Microtubule organizing center (MTOC)-inactivating peptides
09567380 ยท 2017-02-14
Assignee
Inventors
Cpc classification
International classification
G01N33/50
PHYSICS
Abstract
Disclosed herein is the identification of a new therapeutic target, an upstream target, the microtubule-organizing center (MTOC), for arresting mitosis and inhibiting cell growth and proliferation. Achieving mitotic arrest involves the interaction of two proteins with the TuRC of the MTOC: Kinesin-14 or a Tail peptide of Kinesin-14 having the amino acid sequence of SEQ ID NO: 1 and an antagonist capable of disarming the function of the BimC domain of Kinesin-5. Methods and compositions for screening for Kinesin-5 BimC antagonists are also disclosed.
Claims
1. A method for identifying a compound as a Kinesin-5 BimC antagonist, the method comprising culturing a eukaryotic cell transduced/transfected with a nucleic acid that encodes the peptide of SEQ ID NO: 1 in the presence and absence of said compound and monitoring the cell for mitotic arrest, wherein a compound that promotes mitotic arrest in the cell is identified as a Kinesin-5 BimC antagonist.
2. The method of claim 1, wherein said cell is cultured under conditions for cell growth.
3. The method of claim 1, where said cell is a yeast cell.
4. The method of claim 1, wherein said cell is a mammalian cell.
5. The method of claim 1, wherein said cell is a human breast cancer cell.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1) The patent or application file contains at least one drawing executed in color. Copies of this patent or patent application publication with color drawing(s) will be provided by the Office upon request and payment of the necessary fee.
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
DETAILED DESCRIPTION OF THE INVENTION
(18) All patents, applications, publications and other references listed herein are hereby incorporated by reference in their entirety.
(19) In practicing the presently disclosed methods, many conventional techniques in molecular biology, microbiology, cell biology, biochemistry, and immunology are used, which are within the skill of the art. These techniques are described in greater detail in, for example, Molecular Cloning: a Laboratory Manual 3rd edition, J. F. Sambrook and D. W. Russell, ed. Cold Spring Harbor Laboratory Press 2001; Current Protocols in Molecular Biology (F. M. Ausubel et al., eds., 1987, and periodic updates). The contents of these references and other references containing standard protocols, widely known to and relied upon by those of skill in the art, including manufacturers' instructions are hereby incorporated by reference as part of the present disclosure.
(20) Unless otherwise defined, all terms of art, notations and other scientific terminology used herein are intended to have the meanings commonly understood by those of skill in the art to which this invention pertains. In some cases, terms with commonly understood meanings are defined herein for clarity and/or for ready reference, and the inclusion of such definitions herein should not necessarily be construed to represent a substantial difference over what is generally understood in the art.
ABBREVIATIONS
(21) -TuSC: -tubulin small complex
(22) -TuRC: -tubulin ring complex
(23) MTOC: microtubule-organizing center
(24) MT: microtubule(s)
(25) Klp: kinesin-like protein
(26) SPB: spindle pole body
(27) The term ortholog refers to genes in different species that are similar in their nucleotide sequences, suggesting that they originated from a common ancestral gene.
(28) The term peptide as it is known in the art refers to a molecule comprising two or more amino acids, generally fewer than fifty, where the alpha-carboxylic group of one is bound to the alpha-amino group of the other. Because of their relatively small size, the peptides of the disclosure may be directly synthesized in solution or on a solid support in accordance with conventional peptide synthesis techniques. Various automatic synthesizers are commercially available and can be used in accordance with known protocols. The synthesis of peptides in solution phase has become a well-established procedure for large-scale production of synthetic peptides and as such is a suitable alternative method for preparing the peptides of the invention. (See for example, Solid Phase Peptide Synthesis by John Morrow Stewart and Martin et al. Application of Almez-mediated Amidation Reactions to Solution Phase Peptide Synthesis, Tetrahedron Letters Vol. 39, pages 1517-1520 1998.)
