Combination anti-estrogen receptor cancer therapy using MUC1 peptides and chemotherapeutics
09572855 ยท 2017-02-21
Assignee
Inventors
Cpc classification
A61K2300/00
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
A61K31/138
HUMAN NECESSITIES
A61K31/138
HUMAN NECESSITIES
International classification
A61K31/138
HUMAN NECESSITIES
Abstract
The invention provides for treatment of MUC1+/ER+/ cancers using an anti-MUC1 therapy, optionally including an anti-ER therapy. In particular, the invention addresses the treatment of tamoxifen-resistant cancers, using MUC1+, and optionally anti-ER therapy.
Claims
1. A method of inhibiting a MUC1-positive/ER-positive tumor cell in a subject comprising administering to said subject a MUC1 peptide of at least 4 consecutive MUC1 residues and no more than 20 consecutive MUC1 residues and comprising the sequence CQC (SEQ ID NO: 4), wherein the amino-terminal cysteine of CQC is covered on its NH.sub.2-terminus by at least one amino acid residue that need not correspond to the native MUC-1 transmembrane sequence, wherein said tumor cell exhibits primary resistance to tamoxifen.
2. The method of claim 1, wherein said peptide comprises at least 5, 6, 7 or 8 consecutive MUC1 residues.
3. The method of claim 1, wherein said peptide contains no more than 10 consecutive residues, 11 consecutive residues, 12 consecutive residues, 13 consecutive residues, 14 consecutive residues, 15 consecutive residues, 16 consecutive residues, 17 consecutive residues, 18 consecutive residues or 19 consecutive residues of MUC1.
4. The method of claim 1, wherein the tumor cell is a carcinoma cell.
5. The method of claim 4, wherein the carcinoma cell is a breast carcinoma cell.
6. The method of claim 1, wherein said peptide is fused to a cell delivery domain.
7. The method of claim 6, wherein said cell delivery domain is poly-D-R, poly-D-P or poly-D-K.
8. The method of claim 1, wherein administering comprises intravenous, intra-arterial, intra-tumoral, subcutaneous, topical or intraperitoneal administration.
9. The method of claim 1, wherein administering comprises local, regional, systemic, or continual administration.
10. The method of claim 1, wherein inhibiting comprises inducing growth arrest of said tumor cell, apoptosis of said tumor cell and/or necrosis of a tumor tissue comprising said tumor cell.
11. The method of claim 1, further comprising administering to said subject an anti-ERtherapy.
12. The method of claim 11, wherein said anti-ER therapy is tamoxifen.
13. The method of claim 11, wherein said anti-ER therapy is administered prior to said peptide.
14. The method of claim 11, wherein said anti-ER therapy is administered after said peptide.
15. The method of claim 11, wherein said anti-ER therapy is administered at the same time as said peptide.
16. The method of claim 1, wherein said subject is a human.
17. The method of claim 1, wherein said peptide is administered at 0.1-500 mg/kg/d.
18. The method of claim 1, wherein said peptide is administered at 10-100 mg/kg/d.
19. The method of claim 1, wherein said peptide is administered daily.
20. The method of claim 19, wherein said peptide is administered daily for 7 days, 2 weeks, 3 weeks, 4 weeks, one month, 6 weeks, 8 weeks, two months, 12 weeks, or 3 months.
21. The method of claim 1, wherein said peptide is administered weekly.
22. The method of claim 21, wherein said peptide is administered weekly for 2 weeks, 3 weeks, 4 weeks, 6 weeks, 8 weeks, 10 weeks, or 12 weeks.
23. The method of claim 1, wherein said peptide comprises all L amino acids.
24. The method of claim 1, wherein said peptide comprises all D amino acids.
25. The method of claim 1, wherein said peptide comprises a mix of L and D amino acids.
26. The method of claim 1, further comprising the step of assessing the expression of MUC1 in a tumor cell of said subject prior to administering said peptide.
27. The method of claim 1, further comprising the step of assessing the expression of ER in a tumor cell of said subject prior to administering said peptide.
28. The method of claim 1, wherein said subject has metastatic cancer.
29. The method of claim 1, wherein said subject has recurrent cancer.
30. The method of claim 1, wherein said peptide is at least 8 residues in length, and at least two non-adjacent residues form a bridge through their side chains.
31. The method of claim 30, wherein the bridge comprises a linker, chemically modified side chains, or hydrocarbon stapling.
32. The method of claim 31, wherein the linker comprises a modification that stabilizes an alpha-helical structure of said peptide.
33. The method of claim 1, wherein ER is overexpressed as compared to a similar non-cancerous cell.
34. The method of claim 4 wherein the carcinoma cell is a prostate carcinoma cell.
35. The method of claim 11, wherein said subject has previously received an anti-ER therapy.
36. A method of inhibiting a MUC1-positive tumor cell in a subject comprising administering to said subject a MUC1 peptide of at least 4 consecutive MUC1 residues and no more than 20 consecutive MUC1 residues and comprising the sequence CQC (SEQ ID NO: 4), wherein the amino-terminal cysteine of CQC is covered on its NH.sub.2-terminus by at least one amino acid residue that need not correspond to the native MUC-1 transmembrane sequence, wherein said tumor cell exhibits resistance to tamoxifen.
Description
BRIEF DESCRIPTION OF THE FIGURES
(1) The following drawings form part of the present specification and are included to further demonstrate certain aspects of the present invention. The invention may be better understood by reference to one or more of these drawings in combination with the detailed.
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
DESCRIPTION OF ILLUSTRATIVE EMBODIMENTS
(11) MUC1 has been studied extensively by the inventors and others for its role in cancer. As discussed above, human MUC1 is heterodimeric glycoprotein, translated as a single polypeptide and cleaved into N- and C-terminal subunits in the endoplasmic reticulum (Ligtenberg et al., 1992; Macao et al., 2006; Levitan et al., 2005). Aberrant overexpression of MUC1, as found in most human carcinomas (Kufe et al., 1984), confers anchorage-independent growth and tumorigenicity (Li et al., 2003a; Huang et al., 2003; Schroeder et al., 2004; Huang et al., 2005). Other studies have demonstrated that overexpression of MUC1 confers resistance to apoptosis induced by oxidative stress and genotoxic anti-cancer agents (Yin and Kufe, 2003b; Ren et al., 2004; Raina et al., 2004; Yin et al., 2004; Raina et al., 2006; Yin et al., 2007).
(12) The family of tethered and secreted mucins functions in providing a protective barrier of the epithelial cell surface. With damage to the epithelial layer, the tight junctions between neighboring cells are disrupted, and polarity is lost as the cells initiate a heregulin-induced repair program (Vermeer et al., 2003). MUC1-N is shed from the cell surface (Abe and Kufe, 1989), leaving MUC1-C to function as a transducer of environmental stress signals to the interior of the cell. In this regard, MUC1-C forms cell surface complexes with members of the ErbB receptor family, and MUC1-C is targeted to the nucleus in the response to heregulin stimulation (Li et al., 2001; Li et al., 2003c). MUC1-C also functions in integrating the ErbB receptor and Wnt signaling pathways through direct interactions between the MUC1 cytoplasmic domain (CD) and members of the catenin family (Huang et al., 2005; Li et al., 2003c; Yamamoto et al., 1997; Li et al., 1998; Li et al., 2001; Li and Kufe, 2001). Other studies have demonstrated that MUC1-CD is phosphorylated by glycogen synthase kinase 3, c-Src, protein kinase C, and c-Ab1 (Raina et al., 2006; Li et al., 1998; Li et al., 2001; Ren et al., 2002).
(13) The mechanisms responsible for nuclear targeting of MUC1-C are unclear. Proteins containing a classical nuclear localization signal (NLS) are imported into the nucleus by first binding to importin and then, in turn, importin (Weis, 2003). The cargo-importin / complex docks to the nuclear pore by binding to nucleoporins and is transported through the pore by a mechanism dependent on the Ran GTPase. Classical NLSs are monopartite with a single cluster of 4-5 basic amino acids or bipartite with two clusters of basic amino acids separated by a linker of 10-12 amino acids. MUC1-CD contains a RRK motif that does not conform to a prototypical monopartite NLS (Hodel et al., 2002). However, certain proteins containing non-classical NLSs are transported through the nuclear pore by binding directly to importin (Kau et al., 2004). Importin associates with several nucleoporins (Ryan and Wente, 2000), including Nup62, which is located on both the cytoplasmic and nucleoplasmic faces of nuclear pore complexes (Percipalle et al., 1997). Other studies have indicated that -catenin is imported into the nucleus by an importin- and nucleoporin-independent mechanism (Suh and Gumbiner, 2003).
