Method of treating metastatic cancer
09567369 ยท 2017-02-14
Assignee
Inventors
Cpc classification
C12N15/63
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
International classification
Abstract
A method of treating metastatic cancer, comprising the steps of (a) treating a metastatic cancer patient with an isolated therapeutic Cystatin C peptide, and (b) observing a reduction in tumor burden is disclosed.
Claims
1. A method of treating glioblastoma, breast cancer, fibrosarcoma, prostate cancer, and melanoma, comprising the step of administering an effective amount of an isolated therapeutic Cystatin C peptide of 16 amino acids, consisting of a peptide sequence selected from the group consisting of SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO:16, SEQ ID NO:17, SEQ ID NO:18, SEQ ID NO:19, SEQ ID NO:20, SEQ ID NO:21, SEQ ID NO:22 and SEQ ID NO:23 to a metastatic cancer patient, wherein the tumor burden is reduced, and wherein the therapeutic Cystatin C peptide is attached to an uptake peptide.
2. The method of claim 1, wherein the therapeutic Cystatin C peptide consists of the peptide sequence selected from the group consisting of SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO: 10, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO:16, SEQ ID NO:17, SEQ ID NO:18, SEQ ID NO:19, SEQ ID NO:20, SEQ ID NO:21, SEQ ID NO:22 and SEQ ID NO:23.
3. The method of claim 2, wherein the therapeutic Cystatin C peptide consists of the peptide sequence selected from the group consisting of SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:8 SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO; 14, SEQ ID NO: 15, SEQ ID NO:16, SEQ ID NO:17, SEQ ID NO:18, SEQ ID NO:19, SEQ ID NO:20, SEQ ID NO:21, SEQ ID NO:22 and SEQ ID NO:23.
4. The method of claim 1, wherein the uptake peptide is a penetratin peptide.
5. The method of claim 4, wherein the penetratin peptide comprises SEQ ID NO:25.
6. The method of claim 1, wherein the therapeutic Cystatin C peptide is additionally attached to a polyethylene glycol (PEG).
7. The method of claim 1, wherein the peptide is delivered by a route selected from the group consisting of intravenous delivery, intradermal delivery, intratumoral delivery, intrathecal delivery and intramuscular delivery.
8. The method of claim 7, wherein the peptide is delivered intravenously.
9. The method of claim 1, wherein the tumor burden is reduced by at least 25% after one month of daily treatment.
10. A chemotherapeutic compound comprising an isolated Cystatin C peptide, wherein the therapeutic Cystatin C peptide consists of the peptide sequence selected from the group consisting of SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13, SEQ ID NO:14, SEQ ID NO:15, SEQ ID NO:16, SEQ ID NO:17, SEQ ID NO:18, SEQ ID NO:19, SEQ ID NO:20, SEQ ID NO:21, SEQ ID NO:22 and SEQ ID NO:23.
11. The method of claim 10, wherein the therapeutic Cystatin C peptide consists of the peptide sequence selected from the group consisting of SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO: 10, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO:16, SEQ ID NO:17, SEQ ID NO:18, SEQ ID NO:19, SEQ ID NO:20 SEQ ID NO:21, SEQ ID NO:22 and SEQ ID NO:23.
12. The method of claim 11, wherein the therapeutic Cystatin C peptide consists of the peptide sequence selected from the group consisting of SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO:16, SEQ ID NO:17, SEQ ID NO:18, SEQ ID NO:19, SEQ ID NO:20, SEQ ID NO:21, SEQ ID NO:22 and SEQ ID NO:23.
13. The compound of claim 10, wherein the therapeutic Cystatin C peptide is additionally attached to an uptake peptide.
14. The compound of claim 13, wherein the uptake peptide is a penetratin peptide.
15. The compound of claim 14, wherein the penetratin peptide comprises SEQ ID NO:25.
16. The compound of claim 10, wherein the therapeutic Cystatin C peptide is additionally attached to a polyethylene glycol (PEG).