(29) Short peptide sequences, or libraries of overlapping peptides which correspond to the selected regions described herein, can be readily synthesized and then screened in assays designed to identify reactive peptides. Alternatively, recombinant DNA technology may be employed wherein a nucleotide sequence which encodes a peptide of the invention is inserted into an expression vector, transformed or transfected into an appropriate host cell and cultivated under conditions suitable for expression. Methods for production of a peptide by recombinant DNA technology are well known to those of skill in the art.
(30) In all eukaryotes, a designated macromolecular complex termed the microtubule-organizing center (MTOC) serves a fundamental role in the initial formation of microtubules (nucleation) as well as their organization, dynamics and temporal cell cycle changes in these parameters once formed. The -tubulin ring complex (-TuRC) is the core functional unit of the MTOC across eukaryotes and controls spindle assembly by directly controlling microtubule nucleation (the presence of microtubules). A unique fission yeast Kinesin-14 molecular motor protein, Pkl1, is one of few proteins known to function in spindle assembly by directly interacting with the -TuRC to alter its structure and block its functional ability to grow microtubules.
(31) Bipolar spindle assembly is a critical control point for initiation of mitosis through nucleation and organization of spindle microtubules and is regulated by Kinesin-like proteins. In fission yeast, the Kinesin-14 Pkl1 binds the -tubulin ring complex (-TuRC) microtubule-organizing center at spindle poles and can alter its structure and function. Here we show that Kinesin-14 blocks microtubule nucleation in yeast, and reveal that this inhibition is countered by the Kinesin-5 protein, Cut7, when it binds to -TuRC (Olmsted et al. Nat Communications 2014). We demonstrate that Cut7 binding to -TuRC and in particular the Cut7 BimC domain are both required for inhibition of Pkl1. We also demonstrate that a yeast Kinesin-14 peptide biochemically removes -tubulin from the human -TuRC similar to the yeast mechanism. Furthermore that a Kinesin-14 peptide blocks microtubule nucleation in vivo in two human breast cancer cell lines, suggesting that this mechanism is evolutionarily conserved.
(32) The microtubule cytoskeleton is a self-assembling network that underlies specialized, often polarized, cellular functions in eukaryotes. Knowledge of its mechanisms is fundamental to understanding normal development and disease and is expected to assist new technologies through biomimicry. The microtubule-based mitotic spindle apparatus is perhaps the best studied self-assembly platform.sup.1,2 and a primary target for cancer therapeutics.sup.3. Spindle pole microtubule-organizing centers (MTOCs) utilize a -tubulin template within a ring complex (-tubulin ring complex, -TuRC) to orchestrate addition of -/-tubulin heterodimeric microtubule building blocks into 25 nm polarized microtubules.sup.4-9. Conserved protein structural features of the -TuRC MTOC have been identified through crystallography studies from multiple model organisms and include -/-tubulin.sup.10, -tubulin.sup.11, GCP4.sup.12 and the -tubulin small complex (-TuSC) cryo-EM structure.sup.13. Conserved structural features are additionally supported by cross-species analysis.sup.14,15. Still unknown is how dynamic control over MTOC functions for microtubule nucleation and organization is achieved. The fission yeast Schizosaccharomyces pombe provides an ideal eukaryotic platform to address conserved MTOC mechanisms.sup.14-17.
(33) The coordination of spindle microtubules into a bipolar array requires Kinesin-like proteins (Klps), though Klp mitotic functions are not limited to interactions solely on microtubules. Studies of the functionally diverse Kinesin-14 Klp family across eukaryotes have indicated an ability by some members to affect microtubule number and organization at spindle poles.sup.18-21. In fission yeast, Kinesin-14 Pkl1 interacts directly with the -TuRC MTOC to alter its composition and function.sup.17,22,23. Conservation of the Kinesin-14 -TuRC regulatory mechanism is expected from yeast to human since human Kinesin-14 HSET replaces fission yeast Kinesin-14 Pkl1.sup.23 and all human -TuSC protein components are also compatible.sup.14,18. Nearly as ubiquitous and complex in eukaryotes as Kinesin-14 Klps are members of the Kinesin-5 family that oppose Kinesin-14 function. In fission yeast, Kinesin-5 Cut7 opposes the action of Kinesin-14 Pkl1 in mitosis, but the detailed mechanism is not yet characterized. Elucidating this mechanism could be informative for understanding -TuRC regulation and spindle bipolarity.