(14) In 2006, the inventors reported that MUC1 is imported into the nucleus by a mechanism involving binding to Nup62. They also demonstrated that MUC1 forms oligomers through a CQC motif in the MUC1 cytoplasmic domain and that MUC1 oligomerization is necessary for nuclear import. In 2009, they extended this work to encompass a further understanding of the role that the CQC motif plays in oligomer formation. They demonstrated that short peptides corresponding to this region are able to disrupt MUC1 oligomer formation, preventing transport into the nucleus of tumor cells. These peptides were able to inhibit tumor cell growth, as well as induce apoptosis in such cells and even necrosis of tumor tissue.
(15) Here, in studies using BT-474 cells, the inventors demonstrate that silencing MUC1-C is associated with sensitivity to tamoxifen-induced growth inhibition and loss of clonogenic survival. In concert with these results, overexpression of MUC1-C in MCF-7 cells confers tamoxifen resistance. They also show that MUC1-C forms complexes with ER on the estrogen-responsive promoter of the Rab31 gene and that MUC1-C blocks tamoxifen-induced decreases in ER occupancy. MUC1-C also attenuated tamoxifen-induced decreases in (i) recruitment of the coactivator CREB binding protein, (ii) Rab31 promoter activation, and (ii) Rab31 mRNA and protein levels. The importance of MUC1-C is further supported by the demonstration that targeting MUC1-C in combination with tamoxifen is highly synergistic in the treatment of tamoxifen-resistant breast cancer cells. The present studies using loss and gain of MUC1-C function demonstrate that MUC1-C is sufficient to confer tamoxifen resistance in breast cancer cells. The mechanistic basis for these results is supported by the demonstration that MUC1-C (i) contributes to HER2 and AKT activation, and (ii) blocks tamoxifen-induced decreases in ER occupancy on an estrogen-responsive promoter. The results also demonstrate that targeting MUC1-C is synergistic with tamoxifen in the treatment of tamoxifen-resistant breast cancer cells.
(16) I. Muc1
(17) A. Structure
(18) MUC1 is a mucin-type glycoprotein that is expressed on the apical borders of normal secretory epithelial cells (Kufe et al., 1984). MUC1 forms a heterodimer following synthesis as a single polypeptide and cleavage of the precursor into two subunits in the endoplasmic reticulum (Ligtenberg et al., 1992). The cleavage may be mediated by an autocatalytic process (Levitan et al., 2005). The >250 kDa MUC1 N-terminal (MUC1 N-ter, MUC1-N) subunit contains variable numbers of 20-amino acid tandem repeats that are imperfect with highly conserved variations and are modified by O-linked glycans (Gendler et al., 1988; Siddiqui et al., 1988). MUC1-N is tethered to the cell surface by dimerization with the 23 kDa C-terminal subunit (MUC1 C-ter, MUC1-C), which includes a 58-amino acid extracellular region, a 28-amino acid transmembrane domain and a 72-amino acid cytoplasmic domain (CD; SEQ ID NO:1) (Merlo et al., 1989). The human MUC1 sequence is shown below:
(19) TABLE-US-00001 GSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVP FPFSAQSGAGVPGWGIALLVLVCVLVALAIVYLIALAVCQCRRKNYGQL DIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSLSY TNPAVAATSANL
(20) The bold sequence indicates the CD (SEQ ID NO: 2), and the underlined portion is an oligomer-inhibiting peptide (SEQ ID NO:3) described in the examples.
(21) With transformation of normal epithelia to carcinomas, MUC1 is aberrantly overexpressed in the cytosol and over the entire cell membrane (Kufe et al., 1984; Perey et al., 1992). Cell membrane-associated MUC1 is targeted to endosomes by clathrin-mediated endocytosis (Kinlough et al., 2004). In addition, MUC1-C, but not MUC1-N, is targeted to the nucleus (Baldus et al., 2004; Huang et al., 2003; Li et al., 2003a; Li et al., 2003b; Li et al., 2003c; Wei et al., 2005; Wen et al., 2003) and mitochondria (Ren et al., 2004).
(22) II. ER-Expressing and -Overexpressing Cancers
(23) A. ER in Cancer
(24) Estrogen receptors are a group of proteins found inside cells. They are receptors that are activated by the hormone estrogen (17-estradiol). Two classes of estrogen receptor exist: ER, which is a member of the nuclear hormone family of intracellular receptors, and the estrogen G protein-coupled receptor GPR30 (GPER), which is a G protein-coupled receptor. Once activated by estrogen, the estrogen receptor is able to bind to DNA and regulate the activity of many different genes (i.e., it is a DNA-binding transcription factor). However, it also has additional functions independent of DNA binding.
(25) There are two different forms of the estrogen receptor, usually referred to as and , each encoded by a separate gene (ESR1 and ESR2, respectively). Hormone-activated estrogen receptors form dimers, and, since the two forms are coexpressed in many cell types, the receptors may form ER () or ER () homodimers or ER () heterodimers. Estrogen receptor and show significant overall sequence homology, and both are composed of five domains (listed from the N- to C-terminus; amino acid sequence numbers refer to human ER):(A-F domain).
(26) The N-terminal A/B domain is able to transactivate gene transcription in the absence of bound ligand (e.g., the estrogen hormone). While this region is able to activate gene transcription without ligand, this activation is weak and more selective compared to the activation provided by the E domain. The C domain, also known as the DNA-binding domain, binds to estrogen response elements in DNA. The D domain is a hinge region that connects the C and E domains. The E domain contains the ligand binding cavity as well as binding sites for coactivator and corepressor proteins. The E-domain in the presence of bound ligand is able to activate gene transcription. The C-terminal F domain function is not entirely clear and is variable in length.
(27) Due to alternative RNA splicing, several ER isoforms are known to exist. At least three ER and five ER isoforms have been identified. The ER isoforms receptor subtypes can transactivate transcription only when a heterodimer with the functional ER1 receptor of 59 kDa is formed. The ER3 receptor was detected at high levels in the testis. The two other ER isoforms are 36 and 46 kDa.
(28) Estrogen receptors are over-expressed in around 70% of breast cancer cases, referred to as ER-positive, and can be demonstrated in such tissues using immunohistochemistry. Two hypotheses have been proposed to explain why this causes tumorigenesis, and the available evidence suggests that both mechanisms contribute. First, binding of estrogen to the ER stimulates proliferation of mammary cells, with the resulting increase in cell division and DNA replication, leading to mutations. Second, estrogen metabolism produces genotoxic waste. The result of both processes is disruption of cell cycle, apoptosis and DNA repair, and, therefore, tumour formation. ER is certainly associated with more differentiated tumors, while evidence that ER is involved is controversial. Different versions of the ESR1 gene (encoding ER), have been identified (with single-nucleotide polymorphisms) and are associated with different risks of developing breast cancer.
(29) Endocrine therapy for breast cancer involves selective estrogen receptor modulators (SERMS), such as tamoxifen, which behave as ER antagonists in breast tissue, or aromatase inhibitors, such as anastrozole. ER status is used to determine sensitivity of breast cancer lesions to tamoxifen and aromatase inhibitors Another SERM, raloxifene, has been used as a preventive chemotherapy for women judged to have a high risk of developing breast cancer. Another chemotherapeutic anti-estrogen, ICI 182,780 (Faslodex), which acts as a complete antagonist, also promotes degradation of the estrogen receptor.
(30) B. MUC1 and ER
(31) As discussed above, MUC1-C associates with ER and this interaction is stimulated by 17-estradiol (E2) (14). MUC1-C binds directly to the ER DNA binding domain and stabilizes ER by blocking its ubiquitination and degradation. MUC1-C also enhances ER promoter occupancy, increases recruitment of coactivators and stimulates ER-mediated transcription (14). Notably, tamoxifen had no effect on MUC1-C/ER complexes and MUC1-C antagonized the inhibitory effects of tamoxifen on ER-mediated transcription (14). In other studies, a MUC1-C-induced 38-gene set was applied to the analysis of a database obtained from ER+ breast cancer patients treated with tamoxifen and (i) demonstrated a strong association with ER-dependent signaling, and (ii) predicted failure to tamoxifen treatment, as measured by disease-free and overall survival (15).
(32) III. MUC1 Peptides
(33) A. Structure
(34) The present invention contemplates the design, production and use of various MUC1 peptides. The structural features of these peptides are as follows. First, the peptides have no more than 20 consecutive residues of MUC1. Thus, the term a peptide having no more than 20 consecutive residues, even when including the term comprising, cannot be understood to comprise a greater number of consecutive MUC1 residues. Second, the peptides will contain the CQC motif, and may also include the CQCR motif, CQCRR motif and the CQCRRK motif. Thus, the peptides will have, at a minimum, these three consecutive residues of the MUC1-C domain. Third, the peptides will have at least one amino acid residue attached to the NH.sub.2-terminal side of the first C residue in the CQC motif, such that the first C residue is covered by that at least one amino acid attached thereto. This residue may be native to MUC1 (i.e., from the transmembrane domain), may be selected at random (any of the 20 naturally-occurring amino acids or analogs thereof), or may be part of another peptide sequence (e.g., a tag sequence for purification, a stabilizing sequence, or a cell delivery domain).
