Urocortin 2 analogs and uses thereof
09572866 ยท 2017-02-21
Assignee
Inventors
- Wylie W. Vale, Jr.
- Joan M. VAUGHAN (San Diego, CA, US)
- Cindy DONALDSON (San Diego, CA, US)
- Wolfgang FISCHER (Encinitas, CA, US)
- Jean E. F. Rivier (La Jolla, CA)
Cpc classification
Y10T428/13
GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
A61P9/04
HUMAN NECESSITIES
C07K14/57509
CHEMISTRY; METALLURGY
A61K38/2228
HUMAN NECESSITIES
C07K14/4705
CHEMISTRY; METALLURGY
International classification
Abstract
Disclosed are polypeptides that are analogs of urocortin 2 that have pharmacological activity similar to urocortin 2 but have improved water solubility compared to urocortin 2, and pharmaceutical compositions of the polypeptides of the present invention. Also disclosed are polynucleotides encoding the polypeptides, and methods of treating pathophysiological states employing pharmaceutical compositions of the polypeptides and polynucleotides of the present invention. In addition, disclosed are vectors and host cells that include a nucleic acid encoding a polypeptide of the present invention, and kits that include pharmaceutical compositions of the present invention.
Claims
1. An isolated nucleic acid molecule encoding SEQ ID NO: 6 or SEQ ID NO: 11 linked to a heterologous regulatory element.
2. The nucleic acid molecule of claim 1, wherein said nucleic acid is dispersed in a lipid particle, a liposome, a vesicle, a nanosphere, or a nanoparticle.
3. A kit comprising the nucleic acid molecule of claim 1.
4. The isolated nucleic acid molecule of claim 1, wherein the molecule is in a vector.
5. The isolated nucleic acid molecule of claim 4, wherein the vector is in a host cell.
6. The nucleic acid molecule of claim 4, wherein the vector is a viral vector.
7. The nucleic acid molecule of claim 6, wherein the viral vector is an adenoviral vector, a lentiviral vector, or an adeno-associated viral vector.
8. The nucleic acid molecule of claim 5, wherein the host cell is a bacterial cell, a mammalian cell, a plant cell, a yeast cell or an insect cell.
9. The nucleic acid molecule of claim 8, wherein the yeast cell is P. pastoris.
10. The nucleic acid molecule of claim 5, wherein said host cell is a prokaryotic host cell.
11. The nucleic acid molecule of claim 10, wherein the prokaryotic host cell is E. coli, S. tymphimurium, S. marcescens or B. subtilis.
12. The nucleic acid molecule of claim 5, wherein host cell is a mammalian cell.
13. The nucleic acid molecule of claim 12, wherein the mammalian cell is a human cell.
14. A composition comprising a nucleic acid molecule encoding SEQ ID NO: 6 or SEQ ID NO: 11 linked to a heterologous regulatory sequence, dispersed in a pharmaceutically-acceptable, sterile solution.
15. The composition of claim 14, wherein the composition is an injectable solution or dispersion.
16. The composition of claim 14, further comprising one or more of a coating, a surfactant, an antibacterial/antifungal agent, an isotonic agent, or an agent for delaying absorption.
17. A kit comprising the composition of claim 14.
18. A method of producing a polypeptide as set forth in SEQ ID NO: 6 or SEQ ID NO: 11 comprising transferring a nucleic acid molecule encoding SEQ ID NO: 6 or SEQ ID NO: 11, linked to a heterologous regulatory element, into a cell under conditions that allow expression of the nucleic acid molecule, thereby producing the polypeptide.
19. A method of expressing a polypeptide as set forth in SEQ ID NO: 6 or SEQ ID NO: 11 in a host organism comprising transferring a composition a nucleic acid molecule encoding SEQ ID NO: 6 or SEQ ID NO: 11, linked to a heterologous regulatory element and a pharmaceutically-acceptable, sterile solution into said organism.
Description
DESCRIPTION OF ILLUSTRATIVE EMBODIMENTS
(1) The present invention is partly based on the identification of analogs of urocortin 2 that have a similar ability to stimulate cAMP production in cells as compared to urocortin 2, but which are surprisingly and unexpectedly more water soluble than urocortin 2. This increased water solubility allows for increased pharmaceutical application of these agents, and the improved treatment of a variety of pathophysiological states that implicate the HPA axis.
(2) A. Urocortin 2 Analogs
(3) The present invention includes polypeptides that are analogs of urocortin 2 as discussed above. All amino-acid residue sequences are represented herein by formulae whose left and right orientation is in the conventional direction of amino-terminus to carboxy-terminus and by single letter abbreviations. Table 1 sets forth a table of the common amino acids and abbreviations known to those of ordinary skill in the art.
(4) TABLE-US-00001 TABLE 1 Amino Acids 3-Letter Single Letter Amino Acids Abbreviation Abbreviation Alanine Ala A Cysteine Cys C Aspartic acid Asp D Glutamic acid Glu E Phenylalanine Phe F Glycine Gly G Histidine His H Isoleucine Ile I Lysine Lys K Leucine Leu L Methionine Met M Asparagine Asn N Proline Pro P Glutamine Gln Q Arginine Arg R Serine Ser S Threonine Thr T Valine Val V Tryptophan Trp W Tyrosine Tyr Y
(5) It should be noted that a dash at the beginning or end of an amino acid residue sequence indicates a peptide bond to a further sequence of one or more amino-acid residues.
(6) The amino acids described herein are preferred to be in the L isomeric form. However, residues in the D isomeric form can be substituted for any L-amino acid residue, as long as the desired functional property of immunoglobulin binding is retained by the polypeptide. NH.sub.2 at the amino-terminus refers to the free amino group present at the amino terminus of a polypeptide. OH at the carboxy terminus refers to the free carboxy group present at the carboxy terminus of a polypeptide. NH.sub.2 at the carboxy terminus refers to a C-terminal amide present at the carboxy terminus of a polypeptide.
(7) Nonstandard amino acids may be incorporated into proteins by chemical modification of existing amino acids or by artificial synthesis of a protein. A nonstandard amino acid refers to an amino acid that differs in chemical structure from the twenty standard amino acids encoded by the genetic code. Post-translational modification in vivo can also lead to the presence of a nonstandard or amino acid derivative in a protein. The N-terminal NH.sub.2 and C-terminal COOH groups of a protein can also be modified by natural or artificial post-translational modification of a protein.
(8) Various embodiments of the present invention pertain to methods for treating or preventing a pathophysiological state in a subject comprising a pharmaceutical composition comprising a polypeptide or nucleic acid encoding a polypeptide of the present invention as set forth herein.
(9) As used herein, the term polypeptide is a consecutive amino acid segment of greater than two amino acids in length. As set forth herein, the polypeptides of the present invention comprise SEQ ID NO:1. The polypeptides set forth herein can include one or more amino acids attached to the N-terminus of SEQ ID NO:1, wherein the amino acids are hydrophilic amino acids as discussed above. Further, the polypeptides set forth herein can include one or more consecutive amino acids attached to the C-terminus of SEQ ID NO:1. For example, the polypeptide can be a polypeptide that includes 4, 5, 10, 15, 20, 25, 30, 50, 100, 200, 300, 400, 500, 1000 or any number of consecutive amino acids attached to the C-terminus of SEQ ID NO:1. The polypeptide may include 0, 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 35, 40, 50, 100, or more consecutive hydrophilic amino acids attached to the N-terminus of SEQ ID NO:1. One of ordinary skill in the art would understand how to generate a polypeptides of the present invention in view of the disclosure using any of a number of experimental methods well-known to those of skill in the art.
