Polytherapy Modulating Cathelicidin Gene Expression Modulation for The Treatment of Alzheimer's Disease and Other Conditions
20230063416 · 2023-03-02
Assignee
- Maxwell Biosciences, Inc. (Austin, TX, US)
- The Board Of Trustees Of The Leland Stanford Junior University (Stanford, CA)
Inventors
- Annelise E. Barron (Woodside, CA, US)
- Andrew K. Evans (La Honda, CA, US)
- Jennifer S. Lin (Mountain View, CA, US)
- Joshua McClure (Westlake Hills, TX, US)
- Mehrdad Shamloo (Palo Alto, CA)
Cpc classification
A61P25/28
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
A61K36/889
HUMAN NECESSITIES
A61K31/192
HUMAN NECESSITIES
A61K31/20
HUMAN NECESSITIES
A61K31/593
HUMAN NECESSITIES
International classification
A61K31/192
HUMAN NECESSITIES
A61K31/593
HUMAN NECESSITIES
A61K36/889
HUMAN NECESSITIES
A61K31/20
HUMAN NECESSITIES
Abstract
A polytherapy of orally available compounds is disclosed that synergistically modulates and induces the expression of the cathelicidin gene (CAMP), which encodes the host defense peptide LL-37. By providing a number of different CAMP-inducing compounds together at the same time, stronger gene induction is achieved than with just one or two compounds, because the mechanism of induction broadens. Induction also may vary in different pas of the body depending on which compounds are used, and at what levels. We show for the first time that the polytherapy can induce cathelicidin expression in the brain, which may help to treat or prevent Alzheimer's Disease Systemic cathelicidin gene induction may help treat numerous other conditions including Type 2 Diabetes/Metabolic Syndrome, or chronic bacterial, viral, or fungal infections associated with increased cancer risk or neurodegeneration. By increasing cellular autophagy and macroautophagy and supporting mitochondrial biogenesis and homeostasis, CAMP gene upregulation may reduce the effects of cellular aging and increase longevity.
Claims
1. A method for treating an individual, comprising: administering a pharmaceutically acceptable composition to an individual, wherein the pharmaceutically acceptable composition upregulates cathelicidin antimicrobial peptide (CAMP) gene expression in the individual.
2. The method of claim 1, wherein the CAMP gene expresses a cathelicidin LL-37 peptide.
3. The method of claim 2, further comprising monitoring levels of the cathelicidin LL-37 peptide in the individual.
4. The method of claim 3, further comprising monitoring levels of β-amyloid in the individual.
5. The method of claim 4, further comprising administering a larger dose of the pharmaceutically acceptable composition to the individual, when the L/B<k is detected, where L is a level of cathelicidin LL-37 peptide detected, B is a level of β-amyloid detected, and k is a predetermined threshold value.
6. The method of claim 5, wherein k is 1.
7. The method of claim 1, wherein the individual suffers from Alzheimer's disease.
8. The method of claim 7, wherein the CAMP gene expression occurs in a brain of an individual.
9. The method of claim 8, wherein the CAMP gene expresses a cathelicidin LL-37 peptide and the cathelicidin LL-37 peptide causes a reduction in β-amyloid fibrils in the individual.
10. The method of claim 1, wherein the pharmaceutically acceptable composition comprises a mixture of at least four materials selected from the group consisting of phenylbutyrate, bexarotene, curcumin, resveratrol, retinal, cholecalciferol, fatty acids, and pharmaceutically acceptable salts thereof.
11. The method of claim 1, wherein the pharmaceutically acceptable composition comprises a mixture of at least four materials selected from the group consisting of phenyl butyrate, bexarotene, curcumin, resveratrol, retinal, cholecalciferol, docosahexaenoic acid, caprylic acid, capric acid, lauric acid, and pharmaceutically acceptable salts thereof.
12. The method of claim 1, wherein the pharmaceutically acceptable composition comprises a mixture of at least three materials selected from the group consisting of phenyl butyrate, bexarotene, curcumin, resveratrol, retinal, cholecalciferol, and pharmaceutically acceptable salts thereof.
13. The method of claim 12, wherein the pharmaceutically acceptable composition comprises a mixture of at least five materials selected from the group consisting of phenyl butyrate, bexarotene, curcumin, resveratrol, retinol, cholecalciferol, fatty acids, and pharmaceutically acceptable salts thereof.
14. The method of claim 12, wherein said mixture is dissolved in a hydrophobic liquid medium.
15. The method of claim 1, further comprising diagnosing the individual for Alzheimer's disease.
16. The method of claim 1, further comprising detecting a presence of β-amyloid aggregate accumulation in the individual, wherein β-amyloid aggregate accumulation comprises at least one structure selected from the group consisting of oligomers, fibrils, and plaques.
17. The method of claim 1, further comprising monitoring a level of a cytokine in the microglia tissues of the individual.
18. The method of claim 17, wherein the cytokine is selected from IL-6, IL-8, IL-1α, and TNFα.
19. The method of claim 17, wherein the CAMP gene expresses a cathelicidin LL-37 peptide, wherein the cathelicidin LL-37 peptide complexes with a β-amyloid in the individual.
20. The method of claim 19, wherein the cathelicidin LL-37 peptide-β-amyloid complexation reduces the level of the cytokine.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0056]
[0057]
[0058]
[0059]
[0060]
[0061]
[0062]
[0063]
[0064]
[0065]
[0066]
[0067]
[0068]
[0069]
[0070]
DETAILED DESCRIPTION
[0071] It will be appreciated from the literature review and discussion presented in the Background Section that the protein product of the CAMP gene, the innate immune effector LL-37, has been studied extensively in the context of infectious disease. LL-37 has also been studied, to a lesser degree, in the context of wound healing, angiogenesis and stem cells, and cancer. However, it has now been discovered that a direct relation exists between LL-37 and Alzheimer's Disease. See [REF: Evidence that the Human Innate Immune Peptide LL-37 may be a Binding Partner of Amyloid-β and Inhibitor of Fibril Assembly De Lorenzi E, Chiari M, Colombo R, Cretich M, Sola L, Vanna R, Gagni P, Bisceglia F, Morasso C, Lin J S, Lee M, McGeer P L, Barron A E. J Alzheimers Dis. 2017; 59(4):1213-1226. Pubmed ID PMID 28731438], which is incorporated by reference in its entirety. This surprising discovery has not been appreciated in the relevant art, and led to the further discovery by the present inventors that Alzheimer's Disease may be treated by inducing expression of the CAMP gene encoding the LL-37 peptide. This discovery is a key technical foundation of the methodologies disclosed herein.
Cathelicidin LL-37 in the Context of Alzheimer's Disease.
[0072] Alzheimer's Disease is a terminal diagnosis suffered by over 42 million patients globally, with no effective therapy or treatment. The handful of drugs currently prescribed to Alzheimer's patients at best ameliorate symptoms (‘disease-modifying’ as opposed to ‘disease-curative’ treatments). Most ‘symptomatic therapies’ currently available are neurotransmitter-focused, and fall into two classes: cholinesterase inhibitors, and the NMDA (glutamatergic) receptor agonist memantine. There are no FDA-approved drugs that address the underlying causes of Alzheimer's disease, which remain poorly understood despite 110 years of research. [REF: Alzheimer's Disease: Lessons Learned from Amyloidocentric Clinical Trials. Soejitno A, Tjan A, Purwata T E, CNS Drugs. 2015 June; 29(6):487-502. PMID: 26187557] Alzheimer's disease risk is known to correlate with the risks of several other chronic diseases, in particular metabolic syndrome/type 2 diabetes and cardiovascular disease. However, these connections are understudied, given the complexity of studying such associations. In practice, pharmaceutical drug development is typically undertaken for only one chronic disease target at a time, although some FDA-approved drugs are repurposed for other conditions.
[0073] As of 2018, it has been 14 years since a new drug for Alzheimer's disease was approved by FDA. The majority of the more than 400+ failed clinical trials pursued strategies to reduce the distinct, observable pathophysiological protein signatures of Alzheimer's disease. These protein signatures include Aβ amyloid plaque accumulation in the brain, which is primarily extracellular (outside of neurons), and (much less commonly) phosphorylated tau protein aggregates, which form ‘neurofibrillary tangles’ within neuronal cells. Clinical trials aimed at reducing the burden of Aβ and tau aggregate protein deposits have so far failed to improve patient cognition and function, as was required by the FDA for drug approval (until recently, when FDA relaxed these criteria somewhat) [REF: Prevention of sporadic Alzheimer's disease: lessons learned from clinical trials and future directions. Andrieu S, Coley N, Lovestone S, Aisen P S, Vellas B Lancet Neurol. 2015 September: 14(9):926-944. PMID: 26213339].
[0074] Within the aging human brain, Alzheimer's disease (AD) involves the assembly of β-amyloid (Aβ) peptides from soluble monomers into oligomers, fibrils and plaques [REF: Alzheimer mechanisms and therapeutic strategies. Huang Y, Mucke L. Cell. 2012 Mar. 16; 148(6):1204-22. Review. Pubmed ID PMID: 22424230]. Studies of the spatiotemporal interplay between diffusible Aβ oligomers and fibrillar deposits, as well as intracellular tau tangles, have been aimed at investigating drivers of neuronal dysfunction, which are still not well understood [REF: Alzheimer's and Parkinson's diseases. The prion concept in relation to assembled Aβ, tau, and α-synuclein. Goedert M. Science. 2015 Aug. 7; 349(6248):1255555. Pubmed PMID 26250687] and [REF: Alzheimer's Disease: Lessons Learned from Amyloidocentric Clinical Trials. Soejitno A, Tjan A, Purwata T E. CNS Drugs. 2015 June; 29(6):487-502. doi: 10.1007/s40263-015-0257-8. Pubmed ID PMID 26187557] The root physiological causes of sporadic (i.e., spontaneously arising) Alzheimer's Disease—i.e., instances of disease in patients for whom there is no known genetic predisposition, which is the most common type of AD-remain unspecified, preventing the development of effective therapies to prevent, halt, or reverse the disease [REP: Prevention of sporadic Alzheimer's disease: lessons learned from clinical trials and future directions. Andrieu S, Coley N, Lovestone S, Aisen P S, Vellas B. Lancet Neurol. 2015 September; 14(9):926-944. Pubmed ID PMID 26213339].
[0075] Identification of physiologically relevant binding partners of Aβ that modulate fibril formation in vivo may yield new insights into causes of AD and help identify early instigators of Aβ accumulation and neurotoxic effects. A number of natural proteins that can bind to, or interact with, Aβ have been identified by various assays [REF: Molecules that target beta-amyloid. Stains C I, Mondal K, Ghosh I, ChemMedChem. 2007 December; 2(12):1474-92 Review. Pubmed ID PMID: 17952881]. However, their roles in sporadic AD are often challenging to assess.