(35) In general, the peptides will be 50 residues or less, again, comprising no more than 20 consecutive residues of MUC1. The overall length may be 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50 residues. Ranges of peptide length of 4-50 residues, 5-50 residues, 6-50 residues, 7-50 residues, 7-25, residues, 4-20 residues, 5-20 residues, 6-20 residues, 7-20 residues, and 7-15 residues are contemplated. The number of consecutive MUC1 residues may be 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20. Ranges of consecutive residues of 4-20 residues, 5-20 residues, 6-20 residues, 7-20 residues and 4-15 residues, 5-15, residues, 6-15 residues or 7-15 residues are contemplated.
(36) The present invention may utilize an L-configuration amino acids, D-configuration amino acids, or a mixture thereof. While L-amino acids represent the vast majority of amino acids found in proteins, D-amino acids are found in some proteins produced by exotic sea-dwelling organisms, such as cone snails. They are also abundant components of the peptidoglycan cell walls of bacteria. D-serine may act as a neurotransmitter in the brain. The L and D convention for amino acid configuration refers not to the optical activity of the amino acid itself, but rather to the optical activity of the isomer of glyceraldehyde from which that amino acid can theoretically be synthesized (D-glyceraldehyde is dextrorotary; L-glyceraldehyde is levorotary).
(37) One form of an all-D peptide is a retro-inverso peptide. Retro-inverso modification of naturally-occurring polypeptides involves the synthetic assemblage of amino acids with -carbon stereochemistry opposite to that of the corresponding L-amino acids, i.e., D-amino acids in reverse order with respect to the native peptide sequence. A retro-inverso analogue thus has reversed termini and reversed direction of peptide bonds (NHCO rather than CONH) while approximately maintaining the topology of the side chains as in the native peptide sequence. See U.S. Pat. No. 6,261,569, incorporated herein by reference.
(38) As mentioned above, the present invention contemplates fusing or conjugating a cell delivery domain (also called a cell delivery vector, or cell transduction domain). Such domains are well known in the art and are generally characterized as short amphipathic or cationic peptides and peptide derivatives, often containing multiple lysine and arginine resides (Fischer, 2007). Of particular interest are poly-D-Arg and poly-D-Lys sequences (e.g., dextrorotary residues, eight residues in length), while others are shown in Table 1, below.
(39) TABLE-US-00002 TABLE1 SEQID CDD/CTDPEPTIDES NO QAATATRGRSAASRPTERPRAPARSASRPRRPVE 5 RQIKIWFQNRRMKWKK 6 RRMKWKK 7 RRWRRWWRRWWRRWRR 8 RGGRLSYSRRRFSTSTGR 9 YGRKKRRQRRR 10 RKKRRQRRR 11 YARAAARQARA 12 RRRRRRRR 13 KKKKKKKK 14 GWTLNSAGYLLGKINLKALAALAKXIL 15 LLILLRRRIRKQANAHSK 16 SRRHHCRSKAKRSRHH 17 NRARRNRRRVR 18 RQLRIAGRRLRGRSR 19 KLIKGRTPIKFGK 20 RRIPNRRPRR 21 KLALKLALKALKAALKLA 22 KLAKLAKKLAKLAK 23 GALFLGFLGAAGSTNGAWSQPKKKRKV 24 KETWWETWWTEWSQPKKKRKV 25 GALFLGWLGAAGSTMGAKKKRKV 26 MGLGLHLLVLAAALQGAKSKRKV 27 AAVALLPAVLLALLAPAAANYKKPKL 28 MANLGYWLLALFVTMWTDVGLCKKRPKP 29 LGTYTQDFNKFHTFPQTAIGVGAP 30 DPKGDPKGVTVTVTVTVTGKGDPXPD 31 PPPPPPPPPPPPPP 32 VRLPPPVRLPPPVRLPPP 33 PRPLPPPRPG 34 SVRRRPRPPYLPRPRPPPFFPPRLPPRIPP 35 TRSSRAGLQFPVGRVHRLLRK 36 GIGKFLHSAKKFGKAFVGEIMNS 37 KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK 38 ALWMTLLKKVLKAAAKAALNAVLVGANA 39 GIGAVLKVLTTGLPALISWIKRKRQQ 40 INLKALAALAKKIL 41 GFFALIPKIISSPLPKTLLSAVGSALGGSGGQE 42 LAKWALKQGFAKLKS 43 SMAQDIISTIGDLVKWIIQTVNXFTKK 44 LLGDFFRKSKEKIGKEFKRIVQRIKQRIKDFLANLVPRTES 45 LKKLLKKLLKKLLKKLLKKL 46 KLKLKLKLKLKLKLKLKL 47 PAWRKAFRWAWRMLKKAA 48
(40) Also as mentioned above, peptides modified for in vivo use by the addition, at the amino- and/or carboxyl-terminal ends, of a blocking agent to facilitate survival of the peptide in vivo are contemplated. This can be useful in those situations in which the peptide termini tend to be degraded by proteases prior to cellular uptake. Such blocking agents can include, without limitation, additional related or unrelated peptide sequences that can be attached to the amino and/or carboxyl terminal residues of the peptide to be administered. These agents can be added either chemically during the synthesis of the peptide, or by recombinant DNA technology by methods familiar in the art. Alternatively, blocking agents such as pyroglutamic acid or other molecules known in the art can be attached to the amino- and/or carboxyl-terminal residues.
(41) B. Synthesis
(42) It will be advantageous to produce peptides using the solid-phase synthetic techniques (Merrifield, 1963). Other peptide synthesis techniques are well known to those of skill in the art (Bodanszky et al., 1976; Peptide Synthesis, 1985; Solid Phase Peptide Synthelia, 1984). Appropriate protective groups for use in such syntheses will be found in the above texts, as well as in Protective Groups in Organic Chemistry, 1973. These synthetic methods involve the sequential addition of one or more amino acid residues or suitable protected amino acid residues to a growing peptide chain. Normally, either the amino or carboxyl group of the first amino acid residue is protected by a suitable, selectively removable protecting group. A different, selectively removable protecting group is utilized for amino acids containing a reactive side group, such as lysine.
(43) Using solid phase synthesis as an example, the protected or derivatized amino acid is attached to an inert solid support through its unprotected carboxyl or amino group. The protecting group of the amino or carboxyl group is then selectively removed and the next amino acid in the sequence having the complementary (amino or carboxyl) group suitably protected is admixed and reacted with the residue already attached to the solid support. The protecting group of the amino or carboxyl group is then removed from this newly added amino acid residue, and the next amino acid (suitably protected) is then added, and so forth. After all the desired amino acids have been linked in the proper sequence, any remaining terminal and side group protecting groups (and solid support) are removed sequentially or concurrently, to provide the final peptide. The peptides of the invention are preferably devoid of benzylated or methylbenzylated amino acids. Such protecting group moieties may be used in the course of synthesis, but they are removed before the peptides are used. Additional reactions may be necessary, as described elsewhere, to form intramolecular linkages to restrain conformation.
(44) Aside from the 20 standard amino acids can can be used, there are a vast number of non-standard amino acids. Two of these can be specified by the genetic code, but are rather rare in proteins. Selenocysteine is incorporated into some proteins at a UGA codon, which is normally a stop codon. Pyrrolysine is used by some methanogenic archaea in enzymes that they use to produce methane. It is coded for with the codon UAG. Examples of non-standard amino acids that are not found in proteins include lanthionine, 2-aminoisobutyric acid, dehydroalanine and the neurotransmitter gamma-aminobutyric acid. Non-standard amino acids often occur as intermediates in the metabolic pathways for standard amino acidsfor example ornithine and citrulline occur in the urea cycle, part of amino acid catabolism. Non-standard amino acids are usually formed through modifications to standard amino acids. For example, homocysteine is formed through the transsulfuration pathway or by the demethylation of methionine via the intermediate metabolite S-adenosyl methionine, while hydroxyproline is made by a posttranslational modification of proline.