(10) Also encompassed in the present invention are polypeptide variants of the polypeptides as set forth herein. For example, the polypeptide variants may include a certain amount of sequence identity compared to the polypeptides of the present invention. Thus, for example, polypeptide variants may be variants that have an amino acid identity of 80%, 85%, 90%, 95%, 98%, or 99% or more, or any range of amino acid identify derivable therein, with (1) a polypeptide that consists of SEQ ID NO:1 with a R (arginine) moiety attached to the N-terminus of SEQ ID NO:1, (2) SEQ ID NO:2, (3) SEQ ID NO:3, or (4) SEQ ID NO:4.
(11) The present invention may utilize polypeptides purified from a natural source or obtained from recombinantly-produced material. Those of ordinary skill in the art would know how to produce these polypeptides from recombinantly-produced material. This material may use the 20 common amino acids in naturally synthesized proteins, or one or more modified or unusual amino acids. Generally, purified will refer to a composition that has been subjected to fractionation to remove various other proteins, polypeptides, or peptides. Purification may be substantial, in which the polypeptide or equivalent is the predominant species, or to homogeneity, which purification level would permit accurate degradative sequencing.
(12) Amino acid sequence mutants also are encompassed by the present invention, and are included within the definition of polypeptide variants. Amino acid sequence variants of the polypeptide can be substitutional mutants or insertional mutants. Insertional mutants typically involve the addition of material at a non-terminal point in the peptide. This may include the insertion of a few residues, or simply a single residue. The added material may be modified, such as by methylation, acetylation, and the like. Alternatively, additional residues may be added to the N-terminal or C-terminal ends of the peptide.
(13) Amino acid substitutions are generally based on the relative similarity of the amino acid side-chain substituents, or for example, their hydrophobicity, hydrophilicity, charge, size, and the like. An analysis of the size, shape and type of the amino acid side-chain substituents reveals that arginine, lysine and histidine are all positively charged residues; that alanine, glycine and serine are all a similar size; and that phenylalanine, tryptophan and tyrosine all have a generally similar shape. Therefore, based upon these considerations, arginine, lysine and histidine; alanine, glycine and serine; and phenylalanine, tryptophan and tyrosine; are defined herein as biologically functional equivalents.
(14) B. Chimeric Proteins
(15) The present invention also concerns chimeric proteins that include a first amino acid sequence that is a urocortin 2 analog and a second amino acid sequence attached to the N or C-terminus of the urocortin 2 analog. The second amino acid sequence may be any amino acid sequence that includes 2 or more amino acid residues. In some embodiments, the second amino acid sequence is a therapeutic peptide or polypeptide. Examples include amino acid sequences that enhance biological activity of the urocortin 2 analog. Examples include amino acid sequences that facilitate penetration of the urocortin 2 analog across the blood-brain barrier. One example is the low-density lipoprotein receptor binding domain of apolipoprotein B (Spencer and Verma, 2007). In specific embodiments, a lentivirus vector system is used to delivery a fusion protein that includes a urocortin 2 analog fused to a low-density lipoprotein receptor binding domain of apolipoprotein A. The amino acid sequence of the low-density lipoprotein receptor binding domain of apolipoprotein A includes amino acids 3371-3409 of human ApoB (GenBank Accession Number AAH51278), herein after SEQ ID NO:20. Other specific examples of therapeutic amino acid sequences that facilitate translocation of amino acid sequences across cell membranes include the HIV TAT sequence (Nagahara et al., 1998), the third helix of the Antennapedia homeodomain (Antp) (Derossi et al., 1994), and the HSV-1 structural protein VP22 (Elliott and O'Hare, 1997). In other embodiments, the second amino acid sequence is an agent that increases duration of action of the urocortin-2 polypeptide. One non-limiting example is an amino acid sequence encoding Fc or a fragment thereof. Other class of possible second amino acid sequences include agents that can kill cells. For example, the second amino acid sequence may be a toxin, such as gelonin, dodecandrin, tricosanthin, tricokirin, bryodin, mirabilis antiviral protein, barley ribosome-inactivating protein (BRIP), pokeweed antiviral proteins (PAPs), saporins, luffins, momordins, ricin, abrin, diphtheria toxin A, pertussis toxin A subunit, E. coli enterotoxin toxin A subunit, cholera toxin (CTX) and Pseudomonas toxin c-terminal.
(16) The two moieties of the chimeric protein produced by synthetic or recombinant methods may be conjugated by linkers according to methods well known in the art (Brinkmann and Pastan, 1994). As used herein, a linker is a chemical or peptide or polypeptide that links a first amino acid sequence with a second amino acid sequence. Non-limiting examples of linkers include flexible polylinkers, such as one composed of a pentamer of four consecutive glycine resides with a serine residue at the C-terminus. Such a linker may be repeated 1 or more times. Any other linker known to those of ordinary skill in the art is contemplated by the present invention.
(17) It is contemplated that cross-linkers may be implemented to fuse the first amino acid sequence and the second amino acid sequence. Cross-linking reagents are used to form molecular bridges that tie together functional groups of two different molecules. To link two different polypeptides in a step-wise manner, hetero-bifunctional cross-linkers can be used that eliminate unwanted homopolymer formation. Bifunctional cross-linking reagents have been extensively used for a variety of purposes including preparation of affinity matrices, modification and stabilization of diverse structures, identification of binding sites, and structural studies.
(18) In some embodiments, the chimeric protein is further defined as a fusion protein. A fusion protein as used herein refers to a polypeptide encoded by a single recombinant polynucleotide encoding the chimeric protein. The chimeric polypeptides set forth herein may comprises a sequence of any number of additional amino acid residues at either the N-terminus or C-terminus of the chimeric polypeptide.
(19) Chemical derivative refers to a subject polypeptide having one or more residues chemically derivatized by reaction of a functional side group. Such derivatized polypeptides include, for example, those in which free amino groups have been derivatized to form amine, p-toluene sulfonyl groups, carbobenzoxy groups, t-butyloxycarbonyl groups, chioroacetyl groups, or formyl groups. Free carboxyl groups may be derivatized to form salts, methyl and ethyl esters or other types of esters or hydrazides. Chemical derivatives may include those peptides which contain one or more naturally occurring amino acids derivatives of the twenty standard amino acids. For example, 4-hydroxyproline may be substituted for serine; and ornithine may be substituted for lysine. Peptides embraced by the present invention also include peptides having one or more residue additions and/or deletions relative to the specific peptide whose sequence is shown herein, so long as the modified peptide maintains the requisite biological activity.
(20) Additional information regarding urocortin 2 and urocortins can be found in U.S. Patent Application Publication Nos. 20080161235, 20070191592, 20070042954, 20050191650, and 20030032587, and U.S. Pat. Nos. 7,507,794, 7,488,865, 7,459,427, 7,223,846, 7,141,546, 6,838,274, 6,353,152, and 6,214,797, each of the foregoing of which is herein specifically incorporated by reference in its entirety.
(21) C. Polynucleotides Encoding Urocortin 2 Analogs
(22) In certain embodiments the present invention concerns polynucleotides encoding urocortin 2 or analogs of urocortin 2, and uses of such polynucleotides in methods as set forth herein.
(23) The polynucleotide may include additional nucleic acid sequences that do not encode a urocortin 2 analog. The polynucleotides may be derived from genomic DNA, i.e., cloned directly from the genome of a particular organism. The polynucleotide may be a DNA or a RNA.