(34) In this disclosure, the mechanism for Kinesin-14 regulation of -TuRC is described. Studies describe genetic interactions of Pkl1 with -TuRC proteins.sup.22,24-26, checkpoint pathways.sup.20,26 and spindle pole organization.sup.20. More recently key Tail elements in Pkl1 that function along with Motor binding to -tubulin to regulate -TuRC.sup.17,22-23 were identified. The present disclosure demonstrates that Kinesin-14 Pkl1 asymmetrically blocks microtubule nucleation in vivo in fission yeast and that a Kinesin-14 Pkl1 Tail peptide can similarly prevent nucleation and generate mitotic arrest in two human breast cancer cell lines. In fission yeast, Kinesin-5 Cut7 counters Pkl1 ability to block nucleation by also associating with -TuRC and binding similarly to -tubulin. This counter-action requires the additional conserved Kinesin-5 BimC domain. Balanced regulation by Kinesin-14 Pkl1 and Kinesin-5 Cut7 generates optimal mitotic fidelity, although both proteins are co-dispensable as determined by genetic analysis of single and double mutants, biochemical approaches and timelapse fluorescence microscopy.
(35) Analysis of pkl1 single and pkl1 cut7 double mutants also reveals separate mitotic roles for Kinesin-14 Pkl1 and Kinesin-5 Cut7. These findings identify Kinesin-14 Pkl1 as a Klp negative regulator of microtubule nucleation at -TuRC and demonstrate conservation of this mechanism in human breast cancer cells, resulting in mitotic arrest. Furthermore these findings indicate that a primary role of Cut7 is to counter Pkl1 and allow microtubule nucleation for spindle assembly.
(36) Microtubule organizing centers play major roles in specialized eukaryotic processes of broad interest such as spindle assembly, neuronal function and immunological synapse formation that involves cell polarization. Understanding the detailed mechanisms for microtubule nucleation requires combined knowledge of the underlying structure along with regulatory insights. This work demonstrates that the ability of fission yeast Kinesin-14 Pkl1 to bind and alter -TuRC structure and function.sup.17 results in blocked microtubule nucleation in vivo generating failed spindle bipolarity and mitotic arrest. Conservation of this mechanism is revealed through use of a Kinesin-14 Pkl1 peptide PTR in human breast cancer cells that localizes to centrosomes and is sufficient to arrest nucleation in the two breast cancer cell lines investigated, representing low and highly aggressive grades, by preventing bipolar spindle formation. In fission yeast, Kinesin-5 Cut7 but not Kinesin-14 Pkl1, is an essential mitotic protein.sup.18,27. To better understand Kinesin-14 Pkl1 function at -TuRC, and Kinesin-5 counter-action of this Klp, we applied genetic analysis, biochemistry and timelapse imaging. Here we show that Kinesin-5 Cut7 is dispensable in the absence of Kinesin-14 Pkl1 and that counter-action of Pkl1 by Cut7 requires Cut7 binding to -TuRC through its Motor and BimC domains. These Klps are the first identified to directly bind and regulate -TuRC, actions that are sufficient to impact microtubule nucleation capability. These findings are expected to have significant impact in the cytoskeleton field, particularly in understanding MTOC function as well as in potential therapeutic anti-cancer applications that utilize mitotic spindle protein antagonists.
(37) Distinct mitotic phenotypes are present with loss of either Pkl1 or Cut7. The loss of pkl1 in the presence of cut7, although viable, results in an asymmetric effect on daughter spindle pole organization that influences spindle width and impairs chromosome segregation. Compared to the double mutant pkl1cut7, no amelioration or exacerbation of the pkl1 phenotype is observed, indicating that these phenotypes are likely due to loss of Pkl1. The additional loss of Cut7, however, does result in delayed spindle breakdown for mitotic exit. Cut7 localizes to the spindle midzone in anaphase.sup.37, and although not required for anaphase B spindle elongation.sup.29, our data indicate it may contribute to normal progression through this stage. A primary role for Kinesin-5 Cut7 is therefore to counter-act Kinesin-14 Pkl1 at -TuRC. Only in the presence of Pkl1 does removal of Cut7 or inactivation of the Cut7 BimC domain (cut7-22) allow an asymmetric block on -TuRC microtubule nucleation to be imposed that results in failed spindle bipolarity (
(38) Extensive studies demonstrate both the importance of Kinesin-5 motors in spindle assembly along with Kinesin-5 independent mechanisms. In the latter, force generation by other microtubule motors such as nuclear envelope-associated dynein and Kinesin-12 operate and include microtubule pushing forces on the opposing pole and kinetochore-mediated microtubule interactions in prophase.sup.38. Our ability to remove Kinesin-5 Cut7 in the absence of Kinesin-14 Pkl1 reveals that in fission yeast Kinesin-5 independent mechanisms exist to establish spindle bipolarity.