(45) C. Linkers
(46) Linkers or cross-linking agents may be used to fuse MUC1 peptides to other proteinaceous sequences. Bifunctional cross-linking reagents have been extensively used for a variety of purposes including preparation of affinity matrices, modification and stabilization of diverse structures, identification of ligand and receptor binding sites, and structural studies. Homobifunctional reagents that carry two identical functional groups proved to be highly efficient in inducing cross-linking between identical and different macromolecules or subunits of a macromolecule, and linking of polypeptide ligands to their specific binding sites. Heterobifunctional reagents contain two different functional groups. By taking advantage of the differential reactivities of the two different functional groups, cross-linking can be controlled both selectively and sequentially. The bifunctional cross-linking reagents can be divided according to the specificity of their functional groups, e.g., amino-, sulfhydryl-, guanidino-, indole-, or carboxyl-specific groups. Of these, reagents directed to free amino groups have become especially popular because of their commercial availability, ease of synthesis and the mild reaction conditions under which they can be applied. A majority of heterobifunctional cross-linking reagents contains a primary amine-reactive group and a thiol-reactive group.
(47) In another example, heterobifunctional cross-linking reagents and methods of using the cross-linking reagents are described in U.S. Pat. No. 5,889,155, specifically incorporated herein by reference in its entirety. The cross-linking reagents combine a nucleophilic hydrazide residue with an electrophilic maleimide residue, allowing coupling in one example, of aldehydes to free thiols. The cross-linking reagent can be modified to cross-link various functional groups and is thus useful for cross-linking polypeptides. In instances where a particular peptide does not contain a residue amenable for a given cross-linking reagent in its native sequence, conservative genetic or synthetic amino acid changes in the primary sequence can be utilized.
(48) Another use of linkers in the context of peptides as therapeutics is the so-called Stapled Peptide technology of Aileron Therapeutics. The general approach for stapling a peptide is that two key residues within the peptide are modified by attachment of linkers through the amino acid side chains. Once synthesized, the linkers are connected through a catalyst, thereby creating a bridge the physically constrains the peptide into its native -helical shape. In addition to helping retain the native structure needed to interact with a target molecule, this conformation also provides stability against peptidases as well as cell-permeating properties. U.S. Pat. Nos. 7,192,713 and 7,183,059, describing this technology, are hereby incorporated by reference. See also Schafmeister et al. (2000).
(49) D. Design, Variants and Analogs
(50) The present invention focuses on peptides comprising the sequence CQC. Having identified this key structure in MUC1 oligomer formation, the inventors also contemplate that variants of the CQC sequence may be employed. For example, certain non-natural amino acids that satisfy the structural constraints of the CQC sequence may be substituted without a loss, and perhaps with an improvement in, biological function. In addition, the present inventors also contemplate that structurally similar compounds may be formulated to mimic the key portions of peptide or polypeptides of the present invention. Such compounds, which may be termed peptidomimetics, may be used in the same manner as the peptides of the invention and, hence, also are functional equivalents.
(51) Certain mimetics that mimic elements of protein secondary and tertiary structure are described in Johnson et al. (1993). The underlying rationale behind the use of peptide mimetics is that the peptide backbone of proteins exists chiefly to orient amino acid side chains in such a way as to facilitate molecular interactions, such as those of antibody and/or antigen. A peptide mimetic is thus designed to permit molecular interactions similar to the natural molecule.
(52) Methods for generating specific structures have been disclosed in the art. For example, -helix mimetics are disclosed in U.S. Pat. Nos. 5,446,128; 5,710,245; 5,840,833; and 5,859,184. Methods for generating conformationally restricted -turns and -bulges are described, for example, in U.S. Pat. Nos. 5,440,013; 5,618,914; and 5,670,155. Other types of mimetic turns include reverse and -turns. Reverse turn mimetics are disclosed in U.S. Pat. Nos. 5,475,085 and 5,929,237, and -turn mimetics are described in U.S. Pat. Nos. 5,672,681 and 5,674,976.
(53) Also of interest are peptidomimetic compounds that are designed based upon the amino acid sequences of compounds of the invention that are peptides. Peptidomimetic compounds are synthetic compounds having a three-dimensional conformation motif that is substantially the same as the three-dimensional conformation of a selected peptide. The peptide motif provides the peptidomimetic compound with the ability to inhibit the oligomerization of MUC1. Peptidomimetic compounds can have additional characteristics that enhance their in vivo utility, such as increased cell permeability and prolonged biological half-life. The peptidomimetics typically have a backbone that is partially or completely non-peptide, but with side groups that are identical to the side groups of the amino acid residues that occur in the peptide on which the peptidomimetic is based. Several types of chemical bonds, e.g., ester, thioester, thioamide, retroamide, reduced carbonyl, dimethylene and ketomethylene bonds, are known in the art to be generally useful substitutes for peptide bonds in the construction of protease-resistant peptidomimetics.
(54) IV. Therapies
(55) A. Pharmaceutical Formulations and Routes of Administration
(56) Where clinical applications are contemplated, it will be necessary to prepare pharmaceutical compositions in a form appropriate for the intended application. Generally, this will entail preparing compositions that are essentially free of pyrogens, as well as other impurities that could be harmful to humans or animals.
(57) One will generally desire to employ appropriate salts and buffers to render materials stable and allow for uptake by target cells. Aqueous compositions of the present invention comprise an effective amount of the vector to cells, dissolved or dispersed in a pharmaceutically acceptable carrier or aqueous medium. Such compositions also are referred to as inocula. The phrase pharmaceutically or pharmacologically acceptable refers to molecular entities and compositions that do not produce adverse, allergic, or other untoward reactions when administered to an animal or a human. As used herein, pharmaceutically acceptable carrier includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents and the like. The use of such media and agents for pharmaceutically active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the vectors or cells of the present invention, its use in therapeutic compositions is contemplated. Supplementary active ingredients also can be incorporated into the compositions.
(58) The active compositions of the present invention may include classic pharmaceutical preparations. Administration of these compositions according to the present invention will be via any common route so long as the target tissue is available via that route. Such routes include oral, nasal, buccal, rectal, vaginal or topical route. Alternatively, administration may be by orthotopic, intradermal, subcutaneous, intramuscular, intraperitoneal, or intravenous injection. Such compositions would normally be administered as pharmaceutically acceptable compositions, described supra. Of particular interest is direct intratumoral administration, perfusion of a tumor, or administration local or regional to a tumor, for example, in the local or regional vasculature or lymphatic system, or in a resected tumor bed.
(59) The active compounds may also be administered parenterally or intraperitoneally. Solutions of the active compounds as free base or pharmacologically acceptable salts can be prepared in water suitably mixed with a surfactant, such as hydroxypropylcellulose. Dispersions can also be prepared in glycerol, liquid polyethylene glycols, and mixtures thereof and in oils. Under ordinary conditions of storage and use, these preparations contain a preservative to prevent the growth of microorganisms.
(60) The pharmaceutical forms suitable for injectable use include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions. In all cases the form must be sterile and must be fluid to the extent that easy syringability exists. It must be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms, such as bacteria and fungi. The carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), suitable mixtures thereof, and vegetable oils. The proper fluidity can be maintained, for example, by the use of a coating, such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants. The prevention of the action of microorganisms can be brought about by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, sorbic acid, thimerosal, and the like. In many cases, it will be preferable to include isotonic agents, for example, sugars or sodium chloride. Prolonged absorption of the injectable compositions can be brought about by the use in the compositions of agents delaying absorption, for example, aluminum monostearate and gelatin.
(61) Sterile injectable solutions are prepared by incorporating the active compounds in the required amount in the appropriate solvent with various of the other ingredients enumerated above, as required, followed by filtered sterilization. Generally, dispersions are prepared by incorporating the various sterilized active ingredients into a sterile vehicle which contains the basic dispersion medium and the required other ingredients from those enumerated above. In the case of sterile powders for the preparation of sterile injectable solutions, the preferred methods of preparation are vacuum-drying and freeze-drying techniques which yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
(62) As used herein, pharmaceutically acceptable carrier includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents and the like. The use of such media and agents for pharmaceutical active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the active ingredient, its use in the therapeutic compositions is contemplated. Supplementary active ingredients can also be incorporated into the compositions.
(63) For oral administration the polypeptides of the present invention may be incorporated with excipients and used in the form of non-ingestible mouthwashes and dentifrices. A mouthwash may be prepared incorporating the active ingredient in the required amount in an appropriate solvent, such as a sodium borate solution (Dobell's Solution). Alternatively, the active ingredient may be incorporated into an antiseptic wash containing sodium borate, glycerin and potassium bicarbonate. The active ingredient may also be dispersed in dentifrices, including: gels, pastes, powders and slurries. The active ingredient may be added in a therapeutically effective amount to a paste dentifrice that may include water, binders, abrasives, flavoring agents, foaming agents, and humectants.