Description
DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
DESCRIPTION OF THE INVENTION
(6) In General
(7) The present invention relates to a small internal peptide fragment of Cystatin C or a homologous peptide or related peptide or corresponding DNA fragment from Cystatin C or other cystatins. The fragment, termed the therapeutic Cystatin C peptide, inhibits protein kinase C activity and protein kinase C related pathways. This is a newly discovered function of cystatins that we discovered and that is not related to the common function of cysteine protease inhibition by the cystatins. The present invention relates to this PKC-active, Cystatin C-derived therapeutic peptide or homologues or peptide mimetic compounds or DNA/RNA coding similar sequences to inhibit tumor, tumor malignancy and/or tumor invasion.
(8) Prior work has suggested native cystatin delivery might be useful for therapy of metastatic disease. We have improved on the prior work by describing a completely new mechanism of action for a segment of cystatin that allows us to predict which internal peptide fragments will be therapeutically suitable and link this peptide to a delivery system (preferably a peptide-16 amino acid penetratin sequence) which can dramatically improve the effectiveness of the anti-metastatic peptide agent. Additional advantages of this therapeutic peptide are that the active peptide sequence is derived from a natural protein, it is totally degraded in the body to non-toxic amino acids, and small peptides are only weakly immunogenic, if at all.
(9) Peptide of the Present Invention
(10) Preferably, the active peptide is between 12 and 18 amino acids in length, more preferably 16 amino acids in length, and includes the most highly conserved sequence among all cystatins, the QVVAG sequence (SEQ ID NO:1), in native-sequence or in variant form, as well as derivatives, fragments, and analogs from any source, whether natural, synthetic, or recombinant, provided that at least 50%, at least 60%, at least 70% of the peptide's activity of inhibiting PKC is retained. Preferably, at least 80% or 90% of such activity is retained.
(11) The peptide of the present invention also includes the QVVAG sequence with conservative substitutions. The term conservative substitution as used herein denotes the replacement of an amino acid residue by another, biologically similar residue with respect to hydrophobicity, hydrophilicity, cationic charge, anionic charge, shape, polarity and the like. Examples of conservative substitutions include the substitution of one hydrophobic residue such as isoleucine (I), valine (V), leucine (L), norleucine (Nle) alanine (A), cysteine (C), glycine (G), phenylalanine (F), proline (P), tryptophan (W), tyrosine (Y) or methionine (M) for another, or the substitution of one polar residue for another, such as the substitution of arginine (R) for lysine (K), glutamic acid (E) for aspartic acid (D), or glutamine (Q) for asparagines (N), and the like. Neutral hydrophilic amino acids, which can be substituted for one another, include asparagines (N), glutamine (Q), serine (S) and threonine (T).
(12) The term conservative substitution also includes the use of a substituted or modified amino acid in place of an unsubstituted parent amino acid provided that substituted peptide has similar proteases property to the QVVAG sequence. By substituted or modified the present invention includes those amino acids that have been altered or modified from naturally occurring amino acids. As such, it should be understood that in the context of the present invention, a conservative substitution is recognized in the art as a substitution of one amino acid for another amino acid that has similar properties.
(13) It is envisioned that at least the second amino acid or the fourth amino acid, or both of the sequence QVVAG are substitutable, as long as at least 50%, at least 60%, at least 70% of the peptide's activity of inhibiting PKC is retained after the substitution(s). Preferably, at least 80% or 90% of such activity is retained after the substitution(s). In this application, the QVVAG sequence and its suitable conservative substitutions is defined in form of the QXVZG sequence (SEQ ID NO:2), in which the amino acids X and Z are substitutable.
(14) In one embodiment, the amino acid in the X position is V, I, L or T. In another embodiment, the amino acid in the Z positions is A, S, G or Q. In a preferred embodiment, the X is V or L and Z is A.
(15) In one preferred embodiment, the QXVZG sequence is QVVAG (SEQ ID NO:3) or QLVAG (SEQ ID NO:4). For example, in a mouse, the therapeutic Cystatin C peptide comprises the sequence of YRKQLVAGVNYFFDVH (SEQ ID NO:5).
