OG were incubated at 5 C. Incubated samples were collected at 15, 30 and 60 minute time points. Samples were diluted 10-fold in medium to neutralise the activity of OG.
[0667] Aliquots of 100 L of OG treated VSV spiked CRP, OG treated VSV spiked EDEM medium, VSV spiked CRP, VSV spiked EDEM medium and controls were titrated (ten-fold serial dilutions to 10.sup.6 dilution) onto 150PL pre-cultured suspension of African Green Monkey Kidney Cells (Vero-PH) in standard 96-well microplates (Nunc, flat bottomed wells). Negative controls used were CRP and EDEM medium. Positive controls used were VSV stock used for spiking, and control virus stock with acceptable VSV titers achieved based on previous results from VSV virus stock characterization.
[0668] Plates were incubated at 37 C., 3-5% C02 and examined for virus specific cytopathogenic effect (CPE) using microscopy over 7 days. Cell cultures titrated with the negative controls were required to be free of CPE.
[0669] The infectivity titers were calculated according to the Spearman-Karber method and expressed as log 10 CCID50/mL (50% cell culture infectious dose per mL). If no infectious virus was detected by microtitration e.g. starting from a 1:10 dilution the virus tier is given as <1.5 log 10 CCID50/mL. To lower the detection limit, 1 mL of the 1:10 diluted post-treated Vero-PH cells was inoculated into 4 T25 flasks. When all 4 T25 cultures remain negative for infectious virus, the resulting infectivity titers is recorded as <0.5 log 10 CCID50/mL.
[0670] Robust reduction of VSV was observed where a final OG concentration of 30 mM was present in the OG treated VSV spiked CRP incubated at 5 C. The log 10 reduction factor (LRF) under these conditions (i.e. 30 mM final concentration of OG at 5 C.) was 5.3 (
Example 8: Optimization of Plasma Thawing
[0671] To evaluate the optimum temperature for plasma thawing, the temperature at which cryoprecipitates were observed was determined. Briefly, cryo-rich plasma (CRP) was gradually heated after thawing from 15 C. to 38 C. and at 20 C., 25 C., 28 C., 30 C., 32 C. and 37 C. a fraction of CRP was centrifuged and temperature dependent pellets weighed. At 30 C., only unspecific aggregates and no cryoprecipitate were present.
[0672] To determine the optimum temperature, the activity of von-Willebrand Factor (vWF), one of the main components of cryoprecipitate, was determined in each pellet. As shown in
TABLE-US-00009 TABLE 8 vWF activity assay in CRP pellets at different temperatures Sample (temperature) CBA:vWF (IU/mL) vWF plasma 0.080 SHPL 1.100 +2 C. <0.11 +20 C. 1.098 +20-+37 C. 1.070 +25 C. 1.370 +28 C. 1.455 +30 C. 1.338 +32 C. 1.218 +37 C. 1.385 +37-+60 C. 0.290 (negative ctrl)
[0673] To further confirm plasma thawing at 32 C., a hold time study was performed as set out in
[0674] As shown in Table 9, no proteolytic activity was observed up to 48 hours when the eluate was filtered at 32 C.
TABLE-US-00010 TABLE 9 Proteolytic activity following CRP thawing at 32 C. versus 14 C. NaPTT (Clotting time (seconds) Non- 1:3 1:10 1:100 Sample diluted diluted diluted diluted CRP at 0.5 C. >380 288 282 286 CRP thawed at 37 C., >380 318 298 296 before filtration CRP thawed at 37 C., >380 35 295 297 after filtration CRP thawed at 32 C., >380 327 305 309 before filtration CRP 14 C. filtrate t = 0 >380 309 301 317 CRP 32 C. filtrate t = 0 >380 353 330 331 CRP 32 C. filtrate ->21 C. >380 369 351 350 hold t = 0 CRP 14 C. filtrate t = 24 >380 276 266 267 CRP 32 C. filtrate t = 24 >380 276 264 264 CRP 32 C. filtrate ->21 C. >380 270 261 272 hold t = 24 CRP 14 C. filtrate t = 48 >380 338 292 285 CRP 32 C. filtrate t = 48 >380 255 264 296 CRP 32 C. filtrate ->21 C. >380 307 293 302 hold t = 48
[0675] Samples were also analysed for levels of particulates using dynamic light scattering. No difference in polydispersity index (PDI) was observed between samples with a PDI<0.6 in all samples (data not shown).
[0676] Turbidity was also assessed over time and visible degradation for all temperatures (i.e., 14 C., 21 C. and 32 C.) after 48 hours was observed. At 24 hours no visible degradation was observed at 14 C., compared with most at 32 C. For plasma held at 32 C. a distinct cycle per cycle pressure increase during chromatography was also observed at 48 hours, compared to 14 C. (data not shown).
[0677] Despite visible degradation, no impact on IgG content was observed. In particular, there was no reduction in IgG content over time when samples were thawed and stored at higher temperatures.