[0076] Literature reports exist which might arguably be interpreted to suggest, in an indirect, “connect-the-dots” fashion, that the biophysical activities and signaling functions of Aβ peptides and LL-37 (the only cathelicidin-derived innate immune system peptide found in humans) are related in vivo. For instance, the vitamin D receptor (VDR) and retinoid X receptor (RXR) am both connected with AD, as well as with expression levels of LL-37. Vitamin D3 treatment was shown to reduce cerebral amyloid-β accumulation and to improve cognition in a mouse model of AD, although the mechanism of action was not stated [REF: 1α,25-Dihydroxyvitamin D3 reduces cerebral amyloid-β accumulation and improves cognition in mouse models of Alzheimer's disease. Durk M R, Han K, Chow E C, Ahrens R, Henderson J T, Fraser P E, Pang K S, J Neurosci. 2014 May 21; 34(21).7091-101 doi. 10.1523/JNEUROSCI.2711-13.2014. Pubmed ID PMID 24849345], while RXR activation reduced neuronal loss and improved cognition in an aggressive mouse model of AD (but again, with no mention of cathelicidin involvement) [REF: Neuronally directed effects of RXR activation in a mouse model of Alzheimer's disease. Mariani M M, Malm T, Lamb R, Jay T R, Neilson L, Casali B, Medarametla L, Landreth G E. Sci Rep. 2017 Feb. 16; 7:42270. Pubmed ID PMID 28205585]. The above AD papers do not mention that expression levels of the human CAMP gene that encodes hCAP-18 (the protein precursor for LL-37) are upregulated by activation of VDR. [REF: The chemistry and biology of LL-37. Burton M F, Steel P G. Nat Prod Rep. 2009 December; 26(12).1572-44. Review. PMID 19936387] and [REF: Human cathelicidin antimicrobial peptide (CAMP) gene is a direct target of the vitamin D receptor and is strongly up-regulated in myeloid cells by 1,25-dihydroxyvitamin D3 Gombart A F, Borregaard N, Koeffler H P. FASEB J. 2005 July; 19(9):1167-77. Pubmed ID PMID 15985530] These references also do not mention that RXR activation is an obligate part of CAMP gene expression, although this has been shown. [REF: Label-free quantitative mass spectrometry reveals novel pathways involved in LL-37 expression. Cederlund A, Nylén F, Miraglia E, Bergman P, Gudmundsson G H, Agerberth B. J Innate Immun. 2014; 6(3):365-76. Pubmed ID PMID 24246949] and [REF: Cell Tissue Res. 2016 November; 366(2):353-362. Vitamin D-induced up-regulation of human keratinocyte cathelicidin anti-microbial peptide expression involves retinoid X receptor α. Svensson D, Nebel D, Voss U, Ekblad E, Nilsson B O. Pubmed ID PMID 27357804]
[0077] Another indirect connection between Alzheimer's Disease mechanism and cathelicidin LL-37 is the hypothesis that sporadic AD is essentially ‘Type 3 Diabetes’ occurring in brain tissue [REF: Type 3 diabetes is sporadic Alzheimers disease: mini-review, de la Monte S M. Eur Neuropsychopharmacol. 2014 December; 24(12):194-60. Pubmed ID PMID 25088942] and [REF: Alzheimer's disease is type 3 diabetes-evidence reviewed. de la Monte S M, Wands J R. J Diabetes Sci Technol. 2008 November; 2(6):1101-13. Pubmed ID PMID 19885299]. In a 2015 study, it was shown that intraperitoneal administration of the murine cathelicidin peptide, CRAMP (which, like LL-37 for humans, is unique in the mouse proteome) protects Non-Obese Diabetic (NOD) mice against the development of autoimmune diabetes. [REF: Pancreatic β-Cells Limit Autoimmune Diabetes via an Immunoregulatory Antimicrobial Peptide Expressed under the Influence of the Gut Microbiota. Sun J, Furio L, Mecheri R, van der Does A M, Lundeberg E, Saveanu L, Chen Y, van Endert P, Agerberth B, Diana J. Immunity. 2015 Aug. 18; 43(2):304-17. Pubmed ID PMID 26253786] This treatment was motivated by the authors' discovery that the genetic defect of NOD mice that creates susceptibility to autoimmune diabetes is a deficit in their ability to express cathelicidin. This defect is more pronounced in female NOD mice, who have a higher incidence of disease as compared with males. In this animal model, immunomodulatory effects of the cathelicidin peptide, including effects on the phenotypes of white blood cells including macrophages, dendritic cells, T and B cells, reduced risks of inflammatory disease [REF: Pancreatic β-Cells Limit Autoimmune Diabetes via an immunoregulatory Antimicrobial Peptide Expressed under the influence of the Gut Microbiota Sun J, Furio L, Mecheri R, van der Does A M, Lundeberg E, Saveanu L, Chen Y, van Endert P, Agerberth B, Diana J. Immunity. 2015 Aug. 18; 43(2):304-17. Pubmed ID PMID 26253786]. What this shows is that, in vivo, the cathelicidin peptide is strongly immunomodulatory of white blood cell phenotypes. Thus, macrophages, dendritic cells, T cells, and B cells, were all switched from a proinflammatory, diabetogenic phenotype by the injection of cathelicidin peptide, to a noninflammatory, healing phenotype that prevented the development of autoimmune diabetes.
[0078] To date, most approaches to AD have relied on the supposition that pathological overexpression or hindered degradation of Aβ lays the primary foundation for disease. [REF: Alzheimer mechanisms and therapeutic strategies. Huang V, Mucke L. Cell. 212 Mar. 16; 148(6).1204-22 Review. Pubmed ID PMID: 22424230]. Recently, it has been shown that the chronic under-expression of the cathelicidin LL-37, which normally opposes Aβ fibril formation, likely plays a key role in the pathological accumulation of Aβ, as will be discussed below [REF: Evidence that the Human Innate Immune Peptide LL-37 may be a Binding Partner of Amyloid-β and Inhibitor of Fibril Assembly. De Lorenzi E, Chiari M, Colombo R, Cretich M, Sola L, Vanna R, Gagni P, Bisceglia F, Morass C, Lin J S, Lee M, McGeer P L, Barron A E. J Alzheimers Dis. 2017; 59(4).1213-1226. Pubmed ID PMID 29731438]. It is, of course, difficult for researchers to identify a systemic element that should be present, or perhaps should be better regulated, but is not. This may explain why the central and important role of LL-37 under-expression in Alzheimer's Disease was not discovered prior to 2017.
[0079] Recently, a multifaceted approach was taken to confirm and characterize, in vitro, the interactions between Aβ and LL-37, and inhibitory effects of LL-37 on Aβ oligomer/fibril formation. It was demonstrated that LL-37 and Aβ42 (residues 1-42 of the Aβ peptide), which am both individually toxic and proinflammatory to neuroblastoma cell line SH-SY5Y via the stimulation of microglial production of inflammatory cytokines, lose most of their cytotoxicity to neurons if the two peptides are co-incubated prior to being added to the cell culture media.
[0080] The interactions between LL-37 and Aβ peptides were investigated by SPR imaging (SPRi), a recent evolution of traditional SPR, which couples the label-free monitoring of molecular interactions by scanning angle SPR measurements with simultaneous CCD-based imaging of the whole surface for signal detection [REF: Surface plasmon resonance imaging for affinity-based biosensors. Scarano S, Mascini M, Turner A P, Minunni M. Biosens Bioelectron. 2010 Jan. 1; 25(5):957-66. Pubmed ID PMID 19765967]. The multi-array SPRi configuration improves the overall accuracy of the study by allowing simultaneous detection of signals originating from both positive and negative control ligands immobilized on the same chip. In addition, the real-time imaging of the entire SPR-biochip allows for verification of the quality and the optical properties of different ligands after their immobilization on the chip surface. To evaluate the aggregation state and the presence of soluble oligomers in the AP samples used for SPRi, capillary electrophoresis (CE) analysis was carried out. The inhibitory effect on fibril formation was demonstrated through transmission electron microscopy (TEM) by investigating fibril formation in quasi-physiological conditions. Conformational analyses of Aβ42 peptide in solution, in the absence and presence of LL-37, were cared out by circular dichroism (CD) spectroscopy.
[0081] In this work [REF: Evidence that the Human Innate Immune Peptide LL-37 may be a Binding Partner of Amyloid-β and Inhibitor of Fibril Assembly. De Lorenzi E, Chai M, Colombo R, Cretich M, Sola L, Vanna R, Gagni P, Bisceglia F, Morasso C, Lin J S, Lee M, McGeer P L, Barron A E. J Alzheimers Dis 2017; 59(4):1213-1226. Pubmed ID PMID 28731438], it was demonstrated that Aβ and LL-37 bind to each other specifically, and that LL-37 inhibits the adoption by Aβ of ordered β-type secondary structures. Additionally, a variety of different published findings were discussed that indicate a physiological interplay between (and potential co-regulation of) these two peptides as an aspect of human innate immunity that may affect the initiation and progression of Alzheimer's Disease-related pathology.
Materials and Methodologies
[0082] The methodologies disclosed herein may be further appreciated with respect to the following non-limiting examples. The following materials and methodologies were utilized in the examples provided herein.
Sourcing Peptides and Buffer Chemicals; Materials and Methods for Sample Preparation
[0083] Aβ40, Aβ42 free base peptides and 1% NH4OH can be purchased from AnaSpec (Fremont Calif., USA). LL-37 was from Innovagen (Lund, Sweden). An unrelated peptide to serve as a binding study control (sequence SYSVQDQYQALLQQHAQYK) was kindly gifted by Dr. Alessandro Gori from the Peptide Synthesis Lab, ICRM, CNR, Milan. “Scrambled sequence” LL-37 peptide was from AnaSpec, and has the same amino acid composition as natural LL-37, but with the following sequence: GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR. 1,1,1,3,3,3-Hexafluoro-2-propanol (HFIP), acetonitrile, sodium carbonate, sodium hydroxide as well as NaH2PO4 and Na2HPO4 were from Sigma-Aldrich (Stenheim, Germany). Buffer solutions were prepared daily using Millipore Direct-Q™-deionized water, filtered with 0.45 μm Millipore membrane filters (Bedford, Mass., USA) and degassed by sonication.
Samples and Methods Used for SPRi and CE Experiments
[0084] In SPRi and CE experiments, 1 mg/mL stock solutions of Aβ40 and unrelated peptide or scrambled-sequence LL-37 in PBS were diluted to the desired concentration. Aβ42 was prepared as described by Bartolini et al. [REF: Kinetic characterization of amyloid-beta 1-42 aggregation with a multimethodological approach. Bartolini M, Naldi M, Fiori J. Valle F, Biscarini F, Nicolau D V, Andrisano V. Anal Biochem. 2011 Jul. 15; 414(2):215-25. Pubmed ID PMID 21435333]. Briefly, 0.5 mg of lyophilized Aβ42 powder was dissolved in HFIP (149 μM) and kept overnight at room temperature. After 12 hours, the solution was aliquoted and the HFIP was left to evaporate overnight at room temperature. The Aβ42 film was redissolved in CH3CN/300 μM Na2CO3/250 mM NaOH (48.3:48.3:3.4, v/v/v). The obtained 500 μM Aβ42 solution was diluted to the desired concentration with 20 mM phosphate buffer, pH 7.4 (SPRi: 20 μM; CE: 100 μM).
Methods for TEM and CE Analysis
[0085] For TEM and CD analysis, the samples were prepared as described in Brogi et al. [REF: Disease-modifying anti-Alzheimer's drugs: inhibitors of human cholinesterases interfering with β-amyloid aggregation. Brogi S, Butini S, Maramai S, Colombo R, Verga L, Lanni C, De Lorenzi E, Lamponi S, Andreassi M, Bartolini M, Andrisano V, Novellino E, Campiani G, Brindisi M, Gemma S. CNS Neurosci Ther. 2014 July, 20(7):624-32. Pubmed ID PMID 24935788], and analyzed at 50 and/or 100 μM concentrations. Briefly, to 1 mg lyophilized Aβ42 powder (AnaSpec) 80 L of 1% NH.sub.4OH solution was added. After 1 minute sonication, the solution was diluted with 20 mM phosphate buffer, pH 7.4, to the desired concentration, and divided into aliquots, which were freeze-dried and stored at −80° C. Each lyophilized peptide aliquot was resuspended in 20 mM phosphate buffer, pH 7.4 immediately before use. Samples were sonicated 3 min in an ultrasonic bath, to break down pre-formed aggregates and increase the peptide's effective concentration [REF: Sonication of proteins causes formation of aggregates that resemble amyloid. Stathopulos P B, Scholz G A, Hwang Y M, Rumfeldt J A, Lepock J R, Meiering E M, Protein Sci. 2004 November; 13(11):3017-27. Pubmed ID PMID 15459333]. For samples incubated with LL-37, lyophilized peptide was re-suspended in appropriately diluted LL-37 solutions, so as to keep the peptides at the desired molar concentrations and obtain proper Aβ42/LL-37 molar ratios. Samples were analyzed either immediately after solubilization, or after different lengths of incubation time, as noted in FIG. legends.
Methods for Surface Plasmon Resonance Imaging (SPRi) Experiments with LL-37 and Aβ
[0086] Bare gold SPRi-biochips (HORIBA Jobin Yvon SAS, France) were treated for 10 minutes with an Oxygen Plasma Generator (Harrick Plasma Cleaner), then coated using a solution of co-poly(DMA-NAS-MAPS) (MCP-2, Lucidant Polymers, Sunnyvale, Calif., USA) via surface immersion for 30 min (MCP-2 copolymer was dissolved at 1% w/v in aqueous 20% ammonium-sulfate). Coated SPRi-biochips were then washed with distilled water and dried at 80° C. for 15 minutes. Residual reactive groups were then reacted with 50 mM ethanolamine/0.1M Tris pH 9.0 for 1 hour, washed with water, and dried with nitrogen.