(16) The cystatins are present in almost all organisms. We found that clearly identifiable cystatins are present in rice and corn plants with sequences similar to those described here. Tables I and II, below, are cystatin sequences and conserved sequences that are found in 1, 2 and 3 cystatin types. This is the QVVAG region found at the first hairpin loop of the cystatin protein. (Stefin is another name for cystatin type I (20)). Any of the peptides listed in Tables I and II are appropriate peptides of the present invention and are therapeutic Cystatin C peptides. Note the consensus sequences listed in Table II which would allow one skilled in the art to create appropriate peptides and allow substitutions and changes from naturally occurring sequences.
(17) In another aspect, the present invention is a nucleotide sequence encoding a peptide of the present invention.
(18) We believe the minimal sequence for activity is QVVAG, allowing for conservative substitutions for the first V (i.e., I or L). Preferably, one would have a peptide of between 10 and 16 amino acids in length and the sequence would be a naturally occurring Cystatin C sequence. However, we envision that one could place the minimal QVVAG sequence within a larger peptide.
(19) All of the sequences in Table I are internal peptides of type II (the first 8 sequences) or type I (the last 8 sequences). Both the type I and type II cystatin types have been shown to inhibit metastasis. In fact, the puff adder venom cystatin has been shown to inhibit melanoma metastasis in a purified form. The puff adder sequence is a little divergent but is covered within consensus sequence.
(20) The type II cystatins arose from gene duplication of the type I or II cystatin to include 3 copies of the cystatin protein in the same megaprotein. Two of the three copies inhibit cathepsins and the other copy diverged to inhibit calpain. To the extent that the consensus sequence is present it may also be used as a source for the peptide. The type III have been shown to inhibit angiogenesis but not metastasis directly.
(21) The consensus sequence in Table II is a generalized consensus as it represents the most common amino acid residue at each site. The hyphen refers to designation of weak consensus at that site. 9 out of 16 residues are a perfect match with the consensus with the I (isoleucine) for V (valine) as a conservative substitution. Other conservative substitutions may also work for this peptide but that data set does not exist. So for example it is known cystatin D behaves similarly in regards to metastatic inhibition and it has both an I and a G substituted within the QVVAG.
(22) TABLE-US-00001 TABLEI CystatinpeptidesequencesintheQVVAGregion (aboutresidues50-66of120totalfortypeIIcystatin) Sequence Source ARKQIVAGVNYFLDVE(SEQIDNO:6) humanCystatinC ARKQLVAGINYYLDVE(SEQIDNO:7) ratCystatinC ARKQLVAGVNYFFDVE(SEQIDNO:8) mouseCystatinC ARKQVVSGMNYFLDVE(SEQIDNO:9) bovineCystatinC AYQQIVGGVNYYFNVK(SEQIDNO:10) humancystatinD AREQTFGGVNYFFDVE(SEQIDNO:11) humancystatinS VQKQVVAGTKFFFDVI(SEQIDNO:12) ratcystatinS AQSQVVSGVKYYLMME(SEQIDNO:13) puffaddercystatin YKTQVVAGTNYYIKVR(SEQIDNO:14) humancystatinA YKSQVVAGQILFMKVD(SEQIDNO:15) ratcystatinA YKTQVVAGQNLFIKID(SEQIDNO:16) mousecystatinA FKSQVVAGTNYFIKVH(SEQIDNO:17) humanstefinB FRRQVVAGTNFFIKVD(SEQIDNO:18) ratstefinB FKSQLVAGKNYFIKVQ(SEQIDNO:19) bovinestefinB FRSQVVAGMNYLIKVQ(SEQIDNO:20) bovinestefinC
(23) TABLE-US-00002 TABLEII CystatinTypeIIpeptidesequencesintheQVVAGregion PeptideSequence Source -K/R-QVVAG-NYF-D/E(SEQIDNO:21) consensussequence* ARKQVVAGVNYFFDVE(SEQIDNO:22) cystatintypeIIconsensus FKSQVVAGTNYFIKVD(SEQIDNO:23) cystatintypeIconsensus YRKQLVAGVNYFFDVH(SEQIDNO:5) Experimentalmurinepeptide** *11/16 matches, with conserved K or R at position 2 and D or E at position 16. **Therapeutic peptide used in these studies derived from mouse Cystatin C with the first A substituted by Y for cloning purposes.