Example 9: Optimization of Continuous Affinity Chromatography Method
Removal of Strip Phase
[0678] During the SMB process, an increase in back pressure of single columns was observed due to denaturation of accumulated proteins on the column by the harsh conditions (i.e., pH2.5) during the strip phase. Accordingly, to investigate whether removal of the strip phase reduced the back pressure increase, the SMB process was run without the strip phase.
[0679] As shown in
Increasing Conductivity of Wash Phase
[0680] The conductivity of the wash phase was screened to investigate whether the protease activity in the eluate could be reduced.
[0681] As shown in
Example 10: Anion Exchange Polishing Step
[0682] The use of the POROS-HQ 50 anion exchange resin as a polishing step was evaluated. The resin was operated in flow through mode.
[0683] Initially, the resin was screened using MES and phosphate buffers for impact on impurity depletion.
[0684] FcXP eluate was subjected to UF/DF in 10 mM MES or phosphate buffer pH 6.0, 0 mM NaCl prior to loading on the anion exchange chromatography column. Flow through and post-wash were collected and analysed separately.
[0685] As shown in Table 10, MES buffer and phosphate buffer resulted in acceptable IgG yield, and acceptable impurity depletion.
[0686] Phosphate buffer at pH 6.0 (low conductivity) yielded the best results in terms of development targets of impurity depletion.
TABLE-US-00011 TABLE 10 Buffer screening Depletion Factor (with PW) pH at end of IgG Yield % (Neph) Depletion factor (excluding PW) IgA IgM Albumin equilibration NaCl Without With IgA IgM Albumin (Target (Target (Target Buffer before loading pH (mM) postwash postwash (Neph) (Neph) (Neph) 108) 1153) 541) MES 5.2 6.0 20 86.9 93.4 273 805 117 228 305 90 MES 6.2 6.0 50 87.8 95.2 66 >1498 39 53 >1076 32 MES 6.7 6.6 25 82.1 88.5 360 518 321 252 225 200 MES 6.7 6.6 50 83.8 90.1 84 >1726 66 66 >1208 52 Phosphate 3 6.0 0 78.0 147 >1476 88 Phosphate 4.6 6.0 50 84.1 40 1120 2 Phosphate 6.56 6.6 50 75.5 77 498 2
Example 11: Anion Exchange Polishing Step Equilibration and Load Buffer Optimization Study and Design of Experiments (DoE) Study
Buffer Evaluation Study
Buffers and Conditions Assessed:
TABLE-US-00012 Ionic state of buffer counter ion Buffers Conditions Anionic Sodium citrate pH 6.0, 0 and 50 mM NaCl pH 6.6, 0 and 50 mM NaCl Anionic MES pH 6.0, 0 mM NaCl pH 6.6, 0 mM NaCl Anionic Sodium dihydrogen phosphate pH 6.6, 0 mM NaCl Cationic Bis-Tris pH 6.0, 0 and 50 mM NaCl pH 6.6, 0 and 50 mM NaCl Cationic L-Histidine pH 6.0, 0 and 50 mM NaCl pH 6.6, 0 and 50 mM NaCl
[0687] Samples were loaded according to Example 10 above. Briefly, FcXP eluate was rebuffered and loaded onto Poros HQ5. Flow though and post-wash were collected and analysed separately.
[0688] Citrate buffer depleted IgA well in a broad range of both NaCl and pH. Acceptable IgA depletion was achieved in phosphate at low salt.
[0689] Phosphate buffer depleted IgM well in a broad range of both NaCl and pH.
[0690] Bis-Tris and histidine depleted albumin well in a broad range of both NaCl and pH. Good albumin depletion in phosphate at low salt.
Design of Experiments Phosphate Buffer
The following conditions were assessed:
TABLE-US-00013 Phase length Phase (CV) Composition Equilibration 15 10 mM NaH.sub.2PO.sub.4 + x mM NaCl, pH y Load 5-15 g/L IgG, varied loading Postwash 3 10 mM NaH.sub.2PO.sub.4 + x mM NaCl, pH y Regen. - high salt 5 1M NaCl, 10 mM NaH.sub.2PO.sub.4, pH 6.2 Regen - NaOH 5 0.5M NaOH Regen. - Hac 5 1M HAc Regen. - NaCl, pH 6.2 5 1M NaCl, 100 mM NaH.sub.2PO.sub.4, pH 6.2 x: 0-40 mM y: pH 5.8-6.6
[0691] Preliminary recommendations for equilibration and loading include 0 mM NaCl and pH 6.2, with load material in the pilot scale run having a purity of 93.5% and an impurity concentration of 40.4-71.6 mg/g IgG. In the BioSMB run, the load material had a purity of 97%, an impurity/IgG concentration of 12.0-20.4 mg/g IgG and concentration of 5-15 g/L IgG for best impurity depletion. The load of the resin was 25-42 mg impurities per mL resin.
[0692] Preliminary recommendations for post-wash conditions include 0 mM NaCl and pH 6.0.
Example 12: Anion Exchange Polishing Step
[0693] The MES and phosphate buffers were further screened for impact on impurity depletion in the POROS HQ 50 anion exchange polishing step. The process was performed as described in Example 10 above using MES buffer pH 6.0 with 20 mM or 50 mM NaCl, MES buffer pH 6.6 with 25 mM or 50 mM NaCl, and phosphate buffer pH 6.2 with 0 mM NaCl.