(24) In some embodiments, the polynucleotides may be complementary DNA (cDNA). cDNA is DNA prepared using messenger RNA (mRNA) as a template. Thus, a cDNA does not contain any interrupted coding sequences and usually contains almost exclusively the coding region(s) for the corresponding protein. In other embodiments, the polynucleotide may be produced synthetically.
(25) It may be advantageous to combine portions of the genomic DNA with cDNA or synthetic sequences to generate specific constructs. For example, where an intron is desired in the ultimate construct, a genomic clone will need to be used. Introns may be derived from other genes in addition to urocortin 2. The cDNA or a synthesized polynucleotide may provide more convenient restriction sites for the remaining portion of the construct and, therefore, would be used for the rest of the sequence.
(26) The polynucleotides encoding urocortin 2 analogs may be naturally-occurring homologous polynucleotide sequences from other organisms. A person of ordinary skill in the art would understand that commonly available experimental techniques can be used to identify or synthesize polynucleotides encoding urocortin analogs. The present invention also encompasses chemically synthesized mutants of these sequences.
(27) Another kind of sequence variant results from codon variation. Because there are several codons for most of the 20 normal amino acids, many different DNAs can encode a urocortin 2 analog. One of ordinary skill in the art would understand these variants.
(28) Allowing for the degeneracy of the genetic code, sequences that have between about 50% and about 75%, or between about 76% and about 99% of nucleotides that are identical to urocortin 2 may be considered as urocortin 2 analogs of the present invention. Sequences that are within the scope the polynucleotides used in the methods set forth herein are those that are capable of base-pairing with a polynucleotide segment set forth above under intracellular conditions.
(29) As stated above, the polynucleotides employed in the methods set forth herein may be full length genomic or cDNA copies, or large fragments thereof. The present invention also may employ shorter oligonucleotides. Sequences of 12 bases long should occur only once in the human genome and, therefore, suffice to specify a unique target sequence.
(30) In certain embodiments, one may wish to employ constructs which include other elements, for example, those which include C-5 propyne pyrimidines. Oligonucleotides which contain C-5 propyne analogues of uridine and cytidine have been shown to bind RNA with high affinity (Wagner et al., 1993).
(31) For those urocortin 2 analogs with a C-terminal amide, the corresponding nucleic acid sequence would be a nucleic acid sequence encoding Gly-X or Gly-X-X, where X is either Arg or Lys.
(32) In some embodiments, the polynucleotides set forth herein encode a chimeric protein that includes a first amino acid sequence that is a urocortin 2 analog and a second amino acid sequence, as discussed above.
(33) D. Pharmaceuticals and Methods for the Treatment of Disease
(34) In additional embodiments, the present invention concerns formulation of one or more of the polynucleotides and/or polypeptides disclosed herein in pharmaceutically-acceptable carriers for administration to a cell, tissue, animal, patient, or subject either alone, or in combination with one or more other modalities of therapy.
(35) Aqueous pharmaceutical compositions of the present invention will have an effective amount of a polypeptide or polynucleotide of the present invention. Such compositions generally will be dissolved or dispersed in a pharmaceutically acceptable carrier or aqueous medium. An effective amount, for the purposes of therapy, is defined as that amount that causes a clinically measurable difference in the condition of the subject. This amount will vary depending on the substance, the condition of the patient, the type of treatment, etc.
(36) The phrases pharmaceutically or pharmacologically acceptable refer to molecular entities and compositions that do not produce a significant adverse, allergic or other untoward reaction when administered to an animal, or human. As used herein, pharmaceutically acceptable carrier includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents and the like. The use of such media and agents for pharmaceutically active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the active ingredients, its use in the therapeutic compositions is contemplated.
(37) In addition to the compounds formulated for parenteral administration, such as those for intravenous or intramuscular injection, other pharmaceutically acceptable forms include, e.g., tablets or other solids for oral administration; time release capsules; and any other form currently used, including creams, lotions, inhalants and the like.
(38) The active compounds of the present invention will often be formulated for parenteral administration, e.g., formulated for injection via the intravenous, intramuscular, subcutaneous, or even intraperitoneal routes. The preparation of an aqueous composition that contains a polypeptide or polynucleotide of the present invention alone or in combination with a conventional therapeutic agent as active ingredients will be known to those of skill in the art in light of the present disclosure. Typically, such compositions can be prepared as injectables, either as liquid solutions or suspensions; solid forms suitable for using to prepare solutions or suspensions upon the addition of a liquid prior to injection can also be prepared; and the preparations can also be emulsified.
(39) The pharmaceutical forms suitable for injectable use include sterile aqueous solutions or dispersions; formulations including sesame oil, peanut oil or aqueous propylene glycol; and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions. In many cases, the form must be sterile and must be fluid to the extent that easy syringability exists. It must be stable under the conditions for manufacture and storage and must be preserved against the contaminating action of microorganisms, such as bacteria and fungi.
(40) The carrier also can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), suitable mixtures thereof, and vegetable oils. The proper fluidity can be maintained, for example, by the use of a coating, such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants. The prevention of the action of microorganisms can be brought about by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, sorbic acid, thimerosal, and the like. In many cases, it will be preferable to include isotonic agents, for example, sugars or sodium chloride. Prolonged absorption of the injectable compositions can be brought about by the use in the compositions of agents delaying absorption, for example, aluminum monostearate and gelatin.
(41) Sterile injectable solutions are prepared by incorporating the active compounds in the required amount in the appropriate solvent with various other ingredients enumerated above, as required, followed by filtered sterilization. Generally, dispersions are prepared by incorporating the various sterilized active ingredients into a sterile vehicle which contains the basic dispersion medium and the required other ingredients from those enumerated above. In the case of sterile powders for the preparation of sterile injectable solutions, the preferred methods of preparation are vacuum-drying and freeze-drying techniques which yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
(42) Upon formulation, solutions will be administered in a manner compatible with the dosage formulation and in such amount as is therapeutically effective. The formulations are easily administered in a variety of dosage forms, such as the type of injectable solutions described above, with even drug release capsules and the like being employable.
(43) The composition can be administered to the subject using any method known to those of ordinary skill in the art. For example, a pharmaceutically effective amount of the composition may be administered intravenously, intracerebrally, intracranially, intrathecally, into the substantia nigra or the region of the substantia nigra, intradermally, intraarterially, intraperitoneally, intralesionally, intratracheally, intranasally, topically, intramuscularly, intraperitoneally, subcutaneously, orally, locally, inhalation (e.g., aerosol inhalation), injection, infusion, continuous infusion, localized perfusion bathing target cells directly, via a catheter, via a lavage, in cremes, in lipid compositions (e.g., liposomes), or by other method or any combination of the forgoing as would be known to one of ordinary skill in the art (Remington's, 1990).
(44) In particular embodiments, the composition is administered to a subject using a drug delivery device. Any drug delivery device is contemplated for use in delivering a pharmaceutically effective amount of a polypeptide or polynucleotide of the present invention.
(45) For parenteral administration in an aqueous solution, for example, the solution should be suitably buffered if necessary and the liquid diluent first rendered isotonic with sufficient saline, mannitol or glucose. These particular aqueous solutions are especially suitable for intravenous, intramuscular, subcutaneous and intraperitoneal administration. In this connection, sterile aqueous media which can be employed will be known to those of skill in the art in light of the present disclosure. For example, one dosage could be dissolved in 1 mL of isotonic NaCl solution and either added to 1000 mL of hypodermoclysis fluid or injected at the proposed site of infusion, (see for example, Remington's Pharmaceutical Sciences (1980)). Some variation in dosage will necessarily occur depending on the condition of the subject being treated. The person responsible for administration will, in any event, determine the appropriate dose for the individual subject.