(64) The compositions of the present invention may be formulated in a neutral or salt form. Pharmaceutically-acceptable salts include the acid addition salts (formed with the free amino groups of the protein) and which are formed with inorganic acids such as, for example, hydrochloric or phosphoric acids, or such organic acids as acetic, oxalic, tartaric, mandelic, and the like. Salts formed with the free carboxyl groups can also be derived from inorganic bases such as, for example, sodium, potassium, ammonium, calcium, or ferric hydroxides, and such organic bases as isopropylamine, trimethylamine, histidine, procaine and the like.
(65) Upon formulation, solutions will be administered in a manner compatible with the dosage formulation and in such amount as is therapeutically effective. The formulations are easily administered in a variety of dosage forms such as injectable solutions, drug release capsules and the like. For parenteral administration in an aqueous solution, for example, the solution should be suitably buffered if necessary and the liquid diluent first rendered isotonic with sufficient saline or glucose. These particular aqueous solutions are especially suitable for intravenous, intramuscular, subcutaneous and intraperitoneal administration. In this connection, sterile aqueous media which can be employed will be known to those of skill in the art in light of the present disclosure. For example, one dosage could be dissolved in 1 ml of isotonic NaCl solution and either added to 1000 ml of hypodermoclysis fluid or injected at the proposed site of infusion, (see for example, Remington's Pharmaceutical Sciences, 15th Edition, pages 1035-1038 and 1570-1580). Some variation in dosage will necessarily occur depending on the condition of the subject being treated. The person responsible for administration will, in any event, determine the appropriate dose for the individual subject. Moreover, for human administration, preparations should meet sterility, pyrogenicity, general safety and purity standards as required by FDA Office of Biologics standards.
(66) B. Cancer Types and Subjects
(67) Cancer cells to which the methods of the present invention can be applied include generally any cell that expresses MUC1 and ER, or that overexpress MUC1, and are either ER-positive or -negative. An appropriate cancer cell can be a breast cancer, lung cancer, colon cancer, pancreatic cancer, renal cancer, stomach cancer, liver cancer, bone cancer, hematological cancer (e.g., leukemia or lymphoma), neural tissue cancer, melanoma, ovarian cancer, testicular cancer, prostate cancer, cervical cancer, vaginal cancer, or bladder cancer cell. In addition, the methods of the invention can be applied to a wide range of species, e.g., humans, non-human primates (e.g., monkeys, baboons, or chimpanzees), horses, cattle, pigs, sheep, goats, dogs, cats, rabbits, guinea pigs, gerbils, hamsters, rats, and mice.
(68) C. Treatment Methods
(69) Peptides or analogs that inhibit MUC1 oligomer formation are generally useful as anti-cancer therapeutics or prophylactics. They can be administered to mammalian subjects (e.g., MUC1+/ER+/ cancer patients) alone or in conjunction with other drugs and/or radiotherapy, in particular anti-ER therapies. The compounds can also be administered to subjects that are genetically and/or environmentally (due to, for example, physiological and/or environmental factors) susceptible to cancer, e.g., subjects with a family history of cancer (e.g., breast cancer), subjects with chronic inflammation or subject to chronic stress, or subjects that are exposed to natural or non-natural environmental carcinogenic conditions (e.g., excessive exposure to sunlight, industrial carcinogens, or tobacco smoke).
(70) When the methods are applied to subjects with cancer, prior to administration of a compound, the cancer can optionally be tested for MUC1 expression (MUC1 protein or MUC1 mRNA expression) by methods known in the art. In this way, subjects can be identified as having a MUC1-expressing or overexpressing cancer. Such methods can be performed in vitro on cancer cells obtained from a subject. Alternatively, in vivo imaging techniques using, for example, radiolabeled antibodies specific for MUC1 can be performed. In addition, body fluids (e.g., blood or urine) from subjects with cancer can be tested for elevated levels of MUC1 protein or MUC1 protein fragments.
(71) The dosage required depends on the choice of the route of administration; the nature of the formulation; the nature of the patient's illness; the subject's size, weight, surface area, age, and sex; other drugs being administered; and the judgment of the attending physician. Suitable dosages are in the range of 0.0001 mg/kg-100 mg/kg. Wide variations in the needed dosage are to be expected in view of the variety of compounds available and the differing efficiencies of various routes of administration. For example, oral administration would be expected to require higher dosages than administration by intravenous injection. Variations in these dosage levels can be adjusted using standard empirical routines for optimization as is well understood in the art. Administrations can be single or multiple (e.g., 2-, 3-, 4-, 5-, 6-, 8-, 10-, 20-, 50-, 100-, 150-, or more times). Encapsulation of the polypeptide in a suitable delivery vehicle (e.g., polymeric microparticles or implantable devices) may increase the efficiency of delivery, particularly for oral delivery.
(72) D. Combination Therapies
(73) As mentioned above, it is not unusual for ER+ cancers to develop into tamoxifen-resistant cancers. One general approach to such problems combine cancer therapies as a way of increasing their efficacy. While such approaches can be successful, it is entirely unclear whether any two therapies will work in concert to inhibit a given type of cancer. In the context of the present invention, the inventors have shown that MUC1 peptide therapy can be used successfully in conjunction with an anti-ER agent to render resistant cells sensitive to treatment.
(74) To kill cells, inhibit cell growth, inhibit metastasis, inhibit angiogenesis or otherwise reverse or reduce the malignant phenotype of tumor cells, using the methods and compositions of the present invention, one would generally contact a target cell with a MUC1 peptide, and optionally an anti-ER therapy. These therapies would be provided in a combined amount effective to kill or inhibit proliferation of the cell. This process may involve contacting the cells with the agents/therapies at the same time. This may be achieved by contacting the cell with a single composition or pharmacological formulation that includes both therapies, or by contacting the cell with two distinct compositions or formulations, at the same time, wherein one composition includes the MUC1 peptide and the anti-ER therapy.
(75) Alternatively, the MUC1 treatment may precede or follow the anti-ER therapy by intervals ranging from minutes to weeks. In embodiments where the anti-ER therapy and the MUC1 peptide are applied separately to the cell, one would generally ensure that a significant period of time did not expire between the time of each delivery, such that the therapies would still be able to exert an advantageously combined effect on the cell. In such instances, it is contemplated that one would contact the cell with both modalities within about 12-24 hours of each other, within about 6-12 hours of each other, or with a delay time of only about 12 hours. In some situations, it may be desirable to extend the time period for treatment significantly; however, where several days (2, 3, 4, 5, 6 or 7) to several weeks (1, 2, 3, 4, 5, 6, 7 or 8) lapse between the respective administrations.
(76) It also is conceivable that more than one administration of either the MUC1 peptide or the anti-ER therapy will be desired. Various combinations may be employed, where the MUC1 peptide is A and the anti-ER therapy is B, as exemplified below:
(77) TABLE-US-00003 A/B/A B/A/B B/B/A A/A/B B/A/A A/B/B B/B/B/A B/B/A/B A/A/B/B A/B/A/B A/B/B/A B/B/A/A B/A/B/A B/A/A/B B/B/B/A A/A/A/B B/A/A/A A/B/A/A A/A/B/A A/B/B/B B/A/B/B B/B/A/B
Other combinations are contemplated. Again, to achieve cell killing, both therapies are delivered to a cell in a combined amount effective to kill the cell.
(78) E. Additional Combinations
(79) In conjunction with the aforementioned combination therapy, other agents or factors or therapies may be suitable for combined use. These include can include any chemical compound or treatment method that induces DNA damage when applied to a cell. Such agents and factors include radiation and waves that induce DNA damage such as, -irradiation, X-rays, UV-irradiation, microwaves, electronic emissions, and the like. A variety of chemical compounds, also described as chemotherapeutic or genotoxic agents, are intended to be of use in the combined treatment methods disclosed herein. In treating cancer according to the invention, one would contact the tumor cells with an agent in addition to the expression construct. This may be achieved by irradiating the localized tumor site with radiation such as X-rays, UV-light, -rays or even microwaves. Alternatively, the tumor cells may be contacted with the agent by administering to the subject a therapeutically effective amount of a pharmaceutical composition.
(80) Various classes of chemotherapeutic agents are comtemplated for use with in combination with peptides of the present invention, for example, selective estrogen receptor antagonists (SERMs), such as Tamoxifen, 4-hydroxy Tamoxifen (Afimoxfene), Falsodex, Raloxifene, Bazedoxifene, Clomifene, Femarelle, Lasofoxifene, Ormeloxifene, and Toremifene.
(81) Chemotherapeutic agents contemplated to be of use include, e.g., camptothecin, actinomycin-D and mitomycin C. The invention also encompasses the use of a combination of one or more DNA damaging agents, whether radiation-based or actual compounds, such as the use of X-rays with cisplatin or the use of cisplatin with etoposide. The agent may be prepared and used as a combined therapeutic composition, or kit, by combining it with a MUC1 peptide, as described above.