[0694] MES buffer and phosphate buffer resulted in acceptable IgG yield, and acceptable impurity depletion in the flow through (without post wash).
TABLE-US-00014 IgM IgA Albumin Buffer pH NaCl (g/g IgG) (mg/g IgG) (mg/g IgG) MES 6.0 20 mM 5.18 0.05 0.41 50 mM 2.73 0.22 1.26 6.6 25 mM 7.80 0.04 0.15 50 mM 2.32 0.17 0.74 Phosphate 6.2 0 mM 3.07 0.07 0.43
Example 13: Scale-Up of SMB FcXP Chromatography Step
[0695] A 4-column set up in SMB mode with 1 cm inner diameter columns was performed without a resin strip phase and alternate wash phase using the following conditions:
TABLE-US-00015 Phase Flow Residence length rate time Phase Input (CV) (cm/h) (mins) Product Feed/Load 4 642 0.56 loading (clarified plasma pool) Wash Buffer 1 2.75 856 0.42 Pre elution Buffer 2 0.6 856 0.42 Elution Buffer 2 2.2 1286 0.28 Post elution Buffer 1 0.7 1286 0.28 Equilibration Buffer 1 3 1286 0.28 [0696] Buffer 1: 20 mM NaH.sub.2PO.sub.4, 500 mM NaCl, pH 7.4; [0697] Buffer 2: 20 mM acetic acid, pH 4.0
[0698] After each batch, all columns were regenerated using 20% EtOH and 20 mM NaOH and used for processing the next batch.
[0699] The IgG yield in FcXP eluate was 98.3-99.1%, with total IgG recovery in all fractions 99.4-100.3%. Purity of the FcXP eluate was also assessed by Labchip, with product purity being between 96.4-96.9%.
[0700] The purification process resulted in 9.55-10.4 g/L IgG.
[0701] Impurities in the FcXP eluate was determined including IgM (47.85-51.90 mg/L; 4.8-5.3 mg/gm IgG), IgA (68.8-76.55 mg/L; 7-8 mg/gm IgG) and albumin (55.3-78.05 mg/L; 5.8-7.6 mg/gm IgG).
Example 14: Scaled-Up Process Runs Using Cryo-Rich Plasma
[0702] Pooled cryo-rich plasma from 30 donors was thawed and clarified by 1.2 m and 0.45 m+0.2 m filters in series before being used for downstream processing.
[0703] Thawed and filtered plasma was purified and processed according to the following process: [0704] 1. FcXP SMB chromatography [0705] 2. Concentration and buffer exchange via UF/DF [0706] 3. pH shift and filtration [0707] 4. Anion exchange chromatography (using POROS-HQ50) [0708] 5. Isoagglutinin affinity chromatography [0709] 6. Virus inactivation [0710] 7. UF/DF [0711] 8. Formulation to 100 g/L IgG
[0712] Three separate runs were performed with IgG recovery from steps 1-6 being 83-96% and total process recovery between 81-94%.
[0713] The purification process resulted in IgG subclass distribution in the final formulated bulk product of 67-69% IgG1, 24-27% IgG2, 3-4% IgG3 and 2-3% IgG4.
[0714] Purity of the product following isoagglutinin chromatography was also assessed by Labchip, with product purity being between 97-98.5%.
[0715] The POROS 50HQ flow through and post wash was assessed for impurities including IgM (<1.86-<2.55 g/gm IgG), IgA (0.109-0.111 mg/gm IgG) and albumin (0.59-0.74 mg/gm IgG). Yield was also determined as 93-97%.
[0716] The formulated bulk product was also assessed for impurities including IgM (<0.17 mg/L; <1.74-<1.86 g/gm IgG), IgA (8.46-8.76 mg/L; 0.089-0.093 mg/gm IgG) and albumin (62.75-67.60 mg/L; 0.64-0.74 mg/gm IgG). FcXP ligand was <10 ppm (below the limit of detection).
[0717] Isoagglutinin depletion was also assessed after FcXP SMB chromatography (Iso-A titer 1:16; Iso-B titer 1:32), after POROS HQ50 chromatography (Iso-A titer 1:4; Iso-B titer 1:8), and after isoagglutinin chromatography (Iso-A titer 1:0; Iso-B titer 1:0).
TABLE-US-00016 Sequences SEQIDNO:1isanaminoacidsequenceofVHH fragment QVQLQESGGGLVQAGDSLRISCRASGLTVNDLYMGWFRQAPGKEREFV GRVTPGDNTDYTYYVDSVKGRFTISRDSAKNTVYLQMNSLKLEDTAVY LCAGRRFGSSEWDYWGQGTQVTVSS SEQIDNO:2isanaminoacidsequenceofCDR1 oftheVHHfragment GLTVNDLYMG SEQIDNO:3isanaminoacidsequenceofCDR2 oftheVHHfragment RVTPGDNTDYTYYVDSVK SEQIDNO:4isanaminoacidsequenceofthe VHHfragment RRFGSSEWDY