(46) In certain aspects of the methods of the invention, the route the therapeutic composition is administered may be by parenteral administration. The parenteral administration may be intravenous injection, subcutaneous injection, intramuscular injection, intramedullary injection, ingestion or a combination thereof. In certain aspects, the composition comprising a polypeptide or polynucleotide of the present invention is administered from about 0.1 to about 10 microgram/kg/body weight per dose. In certain aspects, the composition is administered from about 1 to about 5 microgram/kg/body weight per dose. In certain aspects, the composition is administered from about 1.2 to about 3.6 microgram/kg/body weight per dose. In certain aspects, the composition is administered from about 1.2 to about 2.4 microgram/kg/body weight per dose. In preferred aspects, the amount of polypeptide or polynucleotide of the present invention administered per dose may be about 0.1, about 0.2, about 0.3, about 0.4, about 0.5, about 0.6, about 0.7, about 0.8, about 0.9, about 1.0, about 1.1, about 1.2, about 1.3, about 1.4, about 1.5, about 1.6, about 1.7, about 1.8, about 1.9, about 2.0, about 2.1, about 2.2, about 2.3, about 2.4, about 2.5, about 2.6, about 2.7, about 2.8, about 2.9, about 3.0, about 3.1, about 3.2, about 3.3, about 3.4, about 3 5, about 3.6, about 3.7, about 3.8, about 3.9, about 4.0, about 4.1, about 4.2, about 4.3, about 4.4, about 4.5, about 4.6, about 4.7, about 4.8, about 4.9, about 5.0, about 5.1, about 5.2, about 5.3, about 5.4, about 5.5, about 5.6, about 5.7, about 5.8, about 5.9, about 6.0, about 6.1, about 6.2, about 6.3, about 6.4, about 6.5, about 6.6, about 6.7, about 6.8, about 6.9, about 7.0, about 7.1, about 7.2, about 7.3, about 7.4, about 7.5, about 7.6, about 7.7, about 7.8, about 7.9, about 8.0, about 8.1, about 8.2, about 8.3, about 8.4, about 8.5, about 8.6, about 8.7, about 8.8, about 8.9, about 9.0, about 9.1, about 9.2, about 9.3, about 9.4, about 9.5, about 9.6, about 9.7, about 9.8, about 9.9, about 10.0, or more micrograms/kg/body.
(47) Formulation of pharmaceutically-acceptable excipients and carrier solutions is well-known to those of skill in the art, as is the development of suitable dosing and treatment regimens for using the particular compositions described herein in a variety of treatment regimens, including e.g., oral, parenteral, intravenous, intranasal, and intramuscular administration and formulation.
(48) The term alimentary delivery refers to the administration, directly or otherwise, to a portion of the alimentary canal of an animal. The term alimentary canal refers to the tubular passage in an animal that functions in the digestion and absorption of food and the elimination of food residue, which runs from the mouth to the anus, and any and all of its portions or segments, e.g., the oral cavity, the esophagus, the stomach, the small and large intestines and the colon, as well as compound portions thereof such as, e.g., the gastro-intestinal tract. Thus, the term alimentary delivery encompasses several routes of administration including, but not limited to, oral, rectal, endoscopic and sublingual/buccal administration. A common requirement for these modes of administration is absorption over some portion or all of the alimentary tract and a need for efficient mucosal penetration of the agent so administered.
(49) In certain applications, the pharmaceutical compositions disclosed herein may be delivered via oral administration to an animal, patient, or subject. As such, these compositions may be formulated with an inert diluent or with an assimilable edible carrier, or they may be enclosed in hard- or soft-shell gelatin capsule, or they may be compressed into tablets, or they may be incorporated directly with the food of the diet.
(50) The active components may even be incorporated with excipients and used in the form of ingestible tablets, buccal tables, troches, capsules, elixirs, suspensions, syrups, wafers, and the like (Mathiowitz et al., 1997; Hwang et al., 1998; U.S. Pat. Nos. 5,641,515; 5,580,579 and 5,792,451, each specifically incorporated herein by reference in its entirety). The tablets, troches, pills, capsules and the like may also contain the following: a binder, as gum tragacanth, acacia, cornstarch, or gelatin; excipients, such as dicalcium phosphate; a disintegrating agent, such as corn starch, potato starch, alginic acid and the like; a lubricant, such as magnesium stearate; and a sweetening agent, such as sucrose, lactose or saccharin may be added or a flavoring agent, such as peppermint, oil of wintergreen, or cherry flavoring. When the dosage unit form is a capsule, it may contain, in addition to materials of the above type, a liquid carrier. Various other materials may be present as coatings or to otherwise modify the physical form of the dosage unit. For instance, tablets, pills, or capsules may be coated with shellac, sugar, or both. A syrup of elixir may contain the active component sucrose as a sweetening agent methyl and propylparabens as preservatives, a dye and flavoring, such as cherry or orange flavor. Of course, any material used in preparing any dosage unit form should be pharmaceutically pure and substantially non-toxic in the amounts employed. In addition, the active compounds may be incorporated into sustained-release preparation and formulations.
(51) Typically, these formulations may contain at least about 0.1% of the active compound or more, although the percentage of the active ingredient(s) may, of course, be varied and may conveniently be between about 1 or 2% and about 60% or 70% or more of the weight or volume of the total formulation. Naturally, the amount of active compound(s) in each therapeutically useful composition may be prepared is such a way that a suitable dosage will be obtained in any given unit dose of the compound. Factors such as solubility, bioavailability, biological half-life, route of administration, product shelf life, as well as other pharmacological considerations will be contemplated by one skilled in the art of preparing such pharmaceutical formulations, and as such, a variety of dosages and treatment regimens may be desirable.
(52) Therapeutics administered by the oral route can often be alternatively administered by the lower enteral route, i.e., through the anal portal into the rectum or lower intestine. Rectal suppositories, retention enemas or rectal catheters can be used for this purpose and may be preferred when patient compliance might otherwise be difficult to achieve (e.g., in pediatric and geriatric applications, or when the patient is vomiting or unconscious). Rectal administration may result in more prompt and higher blood levels than the oral route, but the converse may be true as well (Harvey, 1990). Because about 50% of the therapeutic that is absorbed from the rectum will bypass the liver, administration by this route significantly reduces the potential for first-pass metabolism (Benet et al., 1996).
(53) The term parenteral delivery refers to the administration of a therapeutic of the invention to an animal, patient or subject in a manner other than through the digestive canal. Means of preparing and administering parenteral pharmaceutical compositions are known in the art (see, e.g., Avis, 1990).
(54) Intraluminal administration, for the direct delivery of a therapeutic to an isolated portion of a tubular organ or tissue (e.g., such as an artery, vein, ureter or urethra), may be desired for the treatment of patients with diseases or conditions afflicting the lumen of such organs or tissues. To effect this mode of administration, a catheter or cannula is surgically introduced by appropriate means. After isolation of a portion of the tubular organ or tissue for which treatment is sought, a composition comprising a therapeutic of the invention is infused through the cannula or catheter into the isolated segment. After incubation for from about 1 to about 120 minutes, during which the therapeutic is taken up or in contact with the cells of the interior lumen of the vessel, the infusion cannula or catheter is removed and flow within the tubular organ or tissue is restored by removal of the ligatures which effected the isolation of a segment thereof (Morishita et al., 1993). Therapeutic compositions of the invention may also be combined with a biocompatible matrix, such as a hydrogel material, and applied directly to vascular tissue in vivo.