[0087] The SPRi-biochip surface coated with the copolymer was functionalized by spotting the following 20 μM solutions: 1) Aβ40 (t=0 days); 2) Aβ42 (t=0 days); 3) Aβ42 (t=24 days, i.e. spotted after 24 days of incubation at room temperature) and 4) an unrelated peptide used as reference. These peptides were spotted in replicate (8 spots, around 190 μm diameter each) using a piezoelectric spotter (SciFLEXARAYER S5; Scienion) at 20° C. and 50% humidity. After spotting, the SPRi-biochip was incubated overnight in a sealed chamber saturated with sodium chloride at room temperature.
[0088] The binding analysis was performed using a Horiba XelPeX SPRi imaging instrumentation (HORIBA Jobin Yvon SAS, France) after an overnight instrument equilibration with HBS-T (10 mM HEPES, 150 mM NaCl, 0.05% Tween) used also as running buffer. Thereafter increasing concentrations of LL-37 peptide solution (1.0, 2.5, 5.0, 10, 25, 50, 100 μM in phosphate buffer 20 mM, pH 7.4) were injected onto the chip at 50 μL/min for 10 minutes, at 25° C., in order to reach a binding equilibrium for all the responses. Ovalbumin (Sigma-Aldrich, A5503) was used as the negative control sample. After each injection, the chip surface was regenerated by injecting 50 mM glycine at pH 2.0, 50 μL/min for 4 minutes, thus obtaining a complete regeneration of the chip surface without significant loss of binding capacity. The results were preprocessed using EzSuite (HORIBA Jobin Yvon SAS, France), then equilibrium-binding constants (KD and KA (1/KD) values were calculated using Scrubbergen2 (licensed by HORIBA Jobin Yvon SAS). Additional binding analysis experiments were performed using the same procedures and conditions, but by injecting a control scrambled-sequence LL-37 peptide.
Methods for Capillary Electrophoresis (CE) Analysis of A/β Peptides
[0089] All CE experiments were carried out by slightly modifying the method reported by Brogi et al. [REF: Disease-modifying anti-Alzheimer's drugs: inhibitors of human cholinesterases interfering with β-amyloid aggregation. Brogi S, Butini S, Maramai S, Colombo R, Verga L, Lanni C, De Lorenzi E, Lamponi S, Andreassi M, Bartolini M, Andrisano V, Novellino E, Campiani G, Brindisi M, Gemma S. CNS Neurosci Ther. 2014 July; 20(7):624-32. Pubmed ID PMID 24935788). Briefly, an Agilent Technologies 3D CE system with built-in diode-array detector (Waldbronn, Germany) was used and data were collected using Chemstation A.10.02 software. The fused-silica capillary (50 μm id, 360 μm od, total length 33 cm, effective length 24.5 cm) was from Polymicro Technologies (Phoenix, Ariz., USA). A new capillary was flushed at 1 bar with l M NaOH and water for 60 min each and background electrolyte (BGE, 80 mM sodium phosphate buffer, pH 7.4) for 90 min. The between-run rinsing cycle consisted of 50 mM SDS (1.5 min), water (1.5 min) and BGE (2 min). Sample injection (100 μM) was carried out by applying a pressure of 30 mbar for 3 s. Separations were carried out at 25° C. and +12 kV (current 75-80 μA). The acquisition wavelength was 200 nm.
Methods for Transmission Electron Microscopy (TEM) Analysis of Aβ and LL-37 Peptides
[0090] For each TEM sample, a 10-μL droplet of suspension or solution was applied to a carbon-coated Formvar nickel grid (200 mesh) (Electron Microscopy Sciences, Washington, Pa. USA). Each sample was allowed to sediment onto the carbon film for 15 min, then negative staining was performed with 10 μL of 2% w/v uranyl acetate solution (Electron Microscopy Sciences). After carefully draining off excess staining solution using filter paper, the specimen was transferred to a Philips CM12 transmission electron microscope for examination, operating the TEM at 80 kV. Electron micrographs of negatively stained samples were photographed using Kodak film.
Methods for Circular Dichroism Analysis of Aβ and LL-37 Peptides
[0091] CD spectra were collected at 20° C. using a Jasco-810 spectrophotometer and a quartz cuvette with a 0.1 cm path length. All experiments were performed with an Aβ42 concentration of 50 μM. Spectra were registered from 190 to 250 nm and run at a scan speed of 20 nm/min, with a time response of 2 sec and data pitch of 0.2 nm. All spectra were baseline-corrected. Molar mean residue ellipticity [θ] is expressed in degrees cm2 dmol-1, and calculated as [ν]θobs MWR/(101c) where θ is observed ellipticity in degrees; MWR, peptide mean residue molar weight; 1, the optical path length in cm, and c, peptide concentration in g/mL.
Methods of Neuronal Cell Culture for Testing Effects of Aβ and LL-37 Peptides
[0092] Cells from the human neuroblastoma SH-SY5Y cell line were grown in DMEM/F12 medium containing 10 fetal bovine serum (FBS, Invitrogen, Carlsbad, Calif.) and 100 IU/mL penicillin and 100 g/mL streptomycin (Invitrogen, Carlsbad, Calif.) under humidified 5% CO.sub.2 and 95% air.
[0093] Human microglial cells were isolated from surgically resected temporal lobe tissue as described in Lee et al. [REF: Depletion of GSH in glial cells induces neurotoxicity: relevance to aging and degenerative neurological diseases. Lee M, Cho T, Jantaratnotai N, Wang Y T, McGeer E, McGeer P L. FASEB J. 2010 July; 24(7):2533-45. Pubmed ID PMID 20228251]. Briefly, tissues were rinsed with a PBS solution and chopped into small pieces (<2 mm.sup.3) with a sterile scalpel. They were treated with 10 mL of a 0.25% trypsin solution at 37° C. for 20 min. Subsequently DNase I (from bovine pancreas, Pharmacia Biotech, Baie d'Urfé, PQ, Canada) was added to reach a final concentration of 50 μg/mL. Tissues were incubated for an additional 10 min at 37° C. After centrifugation a 275 g for 10 min, the cell pellet was resuspended in the serum-containing medium and passed through a 100 μm nylon cell strainer (Becton Dickinson. Franklin Lakes. N.J.). The cell suspension was centrifuged again (275 g for 10 min) and re-suspended in 10 mL of DMEM/F12 medium with 10% FBS containing gentamicin (50 μg/mL), and plated onto tissue culture plates (Becton Dickinson) in a humidified 5% CO.sub.2,95% air atmosphere at 37° C. for 2 h. This achieved adherence of microglial cells. Cells were allowed to grow by replacing the medium once per week.
[0094] For estimating the purity of microglial cell cultures, aliquots of the cultures were placed on glass slides at 37° C. for 48 h. The attached cells were then fixed with 4% paraformaldehyde for 1 h at 4° C., and made permeable with 0.1% Triton X-100 for 1 h at room temperature. After washing twice with PBS, the culture slides were treated with the monoclonal anti-GFAP antibody ( 1/4,000, DAKO) for astrocytic staining and polyclonal anti-Iba-1 antibody ( 1/500, Wako Chemicals, Richmond, Va.) for microglial staining for 3 h at room temperature. The slides were then incubated with Alexa Fluor 488-conjugated goat anti-mouse IgG antibody (Invitrogen, 1:500) and Alexa Fluor 546-conjugated goat anti-rabbit IgG antibody (Invitrogen, 1:500) in the dark for 3 h at room temperature to yield a positive red fluorescence. To visualize all cells, the slides were washed twice with PBS and counterstained with the nuclear dye DAPI (100 μg/mL, Sigma) to give a blue fluorescent color. Images were acquired using an Olympus BX51 microscope and a digital camera (Olympus DP71). Fluorescent images were co-localized with ImagePro software (Improvision Inc., Waltham, Mass.). The purity of microglia was more than 99% (1.93±0.54 astrocytes in 500 total cells in microglial culture, n=30).
[0095] To achieve SH-SY5Y differentiation, the undifferentiated cells were treated for 4 days with 5 M retinoic aid (RA) in DMEM/F12 medium containing 5% FBS, 100 IU/mL penicillin, and 100 g/mL streptomycin [REF: issue transglutaminase mediates activation of RhoA and MAP kinase pathways during retinoic acid-induced neuronal differentiation of SH-SY5Y cells. Singh U S, Pan J, Kao Y L, Joshi S, Young K L, Baker K M. J Biol Chem. 2003 Jan. 3; 278(1):391-9. Pubmed ID PMID 12401808]. The RA-containing medium was changed every two days. Differentiated SH-SY5Y cells demonstrated neurite extension, indicative of their differentiation [REF: Neurotoxins released from interferon-gamma-stimulated human astrocytes. Lee M, McGeer E, McGeer P L. Neuroscience. 2013 Jan. 15; 229:164-75. Pubmed ID PMID 23098801].
Methods for Neuronal Cell Culture Treatment with Aβ and LL-37 Peptides
[0096] Human microglial cells (5×10.sup.4 cells per well) or human neuroblastoma SH-SY5Y cells (5×10.sup.5 cells per well) or their mixture were seeded into 24-well plates in 1 mL of DMEM/F12 medium containing 5% FBS. Aβ42 peptide (AnaSpec, Fremont, Calif.) was dissolved in mixture of 1% NH4OH and 0.1% Thioflavin S (Sigma, St. Louis, Mo.) in water to make 30 mM stock solution. Further dilution was made with water to reach 30 μM. Similar methods were used to prepare LL-37 peptide solutions (AnaSpec, Fremont, Calif.). Cultured cells were exposed to either 30 μM Aβ42 or 30 μM LL-37; or to a combined 1:1 equimolar mixture of the two peptides at 30 μM each. After incubation for 72 h cell free medium was collected to measure levels of proinflammatory cytokines such as TNFα and IL-6. For SH-SY5Y cell viability, MTT assays were performed as described by Lee et al. [REF: Acidic fibroblast growth factor (FGF) potentiates glial-mediated neurotoxicity by activating FGFR2 IIIb protein. Lee M, Kang Y, Suk K, Schwab C, Yu S, McGeer P L. J Biol Chem. 2011 Dec. 2; 286(48):41230-45. Pubmed ID PMID 21990352].
Methods of SH-SY5Y-Microglial Cell Viability Assays
[0097] The viability of SH-SY5Y cells following incubation with glial cell supernatants was evaluated by MTT assays as described by Lee et al. [REF: Acidic fibroblast growth factor (FGF) potentiates glial-mediated neurotoxicity by activating FGFR2 IIIb protein. Lee M, Kang Y, Suk K, Schwab C, Yu S, McGeer P L. J Biol Chem. 2011 Dec. 2; 286(48):41230-45. Pubmed ID PMID 21990352]. Briefly, the viability was determined by adding MTT to the cell cultures to reach a final concentration of 1 mg/mL. Following 1 h incubation at 37° C., the dark crystals formed were dissolved by adding a SDS/DMF extraction buffer (300 μL, 20% sodium dodecyl sulfate, 50% N, N-dimethylformamide, pH 4.7). Subsequently plates were incubated overnight at 37° C. and optical densities at 570 nm were measured by transferring 100 μL aliquots to 96-well plates and using a plate reader with a corresponding filter. Data are presented as a percentage of the values obtained from cells incubated in fresh medium only.
Methods for the Measurement of TNF and IL-6 Release from Cultured Neuronal Cells
[0098] Cytokine levels were measured in cell-free supernatants after 72 h. Quantitation was performed with ELISA detection kits (Peprotech, NJ) following protocols described by the manufacturer.
Methods for Statistical Data Analysis of Results Obtained in Neuronal Cell Culture Assays
[0099] The significance of differences between data sets was analyzed by one-way ANOVA tests. Multiple group comparisons were followed by a post-hoc Bonferroni test, e.g. cell viability in control condition versus cells treated with LL-37 alone; cell viability in control condition versus cells treated with Aβ42 alone; and viability in control condition versus cells treated with mixed LL-37+Aβ42. P values are provided in the legends of the figures that show the results.