(39) Spindle phenotypes in the double mutant and single pkl1 strains do not include changes to timing for prophase SPB separation or mitotic progression through anaphase B versus wild type. The increase in spindle thickness upon loss of Pkl1 is reminiscent of phenotypes induced by loss of Kinesin-14 Kar3 in budding yeast.sup.19. The thick spindle morphology did not result in increased resistance to the microtubule-depolymerizing drug TBZ at 10 or 20 g/mL concentrations in single or double mutant backgrounds versus wild type, consistent with no change in spindle microtubule number. We favor the model that altered microtubule organization of parallel microtubules emanating from the daughter pole results in increased spindle width at this pole as opposed to an increase in spindle microtubule number. This is consistent with studies by ref. 20 in which TEM analysis of pkl1 cells revealed a decrease in pole organization characterized by loss of the typical plaque-like structure with apparent normal microtubule number. The replication of the spindle pole body and centrosome are semi-conservative with the mother pole used as a template. In order to identify whether the mother or daughter pole is affected by loss of pkl1 we applied live cell fluorescence microscopy with asymmetric pole markers Cdc7-GFP and Mad2-GFP along with mCherry-Atb2 to mark microtubules. Our studies reveal that the daughter pole is affected in both pkl1 single mutant and pkl1 cut7 double mutant cells. Daughter pole disorganization additionally affects cytoplasmic astral microtubule arrays. Mitotic events can influence licensing and semi-conservative centrosome replication in the succeeding G1/S. In human cells, separase and polo kinase license centrosomes for duplication in the next cell cycle during mitosis.sup.39. Whether loss of Kinesin-14 Pkl1 impacts subsequent cell cycle events outside of mitosis is not known. However, the changes to daughter spindle pole integrity without Pkl1 indicate a broader role beyond microtubule nucleation for spindle assembly, such as maturation or integrity of the daughter MTOC. We did not detect a similar role with Kinesin-5 at the daughter MTOC and additional loss of Cut7 does not exacerbate these phenotypes. The concept of asymmetric events at spindle poles is well known. In budding yeast, -tubulin mutants have been isolated that block robust microtubule nucleation from a single pole as seen by transmission electron microscopy.sup.40. In human cells, mother centriole stability is asymmetrically affected by Kinesin-13 Kif24.sup.41. As well, regulation of poles can be asymmetric and is observed in mitotic checkpoint pathways.sup.26,34,35,42-47 that monitor spindle assembly, positioning and timing to help ensure the accurate segregation of chromosomes in cell division.