(55) Intraventricular administration, for the direct delivery of a therapeutic to the brain of a patient, may be desired for the treatment of patients with diseases or conditions afflicting the brain. One method to affect this mode of administration, a silicon catheter is surgically introduced into a ventricle of the brain of a human patient, and is connected to a subcutaneous infusion pump (Medtronic Inc., Minneapolis, Minn.) that has been surgically implanted in the abdominal region (Zimm et al., 1984; Shaw, 1993). The pump is used to inject the therapeutic and allows precise dosage adjustments and variation in dosage schedules with the aid of an external programming device. The reservoir capacity of the pump is 18-20 mL and infusion rates may range from 0.1 mL/h to 1 mL/h. Depending on the frequency of administration, ranging from daily to monthly, and the dose of drug to be administered, ranging from 0.01-100 microgram per kg of body weight, the pump reservoir may be refilled at 3-10 week intervals. Refilling of the pump may be accomplished by percutaneous puncture of the self-sealing septum of the pump.
(56) Intrathecal drug administration, for the introduction of a therapeutic into the spinal column of a patient may be desired for the treatment of patients with diseases of the central nervous system. To effect this route of administration, a silicon catheter may be surgically implanted into the L3-4 lumbar spinal interspace of a human patient, and is connected to a subcutaneous infusion pump which has been surgically implanted in the upper abdominal region (Luer and Hatton, 1993; Ettinger et al., 1978; Yaida et al., 1995). The pump is used to inject the therapeutic and allows precise dosage adjustments and variations in dose schedules with the aid of an external programming device. The administered dose may be similar to that for intraventricular administration.
(57) To effect delivery to areas other than the brain or spinal column via this method, the silicon catheter is configured to connect the subcutaneous infusion pump to, e.g., the hepatic artery, for delivery to the liver (Kemeny et al., 1993).
(58) Vaginal delivery provides local treatment and avoids first pass metabolism, degradation by digestive enzymes, and potential systemic side-effects. Vaginal suppositories (Remington's Pharmaceutical Sciences, 18th Ed., 1990) or topical ointments can be used to effect this mode of delivery.
(59) In certain embodiments, the inventors contemplate the use of liposomes, nanocapsules, microparticles, microspheres, lipid particles, vesicles, and the like, for the introduction of the compositions of the present invention into suitable host cells. In particular, the compositions of the present invention may be formulated for delivery either encapsulated in a lipid particle, a liposome, a vesicle, a nanosphere, or a nanoparticle or the like.
(60) Such formulations may be preferred for the introduction of pharmaceutically-acceptable formulations of the nucleic acids or constructs disclosed herein. The formation and use of liposomes is generally known to those of skill in the art (see for example, Couvreur et al., 1977; Lasic, 1998; which describes the use of liposomes and nanocapsules in the targeted antibiotic therapy for intracellular bacterial infections and diseases). Recently, liposomes were developed with improved serum stability and circulation half-times (Gabizon and Papahadjopoulos, 1988; Allen and Choun, 1987; U.S. Pat. No. 5,741,516, specifically incorporated herein by reference in its entirety). Further, various methods of liposome and liposome like preparations as potential drug carriers have been reviewed (Takakura, 1998; Chandran et al., 1997; Margalit, 1995; U.S. Pat. Nos. 5,567,434; 5,552,157; 5,565,213; 5,738,868 and 5,795,587, each specifically incorporated herein by reference in its entirety).
(61) Liposomes are formed from phospholipids that are dispersed in an aqueous medium and spontaneously form multilamellar concentric bilayer vesicles (also termed multilamellar vesicles (MLVs). MLVs generally have diameters of from 25 nm to 4 .mu.m. Sonication of MLVs results in the formation of small unilamellar vesicles (SUVs) with diameters in the range of 200 to 500 ANG, containing an aqueous solution in the core.
(62) The fate and disposition of intravenously injected liposomes depend on their physical properties, such as size, fluidity, and surface charge. They may persist in tissues for h or days, depending on their composition, and half lives in the blood range from min to several h. Larger liposomes, such as MLVs and LUVs, are taken up rapidly by phagocytic cells of the reticuloendothelial system, but physiology of the circulatory system restrains the exit of such large species at most sites. They can exit only in places where large openings or pores exist in the capillary endothelium, such as the sinusoids of the liver or spleen. Thus, these organs are the predominant site of uptake. On the other hand, SUVs show a broader tissue distribution but still are sequestered highly in the liver and spleen. In general, this in vivo behavior limits the potential targeting of liposomes to only those organs and tissues accessible to their large size. These include the blood, liver, spleen, bone marrow, and lymphoid organs.
(63) Alternatively, the invention provides for pharmaceutically-acceptable nanocapsule formulations of the compositions of the present invention. Nanocapsules can generally entrap compounds in a stable and reproducible way (Baszkin et al., 1987; Quintanar-Guerrero et al., 1998; Douglas et al., 1987). To avoid side effects due to intracellular polymeric overloading, such ultrafine particles (sized around 0.1. mu.m) should be designed using polymers able to be degraded in vivo. Biodegradable polyalkyl-cyanoacrylate nanoparticles that meet these requirements are contemplated for use in the present invention. Such particles may be easily made, as described (Couvreur et al., 1980; 1988; zur Muhlen et al., 1998; Zambaux et al. 1998; Pinto-Alphandry et al., 1995 and U.S. Pat. No. 5,145,684, specifically incorporated herein by reference in its entirety).
(64) E. Treatment of Pathophysiological States
(65) 1. Definitions
(66) A pathophysiological state is defined herein to refer to a disease or health-related condition. Treatment and treating as used herein refer to administration or application of a therapeutic agent to a subject or performance of a procedure or modality on a subject for the purpose of obtaining a therapeutic benefit of a disease or health-related condition. For example, a therapeutic polypeptide of the present invention can be administered for the purpose of reducing temperature in a patient with high body temperature or reducing symptoms of congestive heart failure in a patient with congestive heart failure.
(67) The term therapeutic benefit or therapeutically effective as used throughout this application refers to anything that promotes or enhances the well-being of the subject with respect to the medical treatment of this condition. This includes, but is not limited to, a reduction in the frequency or severity of the signs or symptoms of a disease.
(68) Prevention and preventing are used according to their ordinary and plain meaning to mean acting before or such an act. In the context of a particular disease or health-related condition, those terms refer to administration or application of an agent, drug, or remedy to a subject or performance of a procedure or modality on a subject for the purpose of blocking the onset of a disease or health-related condition.
(69) 2. Pathophysiological States to be Treated or Prevented
(70) The polypeptides and polynucleotides of the present invention can be applied in the treatment or prevention of any disease or health-related condition. The disease or health-related condition can be any disease or health-related condition for which administration of the polypeptides or polynucleotides of the present invention are known or suspected to be of value. Examples include, but are not limited to high body temperature, appetite dysfunction, congestive heart failure, stress, anxiety, and undesirably low levels of ACTH secretion.
(71) 3. Secondary Treatment
(72) Certain embodiments of the present invention provide for the administration or application of one or more secondary forms of therapies for the treatment or prevention of a pathophysiological state.