Example 1—SPRi Analysis of LL-37 Binding to Immobilized Aβ; and CE Analysis
[0100] To demonstrate interaction between LL-37 and Aβ42, a Surface Plasmon Resonance imaging (SPRi) biochip was functionalized with copoly(DMA-NAS-MAPS), a polydimethylacrylamide based copolymer, widely used to immobilize biomolecules on microarray slides [REF: Overcoming mass transport limitations to achieve femtomolar detection limits on silicon protein microarrays. Cretich M, Bagnati M, Damin F, Sola L, Chiari M. Anal Biochem. 2011 Nov. 1, 418(1):164-6. Pubmed ID PMID 21802399]. Three different solutions of 20 μM Aβ-peptides, in different states of aggregation, were spotted onto the SPRi-chip surface. The aggregation state and the presence of soluble oligomers were determined by CE analysis [REF: Disease-modifying anti-Alzheimer's drugs: inhibitors of human cholinesterases interfering with β-amyloid aggregation. Brogi S, Butini S, Maramai S, Colombo R, Verga L, Lanni C, De Lorenzi E, Lamponi S, Andreassi M, Bartolini M, Andrisano V, Novellino E, Campiani G, Brindisi M, Gemma S. CNS Neurosci Ther. 2014 July; 20(7):624-32. Pubmed ID PMID 24935788] and [REF: Capillary electrophoresis studies on the aggregation process of beta-amyloid 1-42 and 1-40 peptides. Sabella S, Quaglia M, Lanni C, Racchi M, Gavoni S, Caccialanza G, Calligaro A, Bellotti V, De Lorenzi E. Electrophoresis. 2004 October; 25(18-19):3186-94. Pubmed ID PMID 15472964]. Aβ40 (a) dissolved in PBS, Aβ42 (b) prepared as in [16], both solubilized immediately before spotting (t=0 days), and Aβ42 (c) prepared as sample (b), but stored in the buffer for 24 days (t=24 days) were spotted in different subarrays. Aβ42 was dissolved following the protocol detailed in the Material and Methods section. The solubilization buffer consisted of i) HFIP, a low-polarity solvent that stabilizes the α-helix and disrupts the interstrand hydrogen bonds of the β-sheets and ii) a mixture of acetonitrile/Na2CO3/NaOH. While acetonitrile stabilizes the unordered/α-helix structure, the basic pH increases the solubility of Aβ peptide. Overall, this procedure disfavors aggregation and provides a time window long enough to appreciate the prevailing formation of low-MW oligomers at early stages (t=0 days) and the building up of high-MW oligomers at late-stages (t=24 days) of the in vitro fibrillogenesis process. Indeed, this was confirmed by analyzing in CE the three samples at 100 μM concentration using a method slightly modified from Sabella et al. [REF: Disease-modifying anti-Alzheimer's drugs: inhibitors of human cholinesterases interfering with β-amyloid aggregation. Brogi S, Butini S, Maramai S, Colombo R, Verga L, Lanni C, De Lorenzi E, Lamponi S, Andreassi M, Bartolini M, Andrisano V, Novellino E, Campiani G, Brindisi M, Gemma S. CNS Neurosci Ther. 2014 July; 20(7).624-32. Pubmed ID PMID 249357988.
[0101] The interaction of Aβ in different aggregation states with LL-37 was investigated by SPRi. The CCD image of the chip surface, and the plasmonic curves acquired before the injection of LL-37 (
TABLE-US-00001 TABLE 1 Values of the maximal response (R.sub.max), (related to the absolute number of LL-37 molecules bound on the Aβ peptides at a certain time) and equilibrium binding constants (K.sub.A and K.sub.D), calculated using a nonlinear curve fit of the SPRi response at equilibrium. Peptide R.sub.max K.sub.A (M.sup.−1) K.sub.D (μM) Aβ.sub.40 (t = 0 days) 0.59 1.20 × 10.sup.5 8.3 Aβ.sub.42 (t = 0 days) 1.56 7.51 × 10.sup.4 13.3 Aβ.sub.42 (t = 24 days) 4.43 4.92 × 10.sup.4 20.3
Example 2—Results of Transmission Electron Microscopy Analysis of Aβ and LL-37 Peptides
[0102] An inhibitory effect of LL-37 peptide binding on fibril formation was demonstrated by transmission electron microscopy (TEM). For these experiments (see Methods), samples were prepared according to a more aggregating protocol [REF: Disease-modifying anti-Alzheimer's drugs: inhibitors of human cholinesterases interfering with β-amyloid aggregation. Brogi S, Butini S, Maramai S, Colombo R, Verga L, Lanni C, De Lorenzi E, Lamponi S, Andreassi M, Bartolini M, Andrisano V, Novellino H, Campiani G, Brindisi M, Gemma S. CNS Neurosci Ther. 2014 July; 20(7):624-32. Pubmed ID PMID 24935788], to mimic quasi-physiological conditions and to better verify LL-37 anti-fibrillogenic activity. Aβ42 reproducibly forms a dense network of interpenetrating, μm-long, straight, unbranched filaments with a diameter of about 10 nm (
Example 3—Results of Conformational Analysis by Circular Dichroism (CD) Spectroscopy
[0103] Conformational analyses of Aβ42 peptide in solution, in the absence and presence of LL-37, were carried out by circular dichroism (CD) spectroscopy. As in TEM analysis, spectra were recorded immediately after dissolving peptide according to [REF: Disease-modifying anti-Alzheimer's drugs: inhibitors of human cholinesterases interfering with β-amyloid aggregation. Brogi S, Butini S, Maramai S, Colombo R, Verga L, Lanni C, De Lorenzi E, Lamponi S, Andreassi M, Bartolini M, Andrisano V, Novellino E, Campiani G, Brindisi M, Gemma S. CNS Neurosci Ther. 2014 July; 20(7).624-32. Pubmed ID PMID 24935788] (
[0104] While CD is essentially an “averaging” spectroscopic method, the spectra of 1:1 mixed Aβ42 and LL-37 peptides do not show ordered β structure of the type that predominates in pure Aβ42 solutions. No time-dependence, within 24 hours, of peptide secondary structure was observed in the mixed solutions, in contrast to the behavior of Aβ42 solutions. As discussed below, this interaction between the peptides makes sense, considering their opposite charges and mutually high and similar proportions of aromatic and aliphatic amino acids (
Example 4—Effects of Aβ42, LL-37, and Aβ42/LL-37 Complexes on Human Microglia, SH-SY5Y Neuronal Cells, and Microglia-Mediated Cytotoxicity to SH-SY5Y Neuronal Cells
[0105] We studied the effects of Aβ42 alone, LL-37 alone, and Aβ42/LL-37 complexes on SH-SY5Y neuroblastoma cells, human microglia, and on cytokine release from microglia that impact SH-SY5Y cells. Specifically, we exploited a simplified model that reproduces the cross-talk between the major players involved in neuronal damage by looking at the effect of cell-free supernatant from microglial cell culture, on cultured neuronal cells. Cultured cells were exposed to either Aβ42 alone or LL-37 alone (each at 30 μM concentration). After incubation for 72 h, MTT assays were performed and the cell-free medium was collected to measure levels of proinflammatory cytokines TNFα and IL-6. Note, as shown in the control experiments (
[0106] However, we find evidence for microglia-mediated neuroinflammation, for both peptides. Human microglia were exposed to either Aβ alone, LL-37 alone, or an equimolar LL-37/Aβ mixture for 2 days. Then cell-free supernatants from microglia cultures were transferred to differentiated SH-SY5Y cells. SH-SY5Y cell viability was measured after 72 h. We also measured TNFα and IL-6 levels in microglial cell-free supernatants after 2 days' incubation with the peptides. Data are presented in
Discussion of In Vitro Results of Aβ:LL-37 Interaction Studies by TEM, CD, SPRi, and Neuronal Cell Culture
[0107] Among the many inhibitors of Aβ aggregation and neurotoxicity that have been identified previously by various assays, or designed, synthesized, and/or selected. [REF: Molecules that target beta-amyloid. Stains C I, Mondal K, Ghosh I, ChemMedChem 2007 December; 2(12):1674-92. Review. Pubmed ID PMID: 17952881] and [REF: A molecular chaperone breaks the catalytic cycle that generates toxic Aβ oligomer. Cohen S I A, Arosio P, Presto J, Kurudenkandy F R, Biverstal H, Dolfe L, Dunning C, Yang X, Frohm B, Vendruscolo M, Johansson J, Dobson C M, Fiaahn A, Knowles T P J, Linse S. Nat Struct Mol Biol 2015 March; 22(3):207-213. Pubmed ID PMID 25686037] However, no naturally occurring peptides that match Aβ in size were ever identified. The cathelicidin LL-37 is a pleiotropic, 37-residue innate immune effector that corresponds to residues 134-170 of the human cationic antimicrobial protein [REF: The chemistry and biology of LL-37. Burton M F, Steel P G. Nat Prod Rep 2009 December; 26(12):1572-84. Review. PMID 19936387]. It is one of a kind in the human proteome and is expressed in many organs, including the brain [REF: The chemistry and biology of LL-37. Burton M F, Steel P G. Nat Prod Rep. 2009 December; 26(12):1572-84. Review. PMID: 19936387] and [REF: Human antimicrobial peptide LL-37 induces glial-mediated neuroinflammation. Lee M, Shi X I, Barron A P, McGeer E, McGeer P L. Biochem Pharmacol. 2015 Mar. 15; 94(2):130-41. Pubmed ID PMID 25686659]. LL-37 fulfills myriad systemic roles as an immune system effector and modulator [REF: Mol Biosyst. 2009 May; 5(5):483-96. Systems biology evaluation of immune responses induced by human host defence peptide LL-37 in mononuclear cells. Mookherjee N I, Hamill P, Gardy J, Blimkie D, Falsafi R, Chikatamarla A, Arenillas D J, Doria S, Kollmann T R, Hancock RE. Pubmed PMID 1931363] Additionally, LL-37's immunomodulatory functions and effects on cells, links the endocrine and immune systems. [REF: Cathelicidins link the endocrine and immune systems. Mayer M L, Hancock R E Cell Host Microbe. 2010 Apr. 22; 7(4):257-9. Pubmed ID PMID 20413092] Moreover, LL-37 plays a central role in Vitamin D3-stimulated monocyte/macrophage autophagy. [REF: Vitamin D3 induces autophagy in human monocytes/macrophages via cathelicidin. Yuk J M, Shin D M, Lee H M, Yang C S, Jin H S, Kim K K, Lee Z W, Lee S H, Kim J M, Jo E K. Cell Host Microbe 2009 Sep. 17; 6(3):231-43. Pubmed ID PMID 19748465]
[0108] Thus, these experiments that were described above, have both discovered and quantified a sequence-specific molecular binding interaction between Aβ and LL-37, indicating that these two peptides appear to be natural binding partners. If so, the dynamics of spatiotemporal expression of LL-37 and Aβ are likely to hold major significance to human health. While there are myriad well-studied functions of LL-37 as an antimicrobial and antiviral weapon of immune cells, the physiological functions of Aβ are not yet fully elucidated [REF: Physiological roles for amyloid beta peptides. Pearson H A, Peers C. J Physiol. 2006 Aug. 15; 575 (Pt 1):5-10. Pubmed PMID: 16809372]. Recently published work suggests that Aβ may itself function in vivo, particularly in the human brain, as an antimicrobial and antiviral peptide [REF: The Alzheimer's disease-associated amyloid beta-protein is an antimicrobial peptide. Soscia S J, Kirby J E, Washicosky K J, Tucker S M, Ingelsson M, Hyman B, Burton M A, Goldstein L E, Duong S, Tanzi R E, Moir R D. PLoS One. 2010 Mar. 3; 5(3):e9505. Pubmed ID PMID: 20209079] and [REF: Sci Transl Med. 2016 May 25; 8(340):340ra72. Amyloid-β peptide protects against microbial infection in mouse and worm models of Alzheimer's disease. Kumar D K, Choi S H, Washicosky K J, Eimer W A, Tucker S, Ghofrani J, Lefkowitz A, McColl G, Goldstein L E, Tanzi R E, Moir R D. Pubmed ID PMID 27225182] and [REF: Biogerontology. 2015 February; 16(1):85-98. β-Amyloid peptides display protective activity against the human Alzheimer's disease-associated herpes simplex virus-1. Bourgade K, Garneau H, Giroux G, Le Page A Y, Bocti C, Dupuis G, Frost E H, Fülöp T Jr. Pubmed ID PMID 25376108] and [REF: Alzheimer's Disease-Associated β-Amyloid Is Rapidly Seeded by Herpesviridae to Protect against Brain infection. Eimer W A, Kumar D K V, Shanmugam N K N, Rodriguez A S, Mitchell T, Washicosky K J, György B, Breakefield X O, Tanzí RE, Moír R D. Neuron. 2018 Jul. 11; 99(1):56-63].