(40) This study demonstrates that the role of Kinesin-14 at -TuRC is to block microtubule nucleation and that key domains are required for this mechanism. This ability to localize to -TuRC at spindle pole bodies is conserved with -TuRC in the mammalian centrosome. We additionally identified the ability of Kinesin-5 to bind -TuRC as a key component in the Klp/-TuRC regulatory mechanism in fission yeast. Pkl1 interacts with -TuRC through two domains, a Motor domain that binds to -tubulin helix 11 and distinct Tail domain binding to the complex. The combined domains provide strongest interactions with -TuRC.sup.17. Data indicates that similar to Pkl1, the Tail domain of Cut7 is the primary -TuRC targeting element. We hypothesize that the Motor domain plays a role in assisted targeting to the -TuRC site at spindle poles and in competition with Pkl1 binding to this site. Consistent with our previously published findings on Pkl1, we observe that the combined domains of Cut7 provide the strongest interactions with -TuRC. However, unlike Pkl1 that has low affinity to microtubules.sup.48, Cut7 retains the ability to bind strongly to spindle tubulins when -tubulin specific binding is prevented. This alternative site of interaction may lower the pool of Cut7 at -TuRC. Thus, as a consequence of blocked loading due to the helix 11 mutation and retained high microtubule binding affinity, we would expect reduced binding of Cut7 to -TuRC complexes with -tubulin-K5A present as compared to Cut7ST, as observed. Interestingly, the cut7-22 mutation lies within a MAP kinase phosphorylation consensus sequence in the conserved BimC sequence of the Cut7 Tail domain.sup.29 indicating that phosphorylation at this or other kinase sites within this domain may be important in the -TuRC mechanism. Finally the dual regulatory relationship of Kinesin-14 and Kinesin-5 at the -TuRC in fission yeast, along with the ability of PTR peptide to block nucleation and spindle bipolarity in breast cancer cells is impactful in regard to cancer therapy.sup.49.
(41) Our findings are of particular interest in regard to multiple clinically oriented studies.sup.52-89 that demonstrate overexpression of -tubulin and other centrosomal proteins is characteristic of tumorigenesis and human malignancies in multiple tissues. In this case supernumerary microtubule-nucleating centrosomes are often observed and result in abnormal multipolar mitoses, aneuploidy and ultimately cell death.sup.58,59,61. Likewise, overexpression of -tubulin in malignant cells can also produce ectopic microtubule nucleation in the cytoplasm. This is thought to result from -tubulin-centrosome decoupling as well as sub-cellular sorting changes to soluble cytoplasmic pools or insoluble centrosomal complexes.sup.52,57,58,60 as well as insoluble cytoplasmic aggregates.sup.53. Interestingly, an increase in the percentage of soluble cytoplasmic -tubulin is associated with cell lines of higher aggressiveness and poorer prognosis versus those of low or moderate aggressiveness.sup.58. Further, -tubulin can be incorporated within the -/-tubulin lattice of cytoplasmic microtubules that may impact drug resistance.sup.58. The ability of the PTR peptide to target complexed -tubulin could allow a means to prevent ectopic microtubule nucleation, although currently this is untested. Regardless, the peptide can mitotically arrest both the MCF-7 low and MDA-MB-231 high aggressive cell lines with similar efficiency. The benefit of PTR versus other anti-mitotic agents that solely target microtubules is yet to be determined but is of interest in particular for malignant cell lines that are difficult to arrest and which often develop resistance.
(42) Combination of Kinesin-14 PTR Peptide and Kinesin-5 Antagonist for Mitotic Arrest
(43) Presently disclosed are methods and compositions that exploit the MTOC as a therapeutic target based on the identification of two MTOC sites involved in microtubule nucleation. Accordingly, for inducing mitotic arrest and growth inhibition in cells, the methods and compositions comprise the contemporaneous use of a Kinesin-14 Tail peptide that blocks MTOC nucleation and an antagonist of the Kinesin-5 BimC domain that counters the Kinesin-14 block.
(44) Kinesin-14 PTR Peptide
(45) A Kinesin-14 Tail peptide, for example the PTR peptide, which is described in more detail in Olmsted et al. Kinesin-14 Pkl1 targets -tubulin for release from the -tubulin ring complex (-TuRC) Cell Cycle 12:5, 1-7 2013 (the contents of which are incorporated herein by reference) binds to TuRC to block microtubule nucleation. PTR has the following amino acid sequence:
(46) YSKFKESAAPQLKDLIGSGAEKDHEYSLQLQ (SEQ ID NO: 1)
(47) Identification of Kinesin-5 BimC Antagonists
(48) Successful targeting of the MTOC to achieve mitotic arrest, however, requires more than just the action of Kinesin-14 to block nucleation. In the absence of a strategy to block the action of Kinesin-5, specifically the binding of the BimC domain of Kinesin-5 to the MTOC, the action by Kinesin-14 to prevent nucleation is itself interrupted. Accordingly, the cells are exposed not only to a Kinesin-14 Tail peptide, but also an antagonist of Kinesin-5. In one embodiment, Kinesin-5 BimC antagonists can be identified using a screening method that employs cells that express a Kinesin-14 Tail peptide, for example, PTR peptide.