(73) The secondary form of therapy may be administration of one or more secondary pharmacological agents that can be applied in the treatment or prevention of a pathophysiological state.
(74) If the secondary therapy is a pharmacological agent, it may be administered prior to, concurrently, or following administration of the polypeptide or polynucleotide of the present invention.
(75) The interval between the polypeptide or polynucleotide of the present invention and the secondary therapy may be any interval as determined by those of ordinary skill in the art. For example, the interval may be minutes to weeks. In embodiments where the agents are separately administered, one would generally ensure that a significant period of time did not expire between the time of each delivery, such that each therapeutic agent would still be able to exert an advantageously combined effect on the subject. For example, the interval between therapeutic agents may be about 12 h to about 24 h of each other and, more preferably, within about 6 hours to about 12 h of each other. In some situations, it may be desirable to extend the time period for treatment significantly, however, where several d (2, 3, 4, 5, 6 or 7) to several wk (1, 2, 3, 4, 5, 6, 7 or 8) lapse between the respective administrations. In some embodiments, the timing of administration of a secondary therapeutic agent is determined based on the response of the subject to the the polypeptide or polynucleotide of the present invention.
(76) F. Kits and Diagnostics
(77) In various aspects of the invention, a kit is envisioned containing one or more polypeptides or polynucleotides of the present invention. In some embodiments, the present invention contemplates a kit for preparing and/or administering a therapy of the invention. The kit may comprise one or more sealed vials containing any of the pharmaceutical compositions of the present invention. In some embodiments, the kit may also comprise a suitable container means, which is a container that will not react with components of the kit, such as an eppendorf tube, an assay plate, a syringe, a bottle, or a tube. The container may be made from sterilizable materials such as plastic or glass.
(78) The kit may further include an instruction sheet that outlines one or more methods of the invention, and will follow substantially the same procedures as described herein or are known to those of ordinary skill. The instruction information may be in a computer readable media containing machine-readable instructions that, when executed using a computer, cause the display of a real or virtual procedure of delivering a pharmaceutically effective amount of a therapeutic agent.
(79) G. Transgenic Animals
(80) Transgenic animals and cell lines derived from such animals may find use in certain testing experiments. In one embodiment of the invention, transgenic animals are produced which contain a functional transgene encoding a polypeptide of the present invention. Such transgenic animals may be useful in methods for identifying additional therapeutic applications of the claimed polypeptides. Transgenic animals of the present invention also can be used as models for studying indications.
(81) In one embodiment of the invention, a transgene is introduced into a non-human host to produce a transgenic animal expressing a polypeptide of the present invention. The transgenic animal is produced by the integration of the transgene into the genome in a manner that permits the expression of the transgene. Methods for producing transgenic animals are generally described by Wagner and Hoppe (U.S. Pat. No. 4,873,191; which is incorporated herein by reference), Brinster et al. (1985); which is incorporated herein by reference in its entirety) and in Manipulating the Mouse Embryo; A Laboratory Manual (1994); which is incorporated herein by reference in its entirety).
(82) Transgenic animals may be produced by any method known to those of ordinary skill in the art. For example, they can be produced from the fertilized eggs from a number of animals including, but not limited to reptiles, amphibians, birds, mammals, and fish. Within a particular embodiment, transgenic mice are generated which overexpress a polypeptide of the present invention.
(83) H. Examples
(84) The following examples are included to demonstrate preferred embodiments of the invention. It should be appreciated by those of skill in the art that the techniques disclosed in the examples which follow represent techniques discovered by the inventor to function well in the practice of the invention, and thus can be considered to constitute preferred modes for its practice. However, those of skill in the art should, in light of the present disclosure, appreciate that many changes can be made in the specific embodiments which are disclosed and still obtain a like or similar result without departing from the spirit and scope of the invention.
EXAMPLE 1
Identification of Biologically Active Urocortin 2 Polypeptides
(85) Urocortin 2 precursors were overexpressed in various cell lines, and their function was evaluated. Pancreatic and skin cell lines were infected with mouse urocortin 2 (mUcn 2) lentivirus. The amino acid sequence of mouse urocortin 2 is provided as SEQ ID NO:10. The cells were found to secrete a precursor and a smaller processed zone which contained a urocortin peptide: R.sup.0mUcn 2 (SEQ ID NO:11) which was C-terminally amidated. The peptide was synthesized and bioactivity was determined by the stimulation of cAMP accumulation in A7r5 cells, which express CRFR2. The R.sup.0mUcn 2 peptide was found to be equipotent to mUcn 2(1-38), with EC.sub.50s of 0.05 (0.028-0.1).sup.2 nM and 0.07 (0.03-0.15).sup.11 nM, respectively. It is possible that R.sup.0mUcn 2 could be further processed by aminopeptidases to mUcn 2(1-38). Number of assays are depicted as a superscript.
(86) The corresponding human analog, R.sup.0hUcn 2, was synthesized. This peptide was found to be equipotent to hUcn 2(1-38) in the ability to stimulate cAMP accumulation in A7r5 cells, with EC.sub.50s of 0.027 (0.023-0.031).sup.2 nM and 0.11 (0.058-0.21).sup.11 nM, respectively.
(87) A peptide extended with a hydrophilic arginine residue such as R.sup.0hUcn 2 is likely more soluble, and therefore, a better pharmaceutical agent, than hUcn 2(1-38). As evidence of increased solubility, QC reverse phase HPLC using a trifluoroacetic acid/acetonitrile solvent system showed the retention time of hUcn 2(1-38) was 16.9 minutes whereas the retention time of R.sup.0hUcn 2 was 13.9 minutes, demonstrating significantly increased hydrophilicity for the arginine extended analog. Table 2 provides sequence information of selected Ucn 2 sequences.