(24) Formulation of the therapeutic cystatin peptide contemplates the native cystatin peptide sequence and all modifications, derivatives, fragments, combinations, and hybrids thereof that retain at least 50%, at least 60%, at least 70% of the peptide's activity to inhibit PKC. Preferably, at least 80% or 90% of the activity is retained.
(25) The therapeutic peptide may be further modified or attached to a carrier. The Cystatin C peptide or its therapeutic moiety can be synthesized by any methods known in the art.
(26) In some embodiments, modifications to improve the therapeutic peptide life-time such as addition of polyethylene glycol (PEG) or similar purpose modifying agent. Peptide N-terminal or C-terminal chemical modifications which might serve to improve in vivo stability of the peptide to proteases.
(27) In some embodiments, peptide modifications can be made to increase stability in regards to in vivo degradation. Capping of the N-terminus by acylation is the preferred method. Amidation of the carboxy-terminus of the peptide to protect from plasma peptidases is also possible.
(28) In the examples below, the cystatin peptide has also been covalently linked to a cell-penetrating peptide (penetratin) for more efficient delivery into cells (17). The delivery of this active peptide to cancer cells, by nature of its size and cell penetratin peptide would be greatly improved over delivery of intact cystatin protein, which happens to contain the active peptide we describe, due to the greater molecular size and less efficient uptake of intact cystatin by cells. Delivery of intact cystatin as a protein or in a DNA form or by viral vector will always suffer from inefficiency of delivery and, hence, expression in an intact host.
(29) Therefore, in a preferred version of the present invention, one would link the therapeutic peptide to an uptake peptide, preferably the Penetratin peptide. The examples below disclose a minor derivative of the original Penetratin sequence. (Essentially, we included within the sequence for penetratin a proline which the authors found blocked cell nuclear trafficking of the penetratinonly cytoplasmic localization was observed with this penetratin subtype, (17)). There are several papers which disclose cell penetrating peptides for anti-cancer peptide delivery (21,22). However, our invention is the first to inhibit metastasis through inhibiting migration and cancer cell survival derived from cystatin. Commercial use of Penetratin for delivery is in clinical trials (23).
(30) Method of the Present Invention
(31) In one embodiment, the present invention is a method of using the therapeutic peptide described above to inhibit tumor malignancy and tumor invasion.
(32) In a preferred embodiment, one would use the peptide therapeutic in the following manner: In the CDG Therapeutics clinical trial referenced above, subjects received p28 peptide three times a week administered or delivered into a vein for four weeks (NCT00914914 sponsor: CDG Therapeutics, Inc. (2009) A Phase I Trial of p28). We anticipate intravenous injection as the most likely route for systemic administration of the peptide. Other delivery methods can be used as well, including but not limited to administering the peptide therapeutic intramuscularly, orally, intrathecally, intradermally, intratumorally, intralesionally, intranasally, intracerebrally (intraparenchymally), intracerebroventricularly, intranasally, intraocularly, intraarterially, topically, transdermally, subcutaneously, via an aerosol, infusion, bolus injection, implantation device, sustained release system etc., either alone or conjugated to a suitable therapeutic carrier.
(33) Other clinical uses of penetrating peptides include uses for treatment of myocardial infarction, glioblastoma treatment, and treatment of stroke (Johnson R M et al. in Methods Mol Biol 683, 535-51. 2011, Fialho A M et al. Glioblastoma mutiforme: novel therapeutic approaches ISRN Neurol 2012:642345 Epub 2012, Xigen).
(34) One could also deliver the Cystatin C peptide in a DNA form or sequence either as part of an expression plasmid or virus vector which expresses the therapeutic peptide from an incorporated DNA sequence which is engineered into the plasmid or virus expression system either alone or as part of a fusion peptide.