(49) In human cancer cells, the addition of the Kinesin-14 Tail peptides blocks MT nucleation. The ability of BimC to counter Kinesin-14 removes the microtubule nucleation block. Drugs that target BimC will restore the Kinesin-14 block and can be validated using the BimC peptides.
(50) Drug delivery of non-peptide small molecule compounds that arrest growth can be done directly on cells expressing a Kinesin-14 Tail peptide. In one embodiment, transfected human tumor cells or tumor cell lines such as breast cancer cells MCF-7 and MDA-MB-231 are prepared as described below. The cells are then cultured under conditions for cell growth in the presence and absence of potential antagonists. Cells are monitored for signs of growth arrest and/or the appearance of apoptotic cells and a compound is deemed to be a Kinesin-5 BimC antagonist when cells grown in the presence of the compound are arrested in mitosis.
(51) In some embodiments, for example with peptides, potential antagonist/inhibitor peptides are transfected into the cells, for example in accordance with techniques well known in the art. In some embodiments, his-tags on the peptides allow identification by immunocytology. The cell proliferation assay may be done using low or high throughput platforms.
(52) Target specificity validation: Candidate drugs are tested for BimC specificity by added increasing BimC active peptides to dilute drug activity vs BimC nonactive peptides.
(53) Drug Screening ProtocolYeast
(54) In one embodiment, a protocol for identifying compounds with the ability to block BimC domain of Kinesin-5 employs yeast. Native genetic copies of both Kinesin-5 and Kinesin-14 are removed to create a double mutant (for example, in fission yeast, the cut7, pkl1 strain described in Olmsted, Z. T. et al. Kinesin-14 Pkl1 targets -tubulin for release from the -tubulin ring complex (-TuRC). Cell Cycle 12, 842-848, 2013).
(55) Drug delivery into cells for screening to identify non-peptide small molecule compounds that arrest growth can be done on non-spheroplasted cells in media or spheroplasted cells as necessary. For identification of peptide drugs libraries are transformed into yeast either with the use of guiding peptides (for details, see Rajerao et al. 2007) or by standard spheroplasting cells. In some embodiment, tags are included on the peptides to allow identification. The cell proliferation assay may be done in low or high throughput platforms.
(56) Target specificity validation: Candidate drugs are validated for BimC specificity by using the BimC peptide reagents. That is using increased levels of BimC active peptides to dilute drug activity versus BimC nonactive peptide controls.
(57) BimC Peptide Sequences
(58) In one embodiment, a Kinesin-5 BimC peptide has the amino acid sequence: YTGDTPSKRELPATPSW (SEQ ID NO: 6) corresponding to native elements. The same sequence with an N-terminal His-tag, for example, HHHHHHYTGDTPSKRELPATPSW (SEQ ID NO: 7) can also be used.
(59) HisBimCP, HHHHHHYTGDTPSKRELPADPSW (SEQ ID NO: 8), is a modified BimC sequence and is always active with His-tag.
(60) His BimC22, HHHHHHYTGDTPSKRELPATSSW (SEQ ID NO: 9), is a modified, His-tagged, BimC sequence that is inactive (control peptide).
(61) A screening protocol is described below to identify peptide or non-peptide small molecules that 1) mimic Kinesin-14/-tubulin action or 2) block Kinesin-5/-tubulin action. The strategy can be done in yeast, human or other eukaryotic cells and will provide two new classes of drugs operating on the same mechanism.
(62) Mimic Kinesin-14 peptide action (Active Kinesin-14 blocks MT nucleation; proliferation halted)
(63) Block Kinesin-5 peptide action (Active Kinesin-5 allows MT nucleation; proliferation halted)
(64) In the eukaryotic model organism fission yeast we demonstrated that active Kinesin-14 can be blocked by a fragment of the Kinesin-5 protein containing only the BimC domain (no motor-tubulin binding domain present; unpublished data,
(65) Research in the Paluh lab has demonstrated the conservation of mechanisms between human and fission yeast for the Kinesin-14 mechanism and -TuSC, indicating that this yeast is an appropriate non-human model for drug screening to target conserved mechanisms of MT nucleation in mitosis for yeast, human, rat and therefore a broad range of eukaryotes (Simeonov et al. 2009; Riehlman et al. 2013; Olmsted et al. Nat Communications 2014).