(88) TABLE-US-00002 TABLE2 SequenceInformation Sequence Peptide Identifier Sequence hUcn2-OH SEQID IVLSLDVPIGLLQILLEQARARAAREQATTNARILARV NO:1 hUcn2-G- SEQID IVLSLDVPIGLLQILLEQARARAAREQATTNARILARVG OH NO:2 hUcn2-GH- SEQID IVLSLDVPIGLLQILLEQARARAAREQATTNARILARVGH OH NO:3 hUcn2-GHC- SEQID IVLSLDVPIGLLQILLEQARARAAREQATTNARILARVGHC OH NO:4 hUcn2 SEQID IVLSLDVPIGLLQILLEQARARAAREQATTNARILARV- NO:5 NH.sub.2(amidatedattheC-terminus) R.sup.0-hUcn2 SEQID RIVLSLDVPIGLLQILLEQARARAAREQATTNARILAR NO:6 V-NH.sub.2(amidatedattheC-terminus) SRP SEQID HPGSRIVLSLDVPIGLLQILLEQARARAAREQATTNARI (HPGSR- NO:7 LARV-NH.sub.2 hUcn2) (amidatedattheC-terminus) [Cys.sup.1.51 SEQID CSPTRHPGSRIVLSLDVPIGLLQILLEQARARAAREQAT (Acm)]-hUcn NO:8 TNARILARVGHC 2(1-51)-OH) hUcn2 SEQID IPTFQLRPQNSPQTTPRPAASESPSAAPTWPWAAQSHC prohormone NO:9 SPTRHPGSRIVLSLDVPIGLLQILLEQARARAAREQATT NARILARV-NH.sub.2 (amidatedattheC-terminus) mUcn2- SEQID VILSLDVPIGLLRILLEQARYKAARNQAATNAQILAHV OH NO:21 mUcn2 SEQID VILSLDVPIGLLRILLEQARYKAARNQAATNAQILAHV NO:10 (amidatedattheC-terminus) R.sup.0-mUcn2 SEQID RVILSLDVPIGLLRILLEQARYKAARNQAATNAQILAH NO:11 V(amidatedattheC-terminus) mUcn2 SEQID RVILSLDVPIGLLRILLEQARYKAARNQAATNAQILAHV prohormone- NO:22 OH mUcn2 SEQID TPIPTFQLLPQNSLETTPSSVTSESSSGTTTGPSASWSNS prohormone NO:12 KASPYLDTRVILSLDVPIGLLRILLEQARYKAARNQAA TNAQILAHV(amidatedattheC-terminus) R.sup.0-hUcn2- SEQID RIVLSLDVPIGLLQILLEQARARAAREQATTNARILARVG G-OH NO:13 R.sup.0-hUcn2- SEQID RIVLSLDVPIGLLQILLEQARARAAREQATTNARILARVGH GH-OH NO:14 R.sup.0-hUcn2- SEQID RIVLSLDVPIGLLQILLEQARARAAREQATTNARILAR GHC-OH NO:15 VGHC hUcn2 SEQID IPTFQLRPQNSPQTTPRPAASESPSAAPTWPWAAQSHC prohormone- NO:16 SPTRHPGSRIVLSLDVPIGLLQILLEQARARAAREQATT G-OH NARILARVG hUcn2 SEQID IPTFQLRPQNSPQTTPRPAASESPSAAPTWPWAAQSHC prohormone- NO:17 SPTRHPGSRIVLSLDVPIGLLQILLEQARARAAREQATT GH-OH NARILARVGH hUcn2 SEQID IPTFQLRPQNSPQTTPRPAASESPSAAPTWPWAAQSHC prohormone- NO:18 SPTRHPGSRIVLSLDVPIGLLQILLEQARARAAREQATT GHC-OH NARILARVGHC hUcn2 SEQID IPTFQLRPQNSPQTTPRPAASESPSAAPTWPWAAQSHC prohormone- NO:19 SPTRHPGSRIVLSLDVPIGLLQILLEQARARAAREQATT OH NARILARV
(89) Table 3 shows a comparison of amino acid sequences and bioactivity of selected synthetic human or human Ucn 2 peptide analogues. The EC50s were calculated based on protein determination by immunoassay and chromatographic peak height.
(90) TABLE-US-00003 TABLE3 BioactivityofSelectedSynthetic HumanorMouseUcn2Peptides/Analogues cAMPA7r5 SEQUENCE (EC.sub.50,nM) Peptide IDENTIFIER [NumberofAssays] hUcn2-OH SEQID 90.4(47-172)[3] NO:1 hUcn2-G-OH SEQID 6.3(3.4-11.5)[2] NO:2 hUcn2-GH-OH SEQID 2.9(0.93-9.1)[2] NO:3 hUcn2-GHC-OH SEQID 13.9(11.3-17)[2] NO:4 hUcn2 SEQID 0.11(0.058-0.21)[11] NO:5 R.sup.0hUcn2 SEQID 0.027(0.023-0.031) NO:6 [2] SRP SEQID 0.09(0.033-0.22)[2] (HPGSR-hUcn2) NO:7 [Cys.sup.1.51(Acm)]- SEQID 9.5(3.3-26.8)[3] hUcn NO:8 2(1-51)-OH) hUcn2 SEQID 2.3(1.8-3)[2] prohormone NO:9 mUcn2 SEQID 0.07(0.03-0.15)[11] NO:10 R.sup.0-mUcn2 SEQID 0.05(0.03-0.1)[2] NO:11 mUcn2 SEQID 0.53(0.4-0.8)[2] prohormone NO:12
(91) All of the methods disclosed and claimed herein can be made and executed without undue experimentation in light of the present disclosure. While the methods of this invention have been described in terms of preferred embodiments, it will be apparent to those of skill in the art that variations may be applied to the methods described herein without departing from the concept, spirit and scope of the invention. More specifically, it will be apparent that certain agents which are both chemically and physiologically related may be substituted for the agents described herein while the same or similar results would be achieved. All such similar substitutes and modifications apparent to those skilled in the art are deemed to be within the spirit, scope and concept of the invention as defined by the appended claims.
REFERENCES
(92) The following references, to the extent that they provide exemplary procedural or other details supplementary to those set forth herein, are specifically incorporated herein by reference. U.S. Pat. No. 4,659,774 U.S. Pat. No. 4,682,195 U.S. Pat. No. 4,683,202 U.S. Pat. No. 4,816,571 U.S. Pat. No. 4,873,191 U.S. Pat. No. 4,879,236 U.S. Pat. No. 4,959,463 U.S. Pat. No. 5,141,813 U.S. Pat. No. 5,145,684 U.S. Pat. No. 5,264,566 U.S. Pat. No. 5,428,148 U.S. Pat. No. 5,552,157 U.S. Pat. No. 5,554,744 U.S. Pat. No. 5,565,213 U.S. Pat. No. 5,567,434 U.S. Pat. No. 5,574,146 U.S. Pat. No. 5,580,579 U.S. Pat. No. 5,602,244 U.S. Pat. No. 5,641,515 U.S. Pat. No. 5,645,897 U.S. Pat. No. 5,705,629 U.S. Pat. No. 5,738,868 U.S. Pat. No. 5,741,516 U.S. Pat. No. 5,792,451 U.S. Pat. No. 5,795,587 U.S. Pat. No. 5,871,986 U.S. Pat. No. 6,214,797 U.S. Pat. No. 6,353,152 U.S. Pat. No. 6,838,274 U.S. Pat. No. 7,141,546 U.S. Pat. No. 7,223,846 U.S. Pat. No. 7,459,427 U.S. Pat. No. 7,488,865 U.S. Pat. No. 7,507,794 U.S. Patent Publn. 20030032587 U.S. Patent Publn. 20050191650 U.S. Patent Publn. 20070042954 U.S. Patent Publn. 20070191592 U.S. Patent Publn. 20080161235 Allen and Choun, FEBS Lett., 223(1):42-46, 1987. Avis, Remington's Pharmaceutical Sciences, 18.sup.th Ed., Gennaro (Ed.), Mack Publishing Co., Pa., 84:1545-1569, 1990. Baichwal and Sugden, In: Gene Transfer, Kucherlapati (Ed.), Plenum Press, NY, 117-148, 1986. Baszkin et al., J. Pharm. Pharmacol., 39(12):973-977. 