(35) In some embodiments, the DNA sequence encoding a Cystatin C peptide or at least a functional portion of a Cystatin C peptide is inserted into a plasmid. The DNA sequence can be cDNA or genomic DNA. The plasmid can be any DNA molecule that is capable of autonomous replication within a host cell, either extrachromosomaily or as part of the host cell chromosomes. The starting plasmids are commercially available, are publicly available on an unrestricted basis, or can be constructed from such available plasmids. In certain instances, as will be apparent to the ordinarily skilled artisan, other suitable plasmids known in the art may be used as well.
(36) In some embodiments, the vector for delivering the Cystatin C peptide comprises the DNA sequence of a Cystatin C peptide or at least a function portion of a Cystatin C peptide. The vector is characterized in that it comprises a nucleotide sequence wherein a gene coding for a Cystatin C peptide is linked to a promoter.
(37) The DNA sequence of the present invention can also include a promoter which is recognized by the host organism and is operably linked to the Cystatin C peptide encoding nucleic acid. Promoters are untranslated sequences located upstream from the start codon of a structural gene (generally within about 100 to 1000 bp) that control the transcription and translation of nucleic acid under their control, including inducible and constitutive promoters. Inducible promoters are promoters that initiate increased levels of transcription from DNA under their control in response to some change in culture conditions, e.g. the presence or absence of a nutrient or a change in temperature. At this time a large number of promoters recognized by a variety of potential host cells are well known.
(38) The DNA sequence of the present invention can include a nucleic acid sequence encoding a signal Cystatin C peptide. Further, the DNA sequence can include additional nucleic acids which encode reporter products to monitor levels of gene expression, or encode peptide tags which can be visualized using known methods in the art to monitor levels of peptide expression. The DNA sequence of the present invention can also comprise expression and cloning vectors which may contain a selection gene or a selectable marker that encodes a protein necessary for the survival or growth of a host cell transformed with the vector. Typical selection genes encode proteins that confer resistance to antibiotics or other toxins and complement auxotrophic deficiencies.
(39) Preferably, the DNA sequence encoding a Cystatin C peptide or at least a functional portion of a Cystatin C peptide is inserted into a plasmid for use as a mammalian expression vector. For example, the gene encoding the Cystatin C peptide is inserted into a virus expression vector such as adenovirus (for example, pcDNA-3) for mammalian cell expression.
(40) Examples of cancers or malignancy tumors that can be treated by the peptide of the present invention include, but are not limited to, breast cancer, colorectal cancer, lung cancer, prostate cancer, colon cancer, ovarian cancer, cervical cancer, gastrointestinal cancer, pancreatic cancer, glioma, glioblastoma, bladder cancer, hepatoma, colorectal cancer, uterine cervical cancer, endometrial carcinoma, salivary gland carcinoma, kidney cancer, vulval cancer, thyroid cancer, hepatic carcinoma, skin cancer, melanoma, ovarian cancer, neuroblastoma, myeloma, various types of head and neck cancer, lymphoma cancer, leukemia, acute lymphoblastic leukemia, acute myeloid leukemia, Ewing sarcoma and peripheral neuroepithelioma, and other carcinomas, lymphomas, blastomas, sarcomas, and leukemias.
(41) In one embodiment of the present invention, one would measure the clinical efficiency of the peptide. For measurement of clinical therapeutic efficiency of the peptide there are many imaging modalities that might be employed. One example would be MRI imaging of the tumor region in a patient to determine the relative growth or spread of the cancer before and after delivery of the peptide to a patient. An alternative would also be PET scan because of the high sensitivity of this imaging modality to cancer in the patient. Antibody methods of tumor detection are also possible, and although specialized techniques are required for their preparation, they are specific for certain cancers and hence within the realm of detection techniques that could be envisioned. One would consider the method of the present invention to be a success if tumor growth were halted, inhibited or reversed Inhibition of growth of the metastatic tumor by at least 25% preferably 50%, is a successful embodiment.