EXAMPLES
Example 1
Methods
(66) General Yeast Strains and Growth Conditions.
(67) Standard procedures for genetic manipulation of fission yeast are as described.sup.62 (S. pombe strains used are shown in Table 1). Cultures grown in fully supplemented YES rich medium or minimally supplemented medium are also as described.sup.62. For yeast transformations, the EZ-YEAST Transformation Kit (MP Biochemicals) was used. In growth assays, cells were grown to logarithmic phase in 10 mL rich YES media at 27 C. Cells were counted by hemocytometer and equalized and spotted at an initial concentration of 210.sup.7 cells/mL followed by 1/10 serial dilutions. Plates incubated at 30 C. and 36 C. were grown for 4-5 days (n=3 experiments). Plates incubated at 25 C. were grown for 7 days. For promoter induction using the pREP81 low strength.sup.63 or pREP90 high strength.sup.64 nmt plasmids, cells were maintained on plates containing 5 g/mL thiamine before inoculation in 10 mL selective media with (control) or without (test) 5 g/mL thiamine for 17 hours. Plates used to assess viability contained 5 mg/L Phloxine B (Sigma-Aldrich). Mini chromosome loss was measured as described.sup.65. Growth curves were obtained using hemocytometer.
(68) Site-directed mutagenesis, deletion constructs and bioinformatics. Site-directed changes or small deletions of the tail domain of the pkl1 gene were done by high-fidelity PCR with mutagenic oligonucleotides that also contained sites for cloning (Integrated DNA Technologies; Roche High Fidelity PCT Master, cat. 2140314). All constructs were sequenced (Northwoods DNA, Inc.; Center for Functional Genomics, University at Albany). For obtaining sequences and sequence analysis the following databases and resources were used: NCBI GenBank and Blastp, Welcome Trust Sanger Institute, The Broad Institute and ExPA Sy PROSITE. Accession numbers are Schizosaccharomyces pombe SpPkl1 (Sanger Center, SPAC_3A11.14c); Pkl1 homologs in Schizosaccharomyces cryophilus (Scy) and Schizosaccharomyces octosporus (So, Broad Institute SPOG_02038.3 and SPOG_00465.5, respectively); Homo sapiens HsHSET (KifC1), Mus musculus MmKifC1 and Rattus norvegicus RnKifC1 (NP_002254.2, GB_BAA19676.1, and NP_001005878.1, respectively).
(69) Yeast Strain Constructions.
(70) Integration of the ura4 gene at the cut7 locus was done using a PCR-based gene-targeting approach with long tracts of flanking homology as previously described.sup.66 (Epicentre MasterAmp Extra-Long PCR Kit). We used 500 by homology upstream and downstream of the cut7 open reading frame and verified stable integrants by colony PCR (
(71) Synchronous Yeast Culture.
(72) Cultures were grown overnight in YES rich or selective minimal media at 27 C. using baffled flasks. 11 mM hydroxyurea was added to cultures in logarithmic phase and incubated for four hours. Cells were then washed twice with 10 mL sterile water prior to release in fresh media. Depending on the experiment, cells were released at 27 C. (permissive temperature), 32 C. (microtubule repolymerization) or 36 C. (restrictive temperature).
(73) FPLC Sedimentation and Immunoprecipitate Analysis.