[0109] The study of LL-37:Aβ interaction was initially inspired by an observation of a strong, apparent complementarity between the peptides' amino acid (aa) sequences (
[0110] In Lee et al. in 2015, it was reported that the human cathelicidin precursor protein hCAP18 and its downstream cleavage product, the peptide LL-37, are both expressed in many organs of the human body, with the highest basic levels of LL-37 being expressed in the gastrointestinal tract and the brain [REF: Human antimicrobial peptide LL-37 induces glial-mediated neuroinflammation. Lee M, Shi Xi, Barron A E, McGeer E, McGeer P L. Biochem Pharmacol. 2015 Mar. 15; 94(2):130-41. Pubmed ID PMID 25686659] Prior to that 2015 Lee et al. publication, LL-37's expression and functional role in the human central nerve system (CNS) had not been reported. Thus, LL-37 has been proven to be expressed in brain tissue in the human body, as is the Aβ peptide. However, that 2015 publication purported to show, only, that LL-37 might be pro-inflammatory in human brain tissue, like Aβ itself. That 2015 paper did not mention or suggest any possibility of a binding interaction between LL-37 and Aβ.
Results of the SPRi Interaction Study of LL-37:Aβ Interaction
[0111] The physical interaction and binding specificity between LL-37 and different Aβ forms was demonstrated by SPRi, taking advantage of the simultaneous monitoring of different interactions on the same chip enabled by the imaging configuration of the technique CCD images and related plasmonic curves (
[0112] Several studies have reported the use of conventional SPR approaches to study Aβ potential interactors. Kai et al. reported the inhibition of Aβ fibril formation by tabersonine and demonstrated the binding between this small molecule and Aβ42 monomers and oligomers immobilized on the SPR chip surface. [REF: Tabersonine inhibits amyloid fibril formation and cytotoxicity of Aβ(1-42). Kai T, Zhang L, Wang X, Jing A, Zhao B, Yu X, Zheng J, Zhou F. ACS Chem Neurosci. 2015 Jun. 17; 6(6).879-48. Pubmed ID PMID 25874995] Equilibrium binding studies yield K.sub.D values of 69 and 535 μM for Aβ42 monomers and oligomers, respectively. In a similar study, Barr et al verified the inhibition of Aβ fibril formation by a 15-amino acid peptide [REF: Validation and Characterization of a Novel Peptide That Binds Monomeric and Aggregated β-Amyloid and Inhibits the Formation of Neurotoxic Oligomers Barr R K, Verdile G, Wijaya L K, Morici M, Taddei K, Gupta V B, Pedriní S, Jin L, Nicolazzo J A, Knock E, Fraser P E, Martins R N. J Biol Chem. 2016 Jan. 8; 291(2):547-59. Pubmed ID PMID 26538562] SPR surfaces functionalized with monomeric, oligomeric and fibrillar Aβ42 revealed a stronger affinity of the polypeptide toward the fibrillar form, although only a K.sub.D value of 11 μM was measured by injecting Aβ42 onto immobilized peptides and no affinity constant was given. In the SPRi studies described above, kinetic constants in the range between 8 to 20 μM were found, similar to what is published for other Aβ fibril inhibitors as noted above. On the other hand, as mentioned earlier (and differently to what was previously shown) [REF: Tabersonine inhibits amyloid fibril formation and cytotoxicity of Aβ(1-42). Kai T, Zhang L, Wang X, Jing A, Zhao B, Yu X, Zheng J, Zhou F. ACS Chem Neurosci. 2015 Jun. 17; 6(6):879-88. Pubmed ID PMID 25874995] and [REF: Validation and Characterization of a Novel Peptide That Binds Monomeric and Aggregated β-Amyloid and Inhibits the Formation of Neurotoxic Oligomers. Barr R K, Verdile G, Wijaya L K, Morici M, Taddei K, Gupta V B, Pedrini S, Jin L, Nicolazzo J A, Knock E, Fraser P E, Martins R N. J Biol Chem. 2016 Jan. 8; 291(2):547-59. Pubmed ID PMID 26538562], LL-37 shows higher affinity for low-MW Aβ oligomers. This strongly supports the ability of LL-37 to inhibit fibril formation by shining the equilibrium toward smaller species of Aβ, according to the fibrillization mechanisms proposed by Cohen et al. [REF: Proliferation of amyloid-β42 aggregates occurs through a secondary nucleation mechanism. Cohen S I, Linse S, Luheshi L M, Hellstrand E, White D A, Rajah L, Otzen D E, Vendruscolo M, Dobson C M, Knowles T P. Proc Natl Acad Sci USA. 2013 Jun. 11; 110(24):9758-63. Pubmed ID PMID 23703910]
Effects of LL-37 and Aβ on Cytotoxicity and Inflammatory Cytokine Release
[0113] The results of the MTT assays showed that Aβ42 and LL-37 both induced microglial-mediated toxicity to SH-SY5Y cells. At the same time, the results of quantitative ELISA assays on IL-6 and TNFα showed that the levels of these proinflammatory makers released from microglia were markedly elevated compared with that of the untreated control group, when each peptide was added alone. However, the effects of each peptide on cell viability and inflammatory marker production were largely mitigated when the two peptides were co-incubated prior to being added to the culture medium. These data support the hypothesis that Aβ42 interacts with LL-37 as seen by the considerable attenuation of the toxicity of the peptides when they are in complexation.
[0114] Certain aspects of our results am not surprising, as previously we have shown that microglia, upon stimulation by LL-37, can release proinflammatory cytokines that affect neurons. [REF: Human antimicrobial peptide LL-37 induces glial-mediated neuroinflammation. Lee M, Shi X I, Barron A E, McGeer E, McGeer P L. Biochem Pharmacol. 2015 Mar. 15; 94(2):130-41. Pubmed ID PMID 25686659] Similarly, Aβ has been shown to activate microglia to produce inflammatory cytokines [REF: Microglia-mediated neurotoxicity: uncovering the molecular mechanisms. Block M L I, Zecca L, Hong J S. Nat Rev Neurosci. 2007 January; 8(1):57-69. Pubmed ID PMID 17180163] However, an attenuation of the release of proinflammatory factors (IL-6 and TNFα) upon treatment of microglia with equimolar LL-37 and Aβ peptide mixtures is a novel finding, which strongly supports our finding that these two peptides may be natural binding partners, which perhaps the body seeks to maintain in balance over the longer term (after an acute innate immune response). Unlike either peptide alone, which causes human microglia to release proinflammatory and neurotoxic cytokines, the complex of the two peptides lacks that neurotoxic effect.
Correlation of Biophysical Activities of Aβ Peptides and LL-37
[0115] Prior to this new work, no one has established a correlation between cathelicidin expression levels and Alzheimer's disease. However, in addition to those mentioned above, other literature reports suggest that the biophysical activities and signaling functions of Aβ peptides and LL-37 are related in vivo. For instance, the Formyl-like Peptide Receptor 1 (FPRL1) is activated by both Aβ [REF: Amyloid (beta)42 activates a G-protein-coupled chemoattractant receptor, FPR-like-1. Le Y, Gong W, Tiffany H L, Tumanov A, Nedospasov S, Shen W, Dunlop N M, Gao X, Murphy P M, Oppenheim J J, Wang J M. J Neurosci. 2001 Jan. 15; 21(2):RC123. Pubmed ID PMID 11160457] and LL-37 [REF: LL-37, the neutrophil granule- and epithelial cell-derived cathelicidin, utilizes formyl peptide receptor-like 1 (FPRL1) as a receptor to chemoattract human peripheral blood neutrophils, monocytes, and T cells. De Yangl, Chen Q, Schmidt A P, Anderson G M, Wang J M, Wooters J, Oppenheim J J, Chertov O. J Exp Med. 2000 Oct. 2; 192(7):1069-74. Pubmed ID PMID 11015447]. This receptor is reportedly involved in inflammatory aspects of AD [REF: Potential role of the formyl peptide receptor-like 1 (FPRL1) in inflammatory aspects of Alzheimer's disease. Cui Y, Le Y, Yazawa H, Gong W, Wang J M. J Leukoc Biol. 2002 October; 72(4):628-35. Review. Pubmed ID PMID: 12377930] via its effects on phagocyte responses [REF: Role of formyl peptide receptor-like 1 (FPRL1/FPR2) in mononuclear phagocyte responses in Alzheimer disease. Iribarren P, Zhou Y, Hu J, Le Y, Wang J M. Immunol Res. 2005; 31(3):165-76. Review. Pubmed PMID: 15888909]; and a decreased phagocyte clearance of CNS β-amyloid is a hallmark of AD [REF: Decreased clearance of CNS beta-amyloid in Alzheimer's disease. Mawuenyega K G I, Sigurdson W, Ovod V, Munsell L, Kasen T, Morris J C, Yarasheski K E, Bateman R J. Science. 2010 Dec. 24; 330(6012):1774. Pubmed ID PMID 21143344] As mentioned above, LL-37 itself is involved in monocyte and macrophage autophagy; its expression, stimulated by Vitamin D3 [REF: Human cathelicidin antimicrobial peptide (CAMP) gene is a direct target of the vitamin D receptor and is strongly up-regulated in myeloid cells by 1,25-dihydroxyvitamin D3. Gombart A F, Borregaard N, Koeffler H P. FASEB J. 2005 July; 19(9):1067-77. Pubmed ID PMID 15985530], engenders enhanced autophagy [REF: Vitamin D3 induces autophagy in human monocytes/macrophages via cathelicidin Yuk J M I, Shin D M, Lee H M, Yang C S, Jin H S, Kim K K, Lee Z W, Lee S H, Kim J M, Jo E K Cell Host Microbe. 2009 Sep. 17; 6(3):23143. Pubmed ID PMID 19748465]. Thus, a dearth of LL-37 generally would reduce phagocytic activity. Phenylbutyrate and Vitamin D3 have each, individually, been shown to be neuroprotective in Alzheimer's Disease mouse models [REF: 1α,25-Dihydroxyvitamin D3 reduces cerebral amyloid-β accumulation and improves cognition in mouse models of Alzheimer's disease. Durk M R, Han K, Chow E C, Ahrens R, Henderson J T, Fraser P E, Pang K S. J Neurosci. 2014 May 21; 34(21):7091-7101. Pubmed ID PMID 24849345] and [REF: Cur Pharm Des. 2013; 19(28):5076-84. Phenylbutyrate is a multifaceted drug that exerts neuroprotective effects and reverses the Alzheimer's disease-like phenotype of a commonly used mouse model. Cuadrado-Tejedor M, Ricobaraza A L, Torrijo R, Franco R Garcia-Osta A. Pubmed ID PMID 23448463], and these same two compounds are known cathelicidin inducers, although this connection between cathelicidin induction and Alzheimer's Disease has not been noticed prior to this patent [REF: Phenylbutyrate induces antimicrobial peptide expression. Steinmann J, Halldórasson S, Agerberth B, Gudmundsson G H. Antimicrob Agents Chemother 2009 December; 53(12):5127-33. Pubmed ID PMID 19770273]. Finally, there is mounting evidence that innate immunity plays a larger role in Alzheimer's disease than previously thought, and that Aβ's normal function may be as an antimicrobial and antiviral peptide [REF: The Alzheimer's disease-associated amyloid beta-protein is an antimicrobial peptide. Soscia S J, Kirby J E, Washicosky K J, Tucker S M, Ingelsson M, Hyman B, Burton M A, Goldstein L E, Duong S, Tanzi R E, Moir R D. PLoS One. 2010 Mar. 3; 5(3):e9505. Pubmed ID PMID: 20209079] and [REF: Sci Transl Med. 2016 May 25; 8(340):340ra72. Amyloid-β peptide protects against microbial infection in mouse and worm models of Alzheimer's disease. Kumar D K, Choi S H, Washicosky K J, Eimer W A, Tucker S, Ghofrani J, Lefkowitz A, McColl G, Goldstein L E, Tanzi R E, Moir R D. Pubmed ID PMID 27225182] and [REF: Biogerontology. 2015 February; 16(1):85-98. β-Amyloid peptides display protective activity against the human Alzheimer's disease-associated herpes simplex virus-1. Bourgade K, Garneau H, Giroux G, Le Page A Y, Bocti C, Dupuis G, Frost E, Fülöp T Jr. Pubmed ID PMID 25376108] and [REF: Alzheimer's Disease-Associated β-Amyloid Is Rapidly Seeded by Herpesviridae to Protect against Brain Infection. Eimer W A, Kumar D K V, Shanmugam N K N, Rodriguez A S, Mitchell T, Washicosky K J, György B, Breakefield X O, Tanzi R E, Moir R D. Neuron. 2018 Jul. 11; 99(1):56-63]. Kumar et al. showed that Aβ expression protects against fungal and bacterial infections in mouse, nematode, and cell culture models of AD [REF: Sci Transl Med. 2016 May 25; 9(340):340ra72. Amyloid-β peptide protects against microbial infection in mouse and worm models of Alzheimer's disease. Kumar D K, Cho S H, Washicosky K J, Eimer W A, Tucker S, Ghofrani J, Lefkowitz A, McColl G, Goldstein L E, Tanzi R E, Moir R D. Pubmed ID PMID 27225182]. And, part of the body's natural response to infection is, of course, to upregulate cathelicidin [REF: The chemistry and biology of LL-37. Burton M F, Steel P G. Nat Prod Rep. 2009 December, 26(12):1572-84. Review. Pubmed ID PMID: 19936387].