1987 Benet et al., In: Goodman & Gilman's The Pharmacological Basis of Therapeutics, Hardman et al. (Eds.), McGraw-Hill, NY, Chap. 1, 9.sup.th Ed., 1996. Benvenisty and Neshif, Proc. Natl. Acad. Sci. USA, 83(24):9551-9555, 1986. Brinster et al., Proc. Natl. Acad. Sci. USA, 82(13):4438-4442, 1985. Chandran et al., Indian J. Exp. Biol., 35(8):801-809., 1997. Chen and Okayama, Mol. Cell Biol., 7(8):2745-2752, 1987. Coffin, In: Virology, Fields et al. (Eds.), Raven Press, NY, 1437-1500, 1990. Coupar et al., Gene, 68:1-10, 1988. Couvreur et al., FEBS Lett., 84(2):323-326, 1977. Couvreur et al., J. Pharm. Sci., 69(2):199-202, 1980. Couvreur, Crit. Rev. Ther. Drug Carrier Syst., 5(1):1-20, 1988. Davidson et al., Biochem. Pharmacol., 77(2):141-50, 2009. Derossi et al., J. Biol. Chem., 269(14):10444-10450, 1994. Douglas et al., Crit. Rev. Ther. Drug Carrier Syst., 3(3):233-61, 1987. Dubensky et al., Proc. Natl. Acad. Sci. USA, 81:7529-7533, 1984. Elliott and O'Hare, Cell, 88(2):223-233, 1997. EP 266,032 EPO 0273085 Ettinger et al., Cancer, 41:1270, 1978. Fechheimer et al., Proc Natl. Acad. Sci. USA, 84:8463-8467, 1987. Ferkol et al., FASEB J., 7:1081-1091, 1993. Fraley et al., Proc. Natl. Acad. Sci. USA, 76:3348-3352, 1979. Freshner, 1992 Friedmann, Science, 244:1275-1281, 1989. Froehler et al., Nucleic Acids Res., 14:5399-5407, 1986. Gabizon and Papahadjopoulos, Proc. Natl. Acad. Sci. USA, 85(18):6949-6953, 1988. Ghosh and Bachhawat, In: Liver Diseases, Targeted Diagnosis and Therapy Using Specific Receptors and Ligands, Wu et al. (Eds.), Marcel Dekker, NY, 87-104, 1991. Gomez-Foix et al., J. Biol. Chem., 267:25129-25134, 1992. Gopal, Mol. Cell Biol., 5:1188-1190, 1985. Graham and Prevec, Biotechnology, 20:363-390, 1992. Graham and Van Der Eb, Virology, 52:456-467, 1973. Graham et al., J. Gen. Virl., 36(1):59-74, 1977. Grunhaus and Horwitz, Seminar in Virology, 3:237-252, 1992. Grunhaus and Horwitz, Seminar in Virology, 3:237-252, 1992. Harland and Weintraub, J. Cell Biol., 101(3):1094-1099, 1985. Harvey, Remington's Pharmaceutical Sciences, 18.sup.th Ed., Gennaro Ed.), Mack Publishing Co., Pa., 35:711, 1990. Hermonat and Muzycska, Proc. Natl. Acad. Sci. USA, 81:6466-6470, 1984. Herz and Gerard, Proc. Natl. Acad. Sci. USA, 90:2812-2816, 1993. Horwich et al. J. Virol., 64:642-650, 1990. Hsu and Hsueh, Nat. Med., 7605-611, 2001. Hwang et al., Crit. Rev. Ther. Drug Carrier Syst., 15(3):243-284, 1998. Kaneda et al., Science, 243:375-378, 1989. Kato et al, J. Biol. Chem., 266:3361-3364, 1991. Kemeny et al., Cancer, 71:1964, 1993. Klein et al., Nature, 327:70-73, 1987. Lasic, Trends Biotechnol., 16(7):307-321, 1998. Lawrence and Latchman, Mini Rev. Med. Chem., 6(10):1119-26, 2006 Le Gal La Salle et al., Science, 259:988-990, 1993. Levrero et al., Gene, 101:195-202, 1991. Luer and Hatton, In: The Annals of Pharmacotherapy, 27:912, 1993. Manipulating the Mouse Embryo; A Laboratory Manual, 2.sup.nd Ed., Hogan et al., (Eds.), Cold Spring Harbor Laboratory Press, 1994 Mann et al., Cell, 33:153-159, 1983. Margalit, Crit. Rev. Ther. Drug Carrier Syst., 12(2-3):233-261, 1995. Mathiowitz et al., Nature, 386(6623):410-414, 1997. Morishita et al., Proc. Natl. Acad. Sci. USA, 90:8474, 1993. Nagahara et al., Am. J. Physiol., 275(4 Pt 1):G740-G748, 1998. Nagahara et al., Nat. Med., 4(12):1449-1452, 1998. Nicolas and Rubenstein, In: Vectors: A survey of molecular cloning vectors and their uses, Rodriguez and Denhardt, eds., Stoneham: Butterworth, pp. 494-513, 1988. Nicolau and Sene, Biochim. Biophys. Acta, 721:185-190, 1982. Nicolau et al., Methods Enzymol., 149:157-176, 1987. Paskind et al., Virology, 67:242-248, 1975. Perales et al., Proc. Natl. Acad. Sci. USA, 91:4086-4090, 1994. Pinto-Alphandary et al., J. Drug Target, 3(2):167-169, 1995. Potter et al., Proc. Natl. Acad. Sci. USA, 81:7161-7165, 1984. Quintanar-Guerrero et al., Drug Dev. Ind. Pharm., 24(12):1113-28, 1998. Raddino et al., G. Ital. Cardiol (Rome), 8(4):236-245, 2007 Ragot et al., Nature, 361:647-650, 1993. Remington's Pharmaceutical Sciences, 15.sup.th ed., 33:624-652, Mack Publishing Company, Easton, Pa., 1980. Remington's Pharmaceutical Sciences, 18th Ed. Mack Printing Company, 1289-1329, 1990. Remington's Pharmaceutical Sciences, 18.sup.th Ed., Gennaro (Ed.), MachPublishing Co., Block, Chapter 87:1609-1614, 1990. Rich et al., Hum. Gene Ther., 4:461-476, 1993. Ridgeway, In: Vectors: A Survey of Molecular Cloning Vectors and Their Uses, Rodriguez et al. (Eds.), Stoneham: Butterworth, 467-492, 1988. Rippe, et al., Mol. Cell Biol., 10:689-695, 1990. Rosenfeld et al., Science, 252:431-434, 1991. Rosenfeld, et al., Cell, 68:143-155, 1992. Sambrook et al., In: Molecular cloning, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 2001. Shaw, Cancer, 72(11):3416, 1993. Stratford-Perricaudet and Perricaudet, In: Human Gene Transfer, Eds, Cohen-Haguenauer and Boiron, John Libbey Eurotext, France, 51-61, 1991. Stratford-Perricaudet et al., Hum. Gene. Ther., 1:241-256, 1990. Takakura, Nippon Rinsho., 56(3):691-695, 1998. Temin, In: Gene Transfer, Kucherlapati (Ed.), NY, Plenum Press, 149-188, 1986. Tur-Kaspa et al., Mol. Cell Biol., 6:716-718, 1986. Wagner et al., Proc. Natl. Acad. Sci. USA 87(9):3410-3414, 1990. Wong et al., Gene, 10:87-94, 1980. Wu and Wu, Adv. Drug Delivery Rev., 12:159-167, 1993. Wu and Wu, Biochemistry, 27: 887-892, 1988. Wu and Wu, J. Biol. Chem., 262:4429-4432, 1987. Wu and Wu, J. Biol. Chem., 262:4429-4432, 1987. Yaida et al., Regul. Pept., 59:193, 1995. Yang and Russell, Proc. Natl. Acad. Sci. USA, 87:4144-4148, 1990. Yang et al. Proc. Natl. Acad. Sci. USA, 87:4144-4148, 1990. Zambaux et al., J. Control Release, 50(1-3):31-40, 1998. Zelenin et al., FEBS Lett., 287(1-2):118-120, 1991. Zimm et al., Cancer Research, 44:1698, 1984. zur Muhlen et al., Eur. J. Pharm. Biopharm., 45(2):149-155, 1998.