(42) For melanoma examination a sentinel lymph node biopsy could be used to determine the peptide effect on status of the spread of the cancer. These biopsies are used for tumor staging in melanoma but could also give a critical window into progression during treatment with the described peptide.
(43) Based upon in vitro testing of the purified peptide, one embodiment of the present invention would provide at least a 25% decrease in tumor burden in a cancer patient and significant reduction in metastasis after application of the peptide in 1-3 infusions of an effective dose.
EXAMPLES
(44) Therapeutic Applications of the Peptide
(45) It is envisioned that application of the described peptide could open up new avenues for therapeutic treatment of cancer, since up until now agents have not been targeted against metastasis, the major cause of death from cancer. Therapeutic applications of the described peptide could include intravenous delivery or infusion for systemic distribution of the peptide into a cancer patient. Systemic delivery of the therapeutic peptide may be necessary for cases of metastatic disease in the cancer patient. Periodic infusion or continuous infusion of the peptide could also augment other standard cancer therapies for different cancers, particularly if the cancer has become metastatic. Additive or synergistic effects of simultaneous treatment with the described peptide and other accepted anti-cancer therapies would be expected due to the unique cellular targeting of the peptide to cancer cell pathways which drive metastasis and tumor cell survival.
(46) Another major application would be adjunctive use of the therapeutic peptide following surgical removal of a primary tumor in cases where the tumor removal is not 100% (curative) or residual disease after tumor removal is suspected. In these cases, adjunctive therapy could either be with systemic delivery of the peptide alone or in conjunction with other anti-cancer agents.
(47) Another application of the peptide could include either intravenous injections or infusions or bolus injection of a physiological based solution of the therapeutic peptide into the tumor region within the cancer patient. This might allow higher concentrations of the peptide to be delivered more directly into the tumor environment for more efficient tumor uptake. The dose and frequency of peptide delivery may have to be empirically determined on a cancer by cancer basis due to the variability between different cancers.
(48) In cases where direct injection of a physiological based solution (i.e. physiological saline or other suitable osmotic solution) of the peptide into the tumor or tumor region could be used for delivery, it is envisioned that peptide dosing of a particular cancer with multiple injections may be required, depending upon the biological half-life of the specific peptide or peptide mimetic composition. More stable forms or derivatives of the peptide such as those containing D-isomer amino acids, or other suitably modified peptides or peptide mimetics may require fewer injections to achieve similar therapeutic doses and results.
(49) There may also be instances, particularly in skin cancer patients with surface lesions, where direct contact of a peptide containing solution, either administered by a patch or other suitable delivery device or reservoir could be implemented as the peptide in its basic formulation is able to directly penetrate into cells and may be delivered by means other than blood supply to organs or tissues.
(50) Alternatively, a small pump containing the peptide may be surgically inserted below the skin into a region of the body known to be a major site of tumor spread or systemic delivery for a particular cancer type to head off metastatic cancer cells as they arise from residual or un-resected cancerous tumors.
(51) Other possible scenarios for use of the peptide are with nanoparticle delivery systems which may allow pill formulation such that the peptide survives the digestive system intact. Nanoparticles or nano-materials may also incorporate tumor targeting motifs to enhance targeting of the therapeutic peptide to the tumor cells. Any efficient delivery system which can bring about sustained, therapeutic levels of the peptide systemically or in the region of the cancer should be the therapeutic objective during cancer therapy with the described peptide.
(52) Materials and Methods
(53) B16F10 melanoma cells were obtained from the ATCC. Human 1205 Lu metastatic melanoma cell line was received from Robert Baer, PhD, a collaborator with our laboratory here at ATSU. Growth was in RPMI 1640 media supplemented with FBS (10%) and penicillin, streptomycin, amphotericin antibiotics (1%) (Sigma). Cells were maintained in a humidified incubator at 37 C. with 5% CO.sub.2.