Significance of Studies of LL-37:Aβ Interaction and Binding In Vitro
[0116] The work described above demonstrates that these two peptides, the cathelicidin peptide LL-37 and the Alzheimer's Disease-associated peptide Aβ, which are both ubiquitous in human tissues and expressed in the human brain, bind to and interact with each other in different aggregation states, with affinity constants typical of protein-protein interactions and close to values reported in the literature for the binding of Aβ with optimized synthetic peptides. The addition of LL-37 to Aβ42, in a buffer that mimics quasi-physiological conditions, strongly inhibits fibril formation. The protective effect of LL-37's presence against microglia-mediated Aβ42 toxicity to SH-SY5Y neuroblastoma cells is an important new finding, revealing that in combination the two peptides are 90% less pro-inflammatory than either peptide alone. Literature reports suggest that numerous biophysical activities and signaling functions of Aβ peptides and LL-37 are related in vivo. The in vitro data presented here were the starting point from which we are further investigating whether factors that affect cathelicidin gene CAMP regulation, which will in turn control the production of LL-37 in vivo, modulate Aβ aggregation and/or microglia-induced neuroinflammation.
Correlations Between Infections of Brain Tissue, and Alzheimer's Disease
[0117] As has been mentioned above, it has been hypothesized that the Alzheimer's Disease-associated peptide Aβ may itself be an important host defense peptide. However, it is not yet well understood what causes the expression of the Aβ peptide or its precursor protein, APP. [REF: The Alzheimers disease-associated amyloid beta-protein is an antimicrobial peptide. Soscia S J, Kirby J E, Washicosky K J, Tucker S M, Ingelsson M, Hyman B, Burton M A, Goldstein L E, Duong S, Tanzi R E, Moir R D. PLoS One. 2010 Mar. 3; 5(3):e9505. Pubmed ID PMID: 20209079] and [REF: Sci Transl Med. 2016 May 25, 8(40):340ra72. Amyloid-β peptide protects against microbial infection in mouse and worm models of Alzheimer's disease. Kumar D K, Choi S H, Washicosky K J, Eimer W A, Tucker S, Ghofrani J, Lefkowitz A, McColl G, Goldstein L E, Tanzi R E, Moir R D. Pubmed ID PMID 27225182] and [REF: Biogerontology. 2015 February; 16(1):85-98. β-Amyloid peptides display protective activity against the human Alzheimers disease-associated herpes simplex virus-1. Bourgade K, Gameau H, Giroux G, Le Page A Y, Bocti C, Dupuis G, Frost E H, Fülöp T Jr. Pubmed ID PMID 253761081 Kumar et al. showed that Aβ expression protects against fungal and bacterial infections in mouse, nematode, and cell culture models of AD [REF: Sci Transl Med. 2016 May 25, 8(340):340ra72. Amyloid-β peptide protects against microbial infection in mouse and worm models of Alzheimer's disease. Kumar D K, Choi S H, Washicosky K J, Eimer W A, Tucker S, Ghofrani J, Lefkowitz A, McColl G, Goldstein L E, Tanzi R E, Moir R D. Pubmed ID PMID 27225182]. It has been shown that infection of brain tissue with Herpesvirus results in rapid expression of Aβ peptide, which then entraps the Herpes viral particles in beta-amyloid, which may mean that viral infections actually stimulate the expression of Aβ. [REF: Alzheimer's Disease-Associated β-Amyloid Is Rapidly Seeded by Herpesviridae to Protect against Brain Infection. Eimer W A, Kumar D K V. Shanmugam N K N, Rodriguez A S, Mitchell T, Washicosky K J, György B, Breakefield X O, Tanzi R E, Moir R D. Neuron. 2018 Jul. 11; 99(1):56-43. Pubmed ID PMID 30001512]. Other pathogens, besides Herpesvirus, which seem to infect brain tissue and correlate with higher risk of Alzheimer's Disease include the bacterial pathogens Chlamydia pneumoniae and the family of Spirochete bacteria. [REF: Historic evidence to support a causal relationship between spirochetal infections and Alzheimer's disease. Miklossy J. Front Aging Neurosci. 2015 Apr. 16; 7:46. Pubmed ID PMID 25932012] and [REF: Chlamydia pneumoniae infection of monocytes in vitro stimulates innate and adaptive immune responses relevant to those in Alzheimer's disease. Lim C, Hammond C J, Hingley S T, Balin B J. J Neuroinflammation. 2014 Dec. 24; 11:217. Pubmed ID PMID: 25540075] and [Bacterial Amyloid and DNA are Important Constituents of Senile Plaques: Further Evidence of the Spirochetal and Biofilm Nature of Senile Plaques. Miklossy J. J Alzheimers Dis. 2016 Jun. 13; 53(4):1459-73. Pubmed ID 27314530] A meta-analysis of all studies that have examined the relationship between bacterial infections of brain tissue, and Alzheimer's Disease (AD), found over a ten-fold increased occurrence of AD when there was detectable evidence of spirochetal infection (OR: 10.61; 95% CI: 3.38-33.29), with over a four-fold increased occurrence of AD as a conservative risk estimate (OR 4.45; 95% CI: 2.33-8.52). The same meta-analysis also found over a five-fold increased occurrence of AD with Chlamydophila pneumoniae infection (OR: 5.66; 95% CI: 1.83-17.51). Therefore, there is a strongly positive association between bacterial infection of the brain and AD. [REF: Bacterial infection and Alzheimer's disease: a meta-analysis. Mabeshwari P, Eslick G D. J Alzheimers Dis. 2015; 43(3).957-66. Pubmed ID PMID 25192736] If indeed, as these studies indicate, Aβ is a host defense peptide just as LL-37 is, then their role as binding partners that can detoxify each other also makes sense. Also, it should be noted that the LL-37 peptide has been shown to be active against both HSV-1 and HSV-2, two different strains of Herpesvirus against which it has been tested. [REF: Hunan cathelicidin (LL-37), a multifunctional peptide, is expressed by ocular surface epithelia and has potent antibacterial and antiviral activity. Gordon Y J I, Huang L C, Romanowski E G, Yates K A, Proske R J, McDermott A M. Cur Eye Res 2005 May; 30(5):385-94. Pubmed ID PMID 16020269] and [REF: Cathelicidin deficiency predisposes to eczema herpeticum. Howell M D, Wollenberg A, Gallo R L, Flaig M, Streib J E, Wong C, Pavicic T, Boguniewicz M, Leung D Y. J Allergy Clin Immunol. 2006 April; 117(4):836-41. Pubmed ID PMID 16630942] interestingly, the particular bacterial pathogen Chlamydia pneumoniae, which is associated with AD, appeared in one study to resist the antibacterial activity of LL-37 peptide. [REF: Involvement of the antimicrobial peptide LL-37 in human atherosclerosis. Edfeldt K, Agerberth B, Rottenberg M E, Gudmundsson G H, Wang X B, Mandal K, Xu Q, Yan Z Q. Arterioscler Tromb Vasc Biol. 2006 July; 26(7):1551-7. Pubmed ID PMID 1664514] Finally, a 2018 study of the brains of patients with Alzheimer's Disease found increased prevalence of human herpesvirus 6A (HHV-6A) and human herpesvirus 7 (HHV-7) within the brain tissue of subjects with Alzheimer's Disease, compared with controls. These results were replicated in two additional, independent and geographically dispersed cohorts. [REF: Multiscale Analysis of Independent Alzheimer's Cohorts Finds Disruption of Molecular, Genetic, and Clinical Networks by Human Herpesvirus. Readhead B, Haure-Mirande J V, Funk C C, Richards M A, Shannon P, Haroutunian V, Sano M, Liang W S, Beckmann N D, Price N D, Reiman E M, Schadt E E, Ehrlich M E, Candy S, Dudley J T. Neuron. 2018 Jul. 11; 99(1):64-82.e7. Pubmed ID PMID 29937276] Whether this statistically significant, increased burden of Herpesviridae in the brains of Alzheimer's Disease sufferers is causative of neurodegeneration, or correlative with the disease process, is not yet clear: however, this finding is important. If, as put forward by Moir and Tanzi et al., Aβ amyloid oligomers, fibrils and plaques serve to sequester and inactivate Herpesvirus particles, then LL-37-stimulated macroautophagy may serve to clear away these molecular debris from the brain, once the virus has been rendered inactive by immobilization in AP plaques. [REF: Vitamin D3 induces autophagy in human monocytes/macrophages via cathelicidin Yuk J M, Shin D M, Lee H M, Yang C S, Jun H S, Kim K K, Lee Z W, Lee S H, Kim J M, Jo E K. Cell Host Microbe. 2009 Sep. 17; 6(3):231-43. Pubmed ID PMID: 19748465]
Inducer of Cathelicidin Gene, CAMP, and Obligate Co-Factors for CAMP Expression
[0118] There are a number of known inducers and essential cofactors for expression of the cathelicidin gene, which is called CAMP in humans, and cup in mice. One important compound for the induction of CAMP gene expression is Vitamin D3. [REF: Human cathelicidin antimicrobial peptide (CAMP) gene is a direct target of the vitamin D receptor and is strongly up-regulated in myeloid cells by 1,25-dihydroxyvitamin D3. Gombart A F I, Borregaard N, Koeffler H P, FASEB J. 2005 July; 19(9):1067-77. Pubmed ID PMID 15985530] and [REF: Vitamin D as an inducer of cathelicidin antimicrobial peptide expression: past, present and future. White J H. J Steroid Biochem Mol Biol. 2010 July; 121(1-2):234-8. Pubmed ID PMID 20302931] Vitamin D3 is a particularly potent inducer of cathelicidin in human immune cells. [REF: Regulation of the human cathelicidin antimicrobial peptide gene by 1α,25-dihydroxyvitamin D3 in primary immune cells. Lowry M B, Guo C, Borregaard N, Gombart A F. J Steroid Biochem MCA Biol. 2014 September; 143:183-91. Pubmed PMID: 24565560] Interestingly, this Vitamin D3 requirement for CAMP expression in human beings and primates, especially, is related to the existence of a Vitamin D Receptor (VDR) binding domain in transcriptional control region of the gene. [REF: Exaptation of an ancient Alu short interspersed element provides a highly conserved vitamin D-mediated innate immune response in humans and primates. Gombart A F, Saito T, Koeffler H P. BMC Genomics. 2009 Jul. 16; 10:321. doi: 10.1186/1471-2164-10-321. Pubmed ID PMID 19607716] It has been shown that the regulation of cathelicidin expression by Vitamin D3 differs, in different tissues of the body. [REF: Regulation of the CAMP gene by 1,25(OH)2D3 in various tissues. Gombart A F, O'Kelly J, Saito T, Koeffler H P. J Steroid Biochem Mol Biol 2007 March; 103(3-5):552-7. Pubmed ID PMID: 17368184] There is also a Retinoid X Receptor (RXR) binding domain in the CAMP transcriptional control region, which makes RXR agonists obligate cofactors for CAMP gene expression, along with Vitamin D3. RXR agonists include, for instance, natural molecules such as Retinoic Acid (Vitamin A), which is a metabolic by-product of the dietary retinoid β-Carotene, and/or Dodecahexanoic Acid (DHA). A potent non-natural RXR agonist is the compound Bexarotene, which is an FDA-approved drug for cancer treatment. [REF: Vitamin D-induced up-regulation of human keratinocyte cathelicidin antimicrobial peptide expression involves retinoid X receptor α. Svensson D, Nebel D, Voss U, Ekblad E, Nilsson B O. Cell Tissue Res. 2016 November; 366(2):353-362. June 30. Pubmed ID PMID 27357804] and [REF: Label-free quantitative mass spectrometry reveals novel pathways involved in LL-37 expression. Cederlund A, Nylén F, Miraglia E, Bergman P, Gudmundsson G H, Agerberth B. J Innate Immun. 2014; 6(3):365-76. doi: 101159/000355931 Epub 2013 Nov. 16. Pubmed PMID. 24246949]
[0119] The use of the RXR agonist DHA in combination with Bexarotene shows synergy and more efficient activation of Retinoid X Receptors, such that a lower dosage of the FDA-approved drug Bexarotene can be used as an RXR agonist, reducing any potential toxicity to liver or kidneys. [REF: Omega-3 Fatty Acids Augment the Actions of Nuclear Receptor Agonists in a Mouse Model of Alzheimer's Disease. Casali B T, Corona A W, Mariani M M, Karlo J C, Ghosal K, Landreth G E. J Neurosci. 2015 Jun. 17; 35(24):9173-81. Pubmed ID PMID 26005639]