(82) Heat shock protein 90 is a regulatory protein found in many eukaryotic cells. HSP90 inhibitors have been shown to be useful in the treatment of cancer. Such inhibitors include Geldanamycin, 17-(Allylamino)-17-demethoxygeldanamycin, PU-H71 and Rifabutin.
(83) Agents that directly cross-link DNA or form adducts are also envisaged. Agents such as cisplatin, and other DNA alkylating agents may be used. Cisplatin has been widely used to treat cancer, with efficacious doses used in clinical applications of 20 mg/m.sup.2 for 5 days every three weeks for a total of three courses. Cisplatin is not absorbed orally and must therefore be delivered via injection intravenously, subcutaneously, intratumorally or intraperitoneally.
(84) Agents that damage DNA also include compounds that interfere with DNA replication, mitosis and chromosomal segregation. Such chemotherapeutic compounds include Adriamycin, also known as Doxorubicin, Etoposide, Verapamil, Podophyllotoxin, and the like. Widely used in a clinical setting for the treatment of neoplasms, these compounds are administered through bolus injections intravenously at doses ranging from 25-75 mg/m.sup.2 at 21 day intervals for Doxorubicin, to 35-50 mg/m.sup.2 for etoposide intravenously or double the intravenous dose orally. Microtubule inhibitors, such as taxanes, also are contemplated. These molecules are diterpenes produced by the plants of the genus Taxus, and include paclitaxel and docetaxel.
(85) Epidermal growth factor receptor inhibitors, such as Iressa, mTOR, the mammalian target of rapamycin, also known as FK506-binding protein 12-rapamycin associated protein 1 (FRAP1) is a serine/threonine protein kinase that regulates cell growth, cell proliferation, cell motility, cell survival, protein synthesis, and transcription. Rapamycin and analogs thereof (rapalogs) are therefore contemplated for use in combination cancer therapy in accordance with the present invention.
(86) Another possible combination therapy with the peptides claimed herein is TNF- (tumor necrosis factor-alpha), a cytokine involved in systemic inflammation and a member of a group of cytokines that stimulate the acute phase reaction. The primary role of TNF is in the regulation of immune cells. TNF is also able to induce apoptotic cell death, to induce inflammation, and to inhibit tumorigenesis and viral replication.
(87) Agents that disrupt the synthesis and fidelity of nucleic acid precursors and subunits also lead to DNA damage. As such a number of nucleic acid precursors have been developed. Particularly useful are agents that have undergone extensive testing and are readily available. As such, agents such as 5-fluorouracil (5-FU), are preferentially used by neoplastic tissue, making this agent particularly useful for targeting to neoplastic cells. Although quite toxic, 5-FU, is applicable in a wide range of carriers, including topical, however intravenous administration with doses ranging from 3 to 15 mg/kg/day being commonly used.
(88) Other factors that cause DNA damage and have been used extensively include what are commonly known as -rays, x-rays, and/or the directed delivery of radioisotopes to tumor cells. Other forms of DNA damaging factors are also contemplated such as microwaves and UV-irradiation. It is most likely that all of these factors affect a broad range of damage DNA, on the precursors of DNA, the replication and repair of DNA, and the assembly and maintenance of chromosomes. Dosage ranges for x-rays range from daily doses of 50 to 200 roentgens for prolonged periods of time (3 to 4 weeks), to single doses of 2000 to 6000 roentgens. Dosage ranges for radioisotopes vary widely, and depend on the half-life of the isotope, the strength and type of radiation emitted, and the uptake by the neoplastic cells.
(89) The skilled artisan is directed to Remington's Pharmaceutical Sciences 15th Edition, chapter 33, in particular pages 624-652. Some variation in dosage will necessarily occur depending on the condition of the subject being treated. The person responsible for administration will, in any event, determine the appropriate dose for the individual subject. Moreover, for human administration, preparations should meet sterility, pyrogenicity, general safety and purity standards as required by FDA Office of Biologics standards.
(90) The inventors propose that the local or regional delivery of MUC1 peptides to patients with cancer will be a very efficient method for treating the clinical disease. Similarly, the chemo- or radiotherapy may be directed to a particular, affected region of the subject's body. Alternatively, regional or systemic delivery of expression construct and/or the agent may be appropriate in certain circumstances, for example, where extensive metastasis has occurred.
(91) In addition to combining MUC1 therapies with chemo- and radiotherapies, it also is contemplated that combination with immunotherapy, hormone therapy, toxin therapy and surgery. It also should be pointed out that any of the foregoing therapies may prove useful by themselves in treating cancer.
(92) V. Examples
(93) The following examples are included to demonstrate particular embodiments of the invention. It should be appreciated by those of skill in the art that the techniques disclosed in the examples which follow represent techniques discovered by the inventor to function well in the practice of the invention, and thus can be considered to constitute particular modes for its practice. However, those of skill in the art should, in light of the present disclosure, appreciate that many changes can be made in the specific embodiments which are disclosed and still obtain a like or similar result without departing from the spirit and scope of the invention.
Example 1
Materials and Methods
(94) Cell Culture. Human HER2 overexpressing BT-474 breast cancer cells (ATCC) were grown in Dulbecco's Modified Eagle's Medium (DMEM)/Ham F12 medium (1:1 ratio), 10% heat-inactivated fetal bovine serum (HI-FBS), 100 g/ml streptomycin, 100 units/ml penicillin and 2 mM L-glutamine. BT-474 cells were infected with lentiviral vector expressing a MUC1 shRNA (Sigma) or a scrambled control shRNA (CshRNA; Sigma). Human MCF-7 breast cancer and 293T renal cells (ATCC) were maintained in DMEM, 10% HI-FBS, antibiotics and L-glutamine. MCF-7 cells were transfected to stably express a control pHR-CMV-GFP vector or one expressing MUC1-C. For certain experiments performed in the absence of estrogen stimulation, cells were grown in phenol red-free Iscove's Modified Eagle's Medium (IMEM), 10% charcoal-stripped serum (CSS), antibiotics and L-glutamine. Cells were treated with tamoxifen (TAM; Sigma-Aldrich) or 4-hydroxytamoxifen (OHTAM; Sigma-Aldrich) dissolved in DMSO and, as a control, with a corresponding dilution of DMSO. The cells were also treated with the MUC1-C inhibitor GO-203 (Genus Oncology) (Raina et al., 2011).
(95) Immunoblot analysis. Cell lysates were analyzed by immunoblotting with anti-MUC1-C (Panchamoorthy et al., 2011), anti-ER (Santa Cruz Biotechnology), anti-p-HER2, anti-HER2 (Cell Signaling Technology), anti-p-AKT (Cell Signaling Technology), anti-AKT (Santa Cruz Biotechnology) or anti--actin as described (Raina et al., 2011 and Wei et al., 2006) Immune complexes were detected with horseradish peroxidase-conjugated secondary antibodies and enhanced chemiluminescence (GE Healthcare).
(96) Colony formation assays. Cells were seeded in 6-well plates for 24 h and then left untreated or treated with inhibitor. After 7-14 d, the cells were washed and stained with 0.5% crystal violet in 25% methanol. Colonies >30 cells were counted in triplicate wells.
(97) Chromatin immunoprecipitation (ChIP) assays. Soluble chromatin was prepared as described (16) and precipitated with anti-ER (2 g; Thermo Scientific) or a control nonimmune IgG. For re-ChIP assays, complexes from the initial ChIP were eluted and reprecipitated with anti-MUC1-C as described (16). For PCR, 2 l from a 50 l DNA sample was used with the Rab31 promoter primers (16) and 25-35 cycles of amplification. Fold enrichment was calculated as described (17).
(98) Promoter-reporter assays. Control pGL3 or pRab31-Luc constructs (Jin et al., 2012) were transfected into cells with the Renilla plasmid in the presence of Superfect (Qiagen). Luciferase activity was measured using the Promega Dual Glo kit as described (Jin et al., 2012).
(99) qRT-PCR. Total RNA was isolated from cells using an RNeasy Mini kit (Qiagen). cDNAs were synthesized from RNA using the first-strand cDNA synthesis kit (Invitrogen) as described (Jin et al., 2012). The SYBR green qPCR assay kit (Applied Biosystems) was used with 5 l of 20-fold diluted cDNA. The samples were amplified with the ABI Prism 7300 machine (Applied Biosystems). Rab31 and GAPDH primers used for qRT-PCR are listed in Table 1.