(54) Isolation of Cystatin Clones
(55) The Cystatin C cDNA was amplified from B16F10 melanoma cells by PCR amplification of reverse transcribed total RNA isolated from B16 F10 melanoma cells in culture. The primers used for the amplification were derived from 5 and 3 sequences for murine Cystatin C from Solem et al. (18). The PCR product corresponding to the expected size was agarose gel purified and ligated into pcDNA3 expression plasmid for further analysis. The plasmid was sent to for sequence analysis at the University of Chicago and the sequence analysis produced a cDNA sequence which exactly matched murine Cystatin C cDNA sequence (19). Transfection of the cystatin plasmid or pcDNA3 plasmid was carried out with Lipofectamine reagent (Invitrogen) by the manufacturer's instructions. Isolated cell colonies, which had grown following Geneticin (1 mg/ml) selection were trypsized in glass cloning rings and transferred to multi-well tissue culture dishes for expansion in culture.
(56) Western Blot Analysis
(57) For analysis of B16 melanoma proteins, melanoma cell cultures were lysed with lysis buffer and extracts were centrifuged at 10K rpm for 5 minutes. Protein was measured by Lowry assay and 40 ug of protein was loaded per lane on 10% SDS-PAGE gels for analysis. After electrophoresis, the proteins were transferred to PVDF membranes which were first blocked with 2% BSA in TBST buffer. Primary antibodies were added at 1:2000 dilution in TBST and incubated at room temperature for 1 hour, with rocking, or, for phospho-antibodies, overnight at 4 C. Secondary antibodies were used at 1:20,000 dilution for the LiCor detection system (infrared). Cystatin C antibody was a goat polyclonal antibody (Pierce). The pMARCKS antibody was S 152/156 rabbit polyclonal (Cell Signaling) and the tubulin used was from DSHB (Iowa City).
(58) Migration Assay
(59) The migration of clone cc6 was tested in Boyden-type chambers which allow quantitation of cells which migrate through 8 um pores in a filter which do not allow the passage of non-migrating cells. Cells (2104) are placed into the top well of the Boyden chamber in cell culture media while media plus bFGF chemotactic factor (25 ng/ml) is placed into the lower well of the chamber. Quantitation is through direct microscopic counting of 10-20 fields of crystal violet stained cells per filter.
(60) Cystatin Peptide
(61) The cystatin peptide linked to the uptake peptide (penetratin) was synthesized by Peptide 2.0 company and purified to 96% purity. The amino acid sequence of the peptide is RQIKIWFPNRRMKWKKAYRKQLVAGVNYFFDVH (SEQ ID NO:24) with the first 16 amino acids RQIKIWFPNRRMKWKK (SEQ ID NO:25) corresponding to the penetratin uptake peptide sequence and the final 16 amino acids YRKQLVAGVNYFFDVH (SEQ ID NO:5) corresponding to the Cystatin C active peptide with a single A (alanine) separating the two sequences (not necessary for functionality but arose during separate DNA cloning experiments, not reported here). The dried peptide product was resuspended in sterile, deionized water to 1 mM concentration and kept frozen between uses.
(62) MTT Assays
(63) The growth of B16F10 melanoma cells by the MTT method was performed with the addition of 10 uM peptide to the melanoma cells in standard 96-well culture plates. Cells were cultured in media for 4 days after seeding at about 1000 cells per well. After growth the culture media was replaced with media containing 0.5 mg/ml MTT solution and incubated for 4 hours at 37 C. The MTT solution was then removed and the residual dye was solubilized in 100 ul isopropanol for 15 minutes before reading the O.D. at 570 nm.
(64) Scratch Assay
(65) B16F10 melanoma cells were seeded into 24-well plates at 210.sup.5 cells/well. After overnight growth, the wells were scratched with a yellow pipette tip and fresh media was placed on the cells. Peptide was added to treated wells at 15 uM at 12 hour intervals and images were taken with a Motic camera on an Olympus inverted-microscope stage.