[0120] In addition to Vitamin D3, certain short-chain fatty acids are able to induce the expression of the CAMP gene, especially Butyrate. [REF: Expression of the cathelicidin LL-37 is modulated by short chain fatty acids in colonocytes. relevance of signalling pathways. Schauber J, Svanholm C, Termen S, Iffland K, Menzel T, Scheppach W, Melcher R, Agerberth B, Lührs H, Gudmundsson G H. Gut. 2003 May; 52(5):735-41. Pubmed ID PMID: 12692061] However, Butyrate is an undesirable therapeutic compound, as it has a noxious smell. As a replacement for Butyrate induction of CAMP gene expression, it was discovered the Phenylbutyrate is highly effective; and does not smell bad. [REF: Phenylbutyrate induces antimicrobial peptide expression. Steinmann J, Halldörason S, Agerberth B, Gudmundsson G H. Antimicrob Agents Chemother. 2009 December; 53(12):3127-33. doi: 10.1128/AAC.00818-09. Epub 2009 Sep. 21. Pubmed ID PMID: 19770273] The combination of Vitamin D3 and Phenylbutyrate is synergistic in its ability to induce CAMP gene expression, providing enhanced expression of LL-37 and antibacterial activity, relative to what can be achieved with just one of the two compounds. [REF: Vitamin D and phenylbutyrate promote development of a human dendritic cell subset displaying enhanced antimicrobial properties. van der Does A M, Kenne E, Koppelaar E. Agerberth B, Lindbom L. J Leukoc Biol 2014 June, 95(6):883-91. Pubmed ID PMID: 24550524] In the United States, the compound Phenylbutyrate is an FDA-approved drug for the treatment of Urea-Cycle Disorders. [REF: Profile of sodium phenylbutyrate granules for the treatment of urea-cycle disorders. patient perspectives. Peña-Quintana L, Llarena M, Reyes-Suárez D, Aldámiz-Echevarría L. Patient Prefer Adherence. 2017 Sep. 6; 11:1489-1496. Review Pubmed ID PMID: 23919721] It has been shown that Phenylbutyrate induction of CAMP gene also occurs via interaction with the Vitamin D receptor, like Vitamin D3 itself [REF: Phenylbutyrate induces cathelicidin expression via the vitamin D receptor: Linkage to inflammatory and growth factor cytokines pathways. Kulkarni N N, Yi Z, Huebnken C, Agerberth B, Gudmundsson G H. Mol Immunol. 2015 February; 63(2).530-9. Pubmed ID PMID: 25458314] The synergistic induction of the CAMP gene by the combination of Vitamin D3 and Phenylbutyrate has been developed as a novel treatment for bacterial infections, for instance, for the treatment of tuberculosis. A dosage study was done in humans, and the ideal dose for induction of cathelicidin for the purpose of treating lung infection was 5000 IU Vitamin D3 taken daily, plus 500 mg Phenylbutyrate per dose taken twice per day. [REF: Induction of the human cathelicidin LL-37 as a novel treatment against bacterial infections van der Does A M, Bergman P, Agerberth B, Lindbom L. J Leukoc Biol. 2012 October; 92(4):735-42. Review. Pubmed ID PMID: 22701042] and [REF: Oral intake of phenylbutyrate with or without vitamin D3 upregulates the cathelicidin LL-37 in human macrophages: a dose finding study for treatment of tuberculosis. Mily A, Rekha R S, Kamal S M, Akhtar E, Sarker P, Rahim Z, Gudmundsson G H, Agerberth B, Raqib R. BMC Pulm Med. 2013 Apr. 16; 13:23. doi: 10.1186/1471-2466-13-23. Pubmed ID PMID: 2359070] and [REF: Significant Effects of Oral Phenylbutyrate and Vitamin D3 Adjunctive Therapy in Pulmonary Tuberculosis: A Randomized Controlled Trial. Mily A, Rekha R S, Kamal S M, Arifuzzaman A S, Rahim Z, Khan L, Haq M A, Zaman K, Bergman P, Brighenti S, Gudmundsson G H, Agerberth B, Raqib R. PLoS One. 2015 Sep. 22; 10(9):e0138340. Pubmed ID PMID: 26394045] and [REF: Immune responses in the treatment of drug-sensitive pulmonary tuberculosis with phenylbutyrate and vitamin D3 as host directed therapy. Rekha R S, Mily A, Sultana T, Haq A, Ahmed S, Mostafa Kamal S M, van Schadewijk A, Hiemstra P S, Gudmundsson G H, Agerberth B, Raqib R. BMC Infect Dis 2018 Jul. 4; 18(1).303. doi: 10.1186/s12879-018-3203-9. Pubmed ID PMID. 29973153] Phenylbutyrate has also been tested in a preclinical animal trial, using rabbits, for the treatment of enteropathogenic E. coli-induced diarrhea, with good success. [REF: Treatment with phenylbutyrate in a pre-clinical trial reduces diarrhea due to enteropathogenic Escherichia coli link to cathelicidin induction. Al-Mamun A, Mily A, Sarker P, Tiash S, Navarro A, Akter M, Talukder K A, Islam M F, Agerberth B, Gudmundsson G H, Cravioto A, Raqib R. Microbes Infect. 2013 November; 15(13):939-50. Pubmed ID PMID: 24016414]
[0121] Other compounds have also been shown, more recently, to induce the expression of the CAMP gene, but by Vitamin D3 receptor-independent mechanisms that are not fully understood. For instance, the compound Curcumin induces CAMP gene expression by a non-Vitamin D3 receptor dependent mechanism. [REF: Curcumin induces human cathelicidin antimicrobial peptide gene expression through a vitamin D receptor-independent pathway Guo C, Rosoha E, Lowry M B, Borregaard N, Gombart A F. J Nutr Biochem 2013 May; 24(5):754-9. Pubmed ID PMID: 22841393] Additionally, compounds from the family of stilbenoids, in particular Resveratrol or Pterostilbene, also induce CAMP gene expression by a Vitamin D3 receptor-independent mechanism, which is also synergistic with Vitamin D3. [REF: Synergistic induction of human cathelicidin antimicrobial peptide gene expression by vitamin D and stilbenoids Guo C, Sinnott B, Niu B, Lowry M B, Fantacone M L, Gombart A F. Mol Nutr Food Res. 2014 March; 58(3):528-536. Pubmed ID PMID: 24039193] It has been shown that the manner in which Resveratrol induces cathelicidin expression is by a novel mechanism involving sphingosine-1-phosphate pathway signaling. [REF: Resveratrol stimulates sphingosine-1-phosphate signaling of cathelicidin production. Park K, Elias P M, Hupe M, Borkowski A W, Gallo R L, Shin K O, Lee Y M, Holleran W M, Uchida Y. J Invest Dermatol. 2013 August; 133(8):1942-9. Pubmed ID PMID: 23856934] and [REF: Sphingosine kinase 1 activation enhances epidermal innate immunity through sphingosine-1-phosphate stimulation of cathelicidin production. Jeong S K, Kim Y I, Shin K O, Kim B W, Lee S H, Jean J E, Kim H J, Lee Y M, Mauro T M, Elias P M, Uchida Y, Park K. J Dermatol Sci. 2015 September; 79(3):229-34. Pubmed ID PMID: 26113114] One lipid molecule called Genistein was shown in 2015 also to induce cathelicidin expression by a sphingosine-1-phosphate stimulation mechanism. [REF: The dietary ingredient, genistein, stimulates cathelicidin antimicrobial peptide expression through a novel SIP-dependent mechanism. Park K, Kim Y I, Shin K O, Seo H S, Kim J Y, Mann T, Oda Y, Lee Y M, Holleran W M, Elias P M, Uchida Y. J Nutr Biochem. 2014 July; 25(7).734-40. Pubmed PMID: 24768661] Genistein is a soy (or other plant, such as red clover)-derived isoflavanoid compound that has a multitude of health benefits. [REF: Bioactivity of genistein: A review of in vitro and in vivo studies. Ganai A A, Farooqi H. Biomed Pharmacother. 2015 December; 76:30-8. doi. 10.1016/j.biopha.2015.10.026. Epub 2015 Nov. 10. Review. Pubmed ID PMID: 26653547] Interestingly, Genistein and Resveratrol have been shown to have synergistic anticancer effects (with no reference to cathelicidin gene expression); this highlights that natural compounds of this type often show synergies. [REF: A new class of hybrid anticancer agents inspired by the synergistic effects of curcumin and genistein: Design, synthesis, and anti-proliferative evaluation. Chen Q H, Yu K, Zhang X, Chen G, Hoover A, Leon F, Wang R, Subrahmanyam N, Addo Mekuria E, Harinantenaina Rakotondraibe L. Bioorg Med Chem Lett. 2015 Oct. 15, 25(20):4553-6. doi. 10.1016/j.bmcl.2015.08.064. Epub 2015 Aug. 24. Pubmed ID PMID: 26341135] And again, it should be noted that Curcumin's induction of cathelicidin expression is also by a non-Vitamin D receptor dependent mechanism; but perhaps different from that of Genistein, given their synergistic effects in treating cancer [REF: Curcumin induces human cathelicidin antimicrobial peptide gene expression through a vitamin D receptor-independent pathway. Guo C, Rosoha E, Lowry M B, Borregaard N, Gombart A F. J Nutr Biochem 2013 May; 24(5):754-9. Pubmed ID PMID: 22841393]
[0122] In 2016, a novel family of compounds called aroylated phenylenediamines was developed to achieve the potent induction of the cathelicidin gene, which includes the compound Entinostat, for the treatment of infections such as Cholera. [REF: Potent Inducers of Endogenous Antimicrobial Peptides for Hint Directed Therapy of Infections. Ottosson H, Nylén F, Sarker P, Miraglia E, Bergman P, Gudmundsson G H, Raqib R, Agerberth B, Stromberg R. Sci Rep. 2016 Nov. 9, 6.36692. Pubmed ID PMID: 27827460] and [REF: Entinostat up-regulates the CAMP gene encoding LL-37 via activation of STAT3 and HIF-1α transcription factors. Miraglia E, Nylén F, Johansson K, Arnér E, Cebula M, Farmand S, Ottosson H, Stromberg R, Gudmundsson G H, Agerberth B, Bergman P. Sci Rep. 2016 Sep. 16; 6:33274. Pubmed ID PMID 27633343] and [REF Treatment with Entinostat Heals Experimental Cholera by Affecting Physical and Chemical Barrier Functions of Intestinal Epithelia. Sarker P, Banik A. Stromberg R, Gudmundsson G H, Raqib R, Agerberth B. Antimicrob Agents Chemother. 2017 Jun. 27; 61(7). pii: e02570-16. Pubmed ID PMID: 28438947]
[0123] The combination of Vitamin D3 and Phenylbutyrate has been shown to be effective for the treatment of infections such as tuberculosis, and the aroylated phenylenediamine Entinostat is able to induce cathelicidin gene expression via activation of STAT3 and HIF-1α transcription factor, again to treat cholera. However, until now, no combination of CAMP-inducing compounds has ever been proposed for the potential treatment of Alzheimer's Disease. This is because it has only recently been discovered that the LL-37 peptide can bind to and detoxify the Alzheimer's Disease-related peptide Aβ. Thus, until 2017 when this patent was filed, no one would have considered CAMP gene induction as a potential therapy for Alzheimer's Disease. [REF: Evidence that the Human Innate Immune Peptide LL-37 may be a Binding Partner of Amyloid-β and Inhibitor of Fibril Assembly. De Lorenzi E, Chiari M, Colombo R, Cretich M, Sola L, Vanna R, Gagni P, Bisceglia F, Morasso C, Lin J S, Lee M, McGeer P L, Barron A E. J Alzheimers Dis. 2017; 59(4):1213-1226. Pubmed ID PMID 28731438]
[0124] Levels of cathelicidin in the human body can be measured by quantitative PCR of DNA extracted from white blood cells, by fluorescent ELISA assays of protein levels, or by radioimmunoassays, as disclosed in these two papers: [REF: Oral intake of phenylbutyrate with or without vitamin D3 upregulates the cathelicidin LL-37 in human macrophages: a doe finding study for treatment of tuberculosis. Mily A, Rekha R S, Kamal S M, Akhtar E, Sarker P, Rahim Z, Gudmundsson G H, Agerberth B, Raqib R. BMC Pulm Med. 2013 Apr. 16; 13:23 doi. 10.1186/1471-2466-13-23. Pubmed ID PMID: 23590701] and [REF: PLoS One. 2016 May 6; 11(5):e0152711. Circulating Cathelicidin Concentrations in a Cohort of Healthy Children. Influence of Age, Body Composition, Gender and Vitamin D Status. Stukes T M, Shary J R, Wei W, Ebeling M D, Dezsi K B, Shary F S, Forestieri N E, Hollis B W, Wagner C L. Pubmed ID PMID 27152524]
[0125] We disclose hem a novel polytherapy, i.e., mixture of a number of different compounds, for the purposes of inducing the expression of the cathelicidin gene CAMP (see
[0126] We have shown that this particular combination of six compounds, dissolved in liquid coconut oil, and orally dosed in mice every other day, can induce the expression of the cathelicidin gene in the brain. The particular dosage used to show this brain induction of cathelicidin expression, for the first time, is shown in TABLE 2 below.