(100) TABLE-US-00004 TABLE1 PrimersusedforqRT-PCRofRab31 Rab31 Fwd:5-TCAGCTGCAGCTGTTATCGT-3 Rab31 Rev:5-CTGGACCATGTTCTTTCAGC-3 GAPDH Fwd:5-CCATGGAGAAGGCTGGGG-3 GAPDH Rev:5-CAAAGTTGTCATGGATGACC-3
Example 2
Results
(101) Silencing MUC1-C confers sensitivity of BT-474 cells to tamoxifen treatment. BT-474 breast cancer cells overexpress HER2, are ER positive and are resistant to tamoxifen (Chung et al., 2002 and Ross-Innes et al., 2012). Immunoblot analysis further demonstrated that BT-474 cells express MUC1-C (
(102) Overexpression of the MUC1-C subunit confers resistance of MCF-7 cells to tamoxifen. In contrast to BT-474 cells, MCF-7 breast cancer cells are ER+ and sensitive to tamoxifen. To extend the analysis of MUC1-C involvement in tamoxifen resistance, MCF-7 cells were stably transfected with a control vector or one expressing MUC1-C (
(103) MUC1-C confers MCF-7 cell growth in the absence of estrogen. Growth of MCF-7 cells is dependent on estrogen (Miller et al., 2010). The demonstration that MUC1-C confers resistance to tamoxifen prompted studies to determine whether MCF-7/MUC1-C cells are also estrogen-independent. Culture of MCF-7/vector cells in estrogen-depleted IMEM/CSS medium was associated with inhibition of growth (
(104) MUC1-C abrogrates effects of tamoxifen on ER-mediated gene transcription. To study the effects of MUC1-C on the response of an estrogen-responsive gene to tamoxifen, the inventors first examined ER and MUC1-C occupancy of the Rab31 promoter by ChIP analysis (16). In this context, recent work showed that MUC1-C forms a complex with ER on the Rab31 promoter and activates Rab31 gene transcription in an estrogen-dependent manner (Jin et al., 2012). Tamoxifen treatment of MCF-7/vector and MCF-7/MUC1-C cells had little if any effect on ER levels (
(105) Tamoxifen-resistant breast cancer cells are sensitive to MUC1-C inhibition. The finding that MUC1-C confers tamoxifen resistance invoked the possibility that MUC1-C inhibitors could be effective in tamoxifen-resistant cells. Accordingly, the inventors treated BT-474 cells with the MUC1-C inhibitor GO-203, a cell-penetrating D-amino acid peptide ([R].sub.9-CQCRRKN) (Raina et al., 2011). GO-203 treatment of BT-474 cells was associated with marked downregulation of p-HER2 and p-AKT (
(106) Synergy between GO-203 and tamoxifen in tamoxifen-resistant breast cancer cells. The above findings demonstrate that silencing MUC1-C in BT-474 cells results in tamoxifen sensitivity. To further substantiate that MUC1-C confers tamoxifen resistance, the inventors silenced MUC1-C in MCF-7/MUC1-C cells (
Example 3
Discussion
(107) The overexpression of HER2 in breast cancers has been linked to tamoxifen resistance (De Laurentis et al., 2005). The present studies provide evidence that the MUC1-C oncoprotein promotes resistance to tamoxifen in the HER2 overexpressing BT-474 breast cancer cell model. Previous work had shown that MUC1-C forms a complex with HER2 and contributes to Heregulin-induced downstream signals (Ren et al., 2006; Yin and Kufe, 2003). In concert with those findings, silencing MUC1-C in BT-474 cells was associated with downregulation of p-HER2 levels. Moreover, silencing MUC1-C and thereby suppressing HER2 activation reversed the resistance of BT-474 cells to tamoxifen, consistent with cross-talk between HER2 signaling and the ER pathway. In further support of a role for MUC1-C in resistance of HER2-overexpressing BT-474 cells to tamoxifen, the inventors found that treatment with the MUC1-C inhibitor, GO-203, suppresses HER2 activation and confers sensitivity to tamoxifen-induced inhibition of growth and colony formation. GO-203 disrupts MUC1-C homodimerization and blocks the interaction of MUC1-C with HER2 at the cell membrane (Kufe, 2012). In this way, silencing MUC1-C or blocking its function with an inhibitor results in HER2 downregulation and reversal of tamoxifen resistance. In addition to HER2, activation of EGFR and IGF1-R can confer tamoxifen resistance (Musgrove et al., 2009). Moreover, like EGFR and IGF1-R, HER2 activates downstream signals that confer phosphorylation of ER and can result in tamoxifen-mediated activation or ligand-independence (Osborne et al., 2011, Arpino et al., 2008 and Shou et al., 2004). Activation of pathways downstream to these RTKs can also contribute to tamoxifen resistance (Musgrove 2009). For example, signaling by the PI3K.fwdarw.AKT.fwdarw.mTOR pathway as a consequence of HER2 overexpression or loss of PTEN can regulate responsiveness to tamoxifen (Aprino et al., 2008, Faridi et al., 2003, deGraffenried et al., 2013, deGraffenried et al., 2004, Riggins et al., 2007). However, the precise mechanisms that confer tamoxifen resistance have not been fully defined and may involve activation of mitogenic and anti-apoptotic pathways (Osborne et al., 2011 and Musgrove et al., 2009).
(108) These studies further demonstrate that overexpression of MUC1-C in MCF-7 cells induces tamoxifen resistance. MCF-7 cells constitutively express MUC1; however, MUC1-C levels are not sufficient to activate the PI3K.fwdarw.AKT pathway. Indeed, as has been shown in other cell types (Raina et al., 2004 and Raina et al., 2011), overexpression of MUC1-C in MCF-7 cells was associated with marked upregulation of AKT activation. In this way, MUC1-C interacts directly with PI3K through binding of PI3K SH2 domains to a consensus pYHPM motif in the MUC1-C cytoplasmic domain and activates the PI3K.fwdarw.AKT pathway (Raina et al., 2004, Raina et al., 2011 and, Jin et al., 2012). The PI3K pathway is hyperactivated in response to the development of resistance to estrogen deprivation (Miller et al., 2010). In addition, activation of PI3K signaling has been linked to antiestrogen resistance in breast cancer cells (Miller et al., 2011). In concert with these findings, MCF-7 cells that overexpress MUC1-C were found to be resistant to estrogen deprivation. Moreover, MUC1-C overexpression was sufficient to confer resistance to tamoxifen-induced loss of proliferation and clonogenic survival. Notably, treatment of MCF-7/MUC1-C cells with the MUC1-C inhibitor GO-203 was associated with a block in AKT activation, consistent with MUC1-C function in activating the PI3K.fwdarw.AKT pathway. GO-203 treatment was also associated with reversal of MUC1-C-induced tamoxifen resistance. These findings and those obtained in the BT-474 model of HER2 overexpression indicate that MUC1-C is sufficient to confer tamoxifen resistance by contributing, at least in part, to signaling pathways, such as AKT, that have been linked to ER activity.
(109) Previous findings have demonstrated that MUC1-C binds directly to the ER DNA binding domain and associates with ER on estrogen-responsive promoters (Wei et al., 2006). MUC1-C was also found to enhance ER promoter occupancy and increase recruitment of coactivators (Wei et al., 2006). In the present work, the inventors studied the effects of MUC1-C on ER occupancy in the response to tamoxifen treatment. MUC1-C forms a complex with ER on the ER-responsive Rab31 promoter and activates Rab31 gene transcription in an estrogen-dependent manner (Jin et al., 2012). Treatment with tamoxifen was associated with a decrease in ER occupancy on the Rab31 promoter and this response was blocked by overexpression of MUC1-C. Tamoxifen competes with estrogen for binding to ER and induces changes in ER conformation that block recruitment of coactivators (Brzozowski et al., 1997 and Shang et al., 2000). In this context, tamoxifen treatment was associated with decreases in recruitment of CBP to the Rab31 promoter and this response was also attenuated by a MUC1-C. MUC1-C contributes to the availability of ER/E2 complexes for occupancy of estrogen-responsive elements (Wei et al., 2006). In addition, through a direct interaction with ER and increasing ER/E2 complexes, MUC1-C attenuates the competitive effects of tamoxifen on estrogen binding (Wei et al., 2006). These findings further indicated that overexpression of MUC1-C promotes the transcription of ER-dependent genes and thereby survival of ER+ breast cancer cells (Wei et al., 2006). Thus, the available evidence indicates that, in concert with MUC1-C-induced regulation of the HER2 and AKT pathways, binding of MUC1-C to ER may also contribute to attenuating the effects of tamoxifen.