(74) Yeast whole cell extracts were prepared using mechanical bead beating (Mini-Beadbeater-16, Biospec) in Buffer P [50 mM Na2PO4 pH 7.2, 10% glycerol, 150 mM NaCl 5 mM ATP, 100 M GTP] with protease inhibitors (PMSF-1 mM, Luepeptin-50 M, Pepstatin-2 M, Aproptinin-175 nM, and Pefabloc-200 M). Three centrifugations at 17,000g (1 min, 5 min, 30 min) were used to clarify cell extracts. Separose 6 FPLC was performed as described.sup.15. For immunoprecipitation, whole cell extracts were incubated with anti-V5-tag mAb-Magnetic beads (MBL International) at 4 C. for 30 minutes. Beads were washed 3 with Buffer P prior to elution by boiling and immediate analysis by Western. Pkl1 peptide co-immunoprecipitation assays were performed as previously described.sup.17. Antibodies used were primary mouse anti--tubulin monoclonal (1:10,000; Sigma-Aldrich cat. T5326), primary rabbit anti-HA epitope tag (1:5,000; Rockland cat. 600-401-384), primary rabbit anti-FLAG polyclonal (1:320; Sigma-Aldrich cat. F7425), primary mouse anti-V5 monoclonal (1:5,000; Life Technologies cat. R96025) or mouse anti-V5 IgG horseradish peroxidase (HRP)-conjugated monoclonal (1:5,000; Life Technologies cat. R96125), goat anti-rabbit IgG HRP-conjugate (1:20,000; Millipore cat. 12-348) and goat anti-mouse IgG HRP-conjugate (1:10,000; Novagen cat. 71045).
(75) Human lysates were prepared by harvesting confluent cells with 2 mL TrypLE (Life Technologies) and centrifuging for 5 minutes at 1,000 rpm followed by two washes with 1 mL 1PBS. Cells were lysed by incubation on ice in RIPA+ Buffer (Tris-HCl pH 7.5, 50 mM, NaCl 150 mM, 1% Triton X-100, 1% Deoxycholic Acid Sodium Salt, 0.1% SDS; supplemented with Luepeptin 5 mM, Pepstatin 2 M, Aprotinin 175 nM, PMSF 1 mM+GTP 100 M) for 45 minutes, mixing occasionally. Lysates were clarified by centrifugation at 14,000 RPM (20,817g) at 4 C. for 1 hour. Peptide co-immunoprecipitation assays were performed as above. Antibodies used for Western blots were primary mouse anti--tubulin monoclonal (1:9,000; Sigma-Aldrich cat. T5326) and primary rabbit anti-GCP2 polyclonal (1:2,000; Thermo Scientific cat. PIPA521433). The secondary antibodies mentioned above were used for detection by HRP. Uncropped scans of Western blots are provided in
(76) Breast Cancer Cell Culture and Peptide Transfection.
(77) MCF-7 and MDA-MB-231 (ATCC) cells were maintained in 25 cm.sup.2 tissue culture treated Corning flasks (Sigma-Aldrich) in DMEM complete medium with Glutamax-1 and supplemented with 10% fetal bovine serum. MCF-7 DMEM complete medium was additionally supplemented with 0.01 mg/mL bovine insulin (Sigma-Aldrich). Flasks were maintained at 37 C. in 5% CO.sub.2, 95% air, and cells were passaged every 5-7 days using 1 mL TrypLE (Life Technologies).
(78) For live cell peptide transfection we used the Chariot system (Active Motif) according to the manufacturer's instructions. Cells were seeded into 35 mm tissue culture-treated dishes containing coverslips and grown in complete medium to 60% confluency. 1 g of Kinesin-14 Tail peptide PTR (GenScript) was diluted in 100 L 1PBS on ice. 6 L of 1/10 PBS-diluted Chariot reagent was further diluted into 100 L sterile water on ice in a separate tube. Diluted peptide and diluted Chariot were combined and incubated at room temperature for 30 minutes to allow the Chariot-peptide complex to form. Following incubation, media was aspirated from cells, which were then washed once in 1PBS. The entire 200 L volume was added to cells in 400 L serum-free media and gently rocked to ensure even delivery. Plates were returned to 37 C. for 1 hr. Next, DMEM complete growth medium was added to 2 mL without removing the peptide delivery solution (108 M peptide in 2 mL). Cells were further incubated at 37 C. overnight and fixed after 24 hours.
(79) Fluorescence Microscopy and Immunocytochemistry.
(80) Fluorescence microscopy was performed using Zeiss Observer.Z1 inverted microscope with 63 Plan-Apochromat 1.4 NA oil and 100 