REFERENCES
(66) 1. Turk V et al. Cystatins: biochemical and structural properties and medical relevance. Front Bioscience 13, 5406-20. 2009 2. Cai X et al. Serum Cystatin C is an early biomarker for assessment of renal function in human patients Clin. Chem Lab Med 50, 667-71. 2012 3. Cox J L Cystatins and Cancer Frontiers in Bioscience. 2009 4. Tizon B et al. Cystatin C protects neuronal cells from amyoid beta induced toxicity J Alzheimers Dis 19, 885-894. 2010 5. Cox J L et al. Inhibition of B16 melanoma metastasis by overexpression of the cysteine protease inhibitor Cystatin C Melanoma Research 9, 369-374. 1999 6. Sexton P S and Cox J L Inhibition of motility and invasion of B16 melanoma by the overexpression of Cystatin C Melanoma Research 7, 97-101. 1997 7. Ervin H and Cox, J L Late stage inhibition of hematogenous metastasis by Cystatin C over-expression Cancer Cell International 5, 14-21. 2005 8. Konduri S D et al. Modulation of Cystatin C expression impairs the invasiveness and tumorigenic potential of human glioblastoma cells Oncogene 21, 8705-12. 2002 9. Sokol J P et al. The use of Cystatin C to inhibit epithelial mesenchymal transition andmorphological transformation stimulated by transforming growth factor beta Cancer Res 7, R844-53 2005 10. Weigel B et al. Cystatin C is downregulated in prostate cancer and modulates invasion of prostate cancer cells via MAPK/Erk and androgen receptor pathways PLOS One 4, e7953 2009 11. Alvarez-Diaz S et al. Cystatin D is a candidate tumor suppressor gene induced by vitamin D in human colon cancer cells J. Clin Invest 119, 2343-58 2009 12. Ostrowski, L E et al. Selective inhibition of proteolytic enzymes in an in vivo mouse model of experimental metastasis Cancer Research 46, 4121-4128. 1986 13. Gopalakrishna R and Barsky S H tumor promoter induced membrane-bound protein kinase C regulates hematogenous metastasis PNAS 85, 612-616. 1988 14. Dissanayake S K et al. The Wnt5a/Protein kinase C pathway mediates motility in melanoma cells via the inhibition of metastasis supressors and initiation of an epithelial to mesenchymal transition J Biol Chem 282, 17259-17271. 2007 15. Kawamoto T. et al. Inhibition of PKC alpha activation in human bone and soft tissue sarcoma cells by the selective PKC inhibitor PKC412 Anticancer Research 28, 825-32 2012 16. Teno N et al. Amino acids and peptides XV. Synthesis of Gln-Val-Val-Ala-Gly and derivatives. Int. J. Peptide Res. 30, 93-98. 1987. 17. Derossi D. et al. Cell Internalization of the third helix of the Antennapedia homeodomain is receptor-independent Journal of Biological Chemistry 271, 18188-18193 1996 18. Solem M et al. Transforming growth factor beta regulates Cystatin C in serum-free mouse embryo cells BBRC 172, 945-951. 1990 19. Hakansson K et al. Mouse and rat Cystatin C: Escerichia coli production, characterization, and tissue distribution Comp Biochem Pysiol Biochem Mol Bio 114, 303-11. 1996 20. Turk V, and Bode W Human cysteine proteinases and their inhibitors, stefins and cystatins Chapter 4, pp 47-59. In biological functions of Proteases and Inhibitors eds. Katanuma N, Suzuki K, Travis J, and Fritz H. Karger 1994. 21. Kim J et al. Sustained inhibition of PKC alpha reduces intravasation and lung seeding during mammary tumor metastasis in an in vivo mouse model; Oncogene 30:323-33, 2011. 22. Heo k et al. Cell Penetrating H4 tail peptides potentiates p53-mediated tansactivation via inhibition of G9a and HDAC1; Oncogene 2012 doi:10.1038/onc.2012.273. 23. Chaubey B, et al. Single acute dose and repeat doses toxicity of anti-HIV-1 PNA TAR-penetratin conjugate after intraperitoneal administration to mice. Oligonucleotides 18, 9-20. 2008; Abes R et al. cell penetrating peptide based delivery of oligonucleotides: an overview Biochem Soc Trans 35:775-9. 2007.