(110) The MUC1-C cytoplasmic domain contains a CQC motif that is necessary for its dimerization and nuclear localization (Leng et al., 2007). Accordingly, cell penetrating peptides and small molecules have been developed to block the CQC dimerization motif (Raina et al. 2009 and Zhou et al., 2011). In this way, treatment with MUC1-C inhibitors abrogates the formation of MUC1-C homodimers and thereby MUC1-C function in breast cancer cells (Raina et al., 2009 and Raina et al., 2012). The present work demonstrates that treatment of tamoxifen-resistant BT-474 cells with the MUC1-C inhibitor, GO-203, is associated with inhibition of growth and loss of clonogenicity, supporting a lack of cross-resistance to targeting MUC1-C. MCF-7 cells with induced resistance to tamoxifen as a result of overexpressing MUC1-C were also sensitive to GO-203 treatment. These findings invoked the possibility that MUC1-C-induced tamoxifen resistance might be reversed by targeting MUC1-C. Tamoxifen-resistant cells were therefore treated with GO-203 in combination with tamoxifen. The demonstration that GO-203 and tamoxifen are highly synergistic against tamoxifen-resistant cells provided further support that MUC1-C is of importance to tamoxifen resistance. By extension, GO-203 and tamoxifen were also found to be synergistic in the treatment of tamoxifen-sensitive cells. These results lend support to the concept that targeting MUC1-C could be effective in the treatment of patients with breast cancers that develop resistance to tamoxifen. A Phase I trial of GO-203 is presently underway for patients with refractory solid tumors to identify a maximum tolerated dose for Phase II studies. Based on the present findings, this agent may be a candidate for evaluation in the treatment of tamoxifen-resistant breast cancers.
* * *
(111) All of the compositions and/or methods disclosed and claimed herein can be made and executed without undue experimentation in light of the present disclosure. While the compositions and methods of this invention have been described in terms of preferred embodiments, it will be apparent to those of skill in the art that variations may be applied to the compositions and/or methods and in the steps or in the sequence of steps of the method described herein without departing from the concept, spirit and scope of the invention. More specifically, it will be apparent that certain agents which are both chemically and physiologically related may be substituted for the agents described herein while the same or similar results would be achieved. All such similar substitutes and modifications apparent to those skilled in the art are deemed to be within the spirit, scope and concept of the invention as defined by the appended claims.
(112) VI. References
(113) The following references, to the extent that they provide exemplary procedural or other details supplementary to those set forth herein, are specifically incorporated herein by reference: U.S. Pat. No. 5,440,013 U.S. Pat. No. 5,446,128 U.S. Pat. No. 5,475,085 U.S. Pat. No. 5,618,914 U.S. Pat. No. 5,670,155 U.S. Pat. No. 5,672,681 U.S. Pat. No. 5,674,976 U.S. Pat. No. 5,710,245 U.S. Pat. No. 5,840,833 U.S. Pat. No. 5,859,184 U.S. Pat. No. 5,889,155 U.S. Pat. No. 5,929,237 U.S. Pat. No. 6,261,569 U.S. Pat. No. 7,183,059 U.S. Pat. No. 7,192,713 Abe and Kufe, Cancer Res., 49(11):2834-2839, 1989. Arpino et al., Endocr Rev., 29:217-33, 2008. Baldus et al., Clin. Cancer Res., 10(8):2790-2796, 2004. Bodanszky et al., J. Antibiot., 29(5):549-53, 1976. Brzozowski, et al., Nature, 389:753-8, 1997. Chou, et al., Adv Enzyme Regul, 22:27-55, 1984. Chou, et al., Cancer Res., 70:440-6, 2010. Chung et al., Int J Cancer 97:306-12; 2002. deGraffenried, et al., Ann Oncol., 14:1051-6, 2013. deGraffenried et al., Clin Cancer Res., 10:8059-67, 2004. De Laurentiis et al., Clin Cancer Res., 11:4741-8, 2005. Ellis et al., J Clin Oncol., 24:3019-25, 2006. Faridi, et al., Clin Cancer Res., 9:2933-9, 2003. Fischer, Med. Res. Rev., 27(6):755-796, 2007. Gendler et al., J. Biol. Chem., 263:12820-12823, 1988. Gutierrez et al., J Clin Oncol., 23:2469-76, 2005. Hodel et al., Mol. Cell, 10(2):347-58, 2002. Huang et al., Cancer Biol Ther., 2:702-706, 2003. Huang et al., Cancer Res., 65:10413-10422, 2005. Jaber et al., J Mol Endocrinol, 32:307-23, 2004. Jin Oncogene, Jun. 11, 2012. Jin, et al., PLoS One 7:e39432, 2012. Johnson et al., In: Biotechnology And Pharmacy, Pezzuto et al. (Eds.), Chapman and Hall, NY, 1993. Kau et al., Nat. Rev. Cancer, 4(2):106-17, 2004. Kinlough et al., J. Biol. Chem., 279(51):53071-53077, 2004. Kufe et al., Hybridoma, 3:223-232, 1984. Kufe Nature Reviews Cancer, 9:874-85, 2009. Kufe Oncogene, 2012. Leng et al., J Biol Chem., 282:19321-30, 2007. Levitan et al., J. Biol. Chem., 280:33374-33386, 2005. Li et al., Cancer Biol. Ther., 2:187-193, 2003b. Li et al., J. Biol. Chem., 276:35239-35242, 2001. Li et al., J. Biol. Chem., 276:6061-6064, 2001. Li et al., Mol. Cancer Res., 1:765-775, 2003c. Li et al., Mol. Cell Biol., 18:7216-7224, 1998. Li et al., Oncogene, 22:6107-6110, 2003a. Ligtenberg et al., J. Biol. Chem., 267, 6171-6177, 1992. Macao, Nat. Struct. Mol. Biol., 13, 71-76, 2006. Merlo et al., Cancer Res., 49, 6966-6971, 1989. Merrifield, J. Am. Chem. Soc., 85:2149-2154, 1963. Miller et al., J Clin Invest., 120:2406-13, 2010. Miller et al., Cancer Discov., 1:338-51, 2011. Miller et al., J Clin Oncol., 29:4452-61, 2011. Musgrove et al., Nat Rev Cancer 9:631-43, 2009. Osborne et al., Annu Rev Med., 62:233-47, 2011. Panchamoorthy et al., Hybridoma 30:531-5, 2011. Peptide Synthesis, 1985 Percipalle et al., J. Mol. Biol., (4):722-32, 1997. Perey et al., Cancer Res., 52(22):6365-6370, 1992. Pitroda et al., Proc Natl Acad Sci USA, 106:5837-41, 2009. Raina et al., J Biol Chem., 279:20607-12, 2004. Raina et al., EMBO J., 25:3774-3783, 2006. Raina, et al., Cancer Res., 69:5133-41, 2009. Raina et al., Mol Cancer Therapeutics, 10:806-16, 2011. Raina, et al., Int J Oncol., 40:1643-9, 2012. Remington's Pharmaceutical Sciences, 15.sup.th Ed., 3:624-652, 1990 Remington's Pharmaceutical Sciences, 15.sup.th Ed., 1035-1038 and 1570-1580, 1990. Ren et al., J. Biol. Chem., 277:17616-17622, 2002. Ren et al., Cancer Cell, 5:163-175, 2004. Ren et al., Oncogene, 25:20-31, 2006. Riggins et al., Cancer Lett., 256:1-24, 2007. Ross-Innes, et al., Nature; 481:389-93, 2012. Ryan and Wente, Curr. Opin. Cell Biol., 12(3):361-71, 2000. Schafmeister et al., J. Am. Chem. Soc., 122(24): p. 5891-5892, 2000. Schroeder et al., Oncogene, 23:5739-5747, 2004. Shang, et al., Cell, 103:843-52, 2000. Shou, et al., J Natl Cancer Inst., 96:926-35, 2004. Siddiqui et al., Proc. Natl. Acad. Sci. USA, 85:2320-2323, 1988. Solid Phase Peptide Synthelia, 1984 Suh and Gumbiner, Exp. Cell Res., 290(2):447-56, 2003. Vermeer et al., Nature, 422(6929):322-6, 2003. Weber, Advances Protein Chem., 41:1-36, 1991. Wei et al., Cancer Cell, 7:167-178, 2005. Wei et al., Mol Cell, 21:295-305, 2006. Weis, Cell, 112(4):441-51, 2003. Wen et al., J. Biol. Chem., 278:38029-38039, 2003. Yamamoto et al., J. Biol. Chem., 272:12492-12494, 1997. Yin et al., J. Biol. Chem., 279:45721-45727, 2004. Yin et al., J. Biol. Chem., 282:257-266, 2007. Yin and Kufe, J. Biol. Chem., 278:35458-35464, 2003a. Yin and Kufe, J. Biol. Chem., 278:35458-35464, 2003b. Zhou, et al., Mol Pharm., 79:886-93, 2011.