TABLE-US-00002 TABLE 2 Dosages for Induction of Cathelicidin Expression in C57BL/6J Mice Dosage Dose per avg mouse Treatment (mg/kg) (mg/two days) Phenylbutyrate 33.33 0.83 Curcumin 50.00 1.25 Bexarotene (Targretin ™) 8.33 0.21 1,25-dihydroxyvitamin D3 5.56E−04 1.67E−05 Resveratrol 41.67 1.04 DHA 66.67 1.67 Coconut oil (MCT oil) 100
[0127] Preliminary studies in wild-type (C57BL/6J) mice using the oral polytherapy treatment, dosed as described in the table above, demonstrated significantly increased levels of cathelicidin gene expression in brain tissue comprised to untreated controls. (
[0128] We have also tested this oral polytherapy using the 5XFAD mouse model as an inflammatory preclinical model of Alzheimer's disease with an aggressive amyloid beta accumulation pathology, to model cerebral amyloidosis with intracellular amyloid beta and amyloid beta plaques beginning to appear as early as 2 months' age. [REF: Neuron loss in the 5XFAD mouse model of Alzheimer's disease correlates with intraneuronal Aβ342 accumulation and Caspase-3 activation Eimer W A, Vassar R. Mol Neurodegener. 2013 Jan. 14; 8:2. Pubmed ID PMID: 23316765] and [REF: Genetic mouse models of brain ageing and Alzheimer's disease. Bilkei-Gorzo A. Pharmacol Ther. 2014 May; 142(2):244-37. Review. Pubmed ID PMID: 24362083] and [REF: Molecular Differences and Similarities Between Alzheimer's Disease and the 5XFAD Transgenic Mouse Model of Amyloidosis Maarouf C L, Kokjohn T A, Whiteside C M, Macias M P, Kalback W M, Sabbagh M N, Beach T G, Vassar R, Roher A E. Biochem Insights. 2013 Nov. 21; 6:1-10. Pubmed ID PMID: 25210460) Experiments commenced at 5 months age. Mice were dosed with the polytherapy as described in Table 2, every other day, for 70 days total. The 5XFAD transgenic model reliably replicates neuropathology and cognitive symptoms of Alzheimer's disease not present in alternative models. In order to obtain sufficient power in our statistical analysis and taking into account the inherent variability in behavioral testing and stereotaxic injections, we used 14-15 mice in each treatment group as well as in the untreated control groups. We compared four groups: (1) treated and (2) untreated wild type C57BL/6J mice, and (3) treated and (4) untreated 5XFAD mice. Mouse studies were carried out with APLAC and IACUC approval.
[0129] We have completed the dosing portion of the study and are in the process of analyzing the data to look for treatment effects on amyloid plaque loads, inflammation, autophagy and cell senescence. As shown in
[0130] Interestingly, in 2015 it was shown that neutrophils and their creation of Neutrophil Extracellular Traps (NETs) play a role in the inflammatory brain pathology in the 5XFAD mouse model of Alzheimer's Disease. It was found that activated neutrophils could extravasate and cross the blood brain barrier, and release NETs inside brain tissue. [REF: Neutrophils promote Alzheimer's disease-like pathology and cognitive decline via LFA-1 integrin. Zenaro E, Pietronigro E, Della Bianca V, Piacentino G, Marongiu L, Budui S, Turano E, Rosi B, Angiari S, Dusi S, Montresor A, Carlucci T, Nani S, Tosadori G, Calciano L, Catalucci D, Berton G, Bonetti B, Constantin G. Nat Med. 2015 August; 21(8):880-6. Pubmed ID PMID: 26214837] Since, as discussed above, the cathelicidin peptide plays a central role in the clearance of neutrophil NETs, which otherwise can be proinflammatory if left in place, it makes sense that the induction of the camp cathelicidin gene in 5XFAD mice was able to enhance their cognitive function, as shown in
[0131] In a prior study in which CAMP induction with Vitamin D3 and Phenylbutyrate to treat tuberculosis, the proper dosing for humans of Vitamin D3 was found to be 5000 IU, and for Phenylbutyrate was 500 mg per dose, twice per day. [REF: Oral intake of phenylbutyrate with or without vitamin D3 upregulates the cathelicidin LL-37 in human macrophages: a dose finding study for treatment of tuberculosis. Mily A, Rekha R S, Kamal S M, Akhtar E, Sarker P, Rahim Z, Gudmundsson G H, Agerberth B, Raqib R. BMC Pulm Med 2013 Apr. 16; 13:23. doi: 10.1186/1471-2466-13-23. Pubmed ID PMID: 23590701] The FDA-recommended and approved initial dosage of the drug Bexarotene is 300 mg/m.sup.2/day. The dosages of the other compounds, Curcumin, Resveratrol, and DHA, could for example be set at typical levels they are provided as GRAS daily supplements: Curcumin, 500 mg per dose, twice per day; Resveratrol, 250 mg per dose, twice per day; and DHA, 500 mg per dose, twice per day. However, since these CAMP-induced compounds are provided in a polytherapy, much lower doses of each or any individual compound may be effective for the intended purpose, in combination with the others.
[0132] It is expected that this synergistic combination of compounds that all help induce cathelicidin expression by causing the expression of the LL-37 peptide in the brain. Without wishing to be bound by theory, this is expected to serve as a useful treatment for Alzheimer's Disease by (1) binding to and detoxifying the Alzheimer's Disease-associated peptide Aβ; (2) enhancing the autophagic clearance of Aβ fibrils and plaques in the brain, as well as the macroautophagy of any dead and damaged tissue within the brain; (3) enhancing tissue regeneration and angiogenesis, improving the oxygenation of brain tissue; (4) enhancing mitochondrial biogenesis in brain cells, and supporting mitochondrial homeostasis; and (5) helping to enhance the clearance of any pathogens that may infect brain tissue, including viruses such as Herpevirus, and bacteria such as Chlamydia pneumoniae and Spirochetes, which are associated with Alzheimer's Disease and dementia. This is a novel approach to inducing the CAMP gene, which may prove beneficial not only for the treatment of Alzheimer's Disease, but for the treatment of other conditions and diseases as well. In the preferred embodiment, a polytherapy of compounds has been intentionally selected, each of which has already been proven to be safe for humans in extensive testing, since this treatment may be most effective if taken regularly.
[0133] The pharmaceutical compositions disclosed herein may utilize one or more active ingredients (and will preferably utilize multiple active ingredients) which may be dissolved, suspended or disposed in various media. Such media may include, for example, various liquid, solid or multistate media such as, for example, emulsions gels or creams. Such media may include liquid media, which may be hydrophobic or may comprise one or more triglycerides or oils. Such media may include, but is not limited to, vegetable oils, fish oils, animal fats, hydrogenated vegetable oils, partially hydrogenated vegetable oils, synthetic triglycerides, modified triglycerides, fractionated triglycerides, and mixtures thereof. Triglycerides used in these pharmaceutical compositions may include those selected from the group consisting of almond oil; babassu oil; borage oil; blackcurrant seed oil; black seed oil; canola oil; castor oil; coconut oil; corn oil; cottonseed oil; evening primrose oil; grapeseed oil; groundnut oil; mustard seed oil; olive oil; palm oil; palm kernel oil; peanut oil; rapeseed oil; safflower oil; sesame oil; shark liver oil; soybean oil; sunflower oil; hydrogenated castor oil; hydrogenated coconut oil; hydrogenated palm oil; hydrogenated soybean oil; hydrogenated vegetable oil; hydrogenated cottonseed and castor oil; partially hydrogenated soybean oil; soy oil; glyceryl tricaproate; glyceryl tricaprylate; glyceryl tricaprate; glyceryl triundecanoate; glyceryl trilaurate; glyceryl trioleate; glyceryl trilinoleate; glyceryl trilinolenate; glyceryl tricaprylate/caprate; glyceryl tricaprylate/caprate/laurate; glyceryl tricaprylate/caprate/linoleate; glyceryl tricaprylate/caprate/stearate; saturated polyglycolized glycerides; linoleic glycerides; caprylic/capric glycerides; modified triglycerides; fractionated triglycerides; and mixtures thereof. The use of coconut oil is especially preferred.
[0134] Various fatty acids may be utilized in the pharmaceutical compositions disclosed herein. These include, without limitation, both long and short chain fatty acids. Examples of such fatty acids include, but are not limited to, docosahexaenoic acid, caprylic acid, capric acid, lauric acid, butyric acid, and pharmaceutically acceptable salts thereof.
[0135] The pharmaceutical compositions disclosed herein may be applied in various manners. Thus, for example, these compositions may be applied as oral, transdermal, transmucosal, intravenous or injected treatments, or via cell-based drug delivery systems. Moreover, these compositions may be applied in a single dose, multi-dose or controlled release fashion.
[0136] The pharmaceutical compositions disclosed herein may be manufactured as tablets, liquids, gels, foams, ointments or powders. In some embodiments, these compositions may be applied as microparticles or nanoparticles.
[0137] In some embodiments, the pharmaceutically acceptable compositions disclosed herein preferably include a mixture of at least four more preferably at least five, and most preferably at least six materials (preferably active materials) selected from the group consisting of phenylbutyrate, bexarotene, curcumin, resveratrol, retinal, phenylbutyrate, cholecalciferol, fatty acids, and pharmaceutically acceptable salts thereof. In other embodiments, the pharmaceutically acceptable compositions disclosed herein preferably include a mixture of at least four more preferably at least five, and most preferably at least six materials (preferably active materials) selected from the group consisting of phenylbutyrate, bexarotene, curcumin, resveratrol, retinol, phenylbutyrate, cholecalciferol, docosahexaenoic acid, caprylic acid, capric acid, lauric acid, and pharmaceutically acceptable salts thereof.
[0138] Various counterions may be utilized in forming pharmaceutically acceptable salts of the materials disclosed herein. One skilled in the art will appreciate that the specific choice of counterion may be dictated by various considerations. However, the use of sodium and hydrochloride salts may be preferred in some applications.
[0139] The above description of the present invention is illustrative, and is not intended to be limiting. It will thus be appreciated that various additions, substitutions and modifications may be made to the above described embodiments without departing from the scope of the present invention. Accordingly, the scope of the present invention should be construed in reference to the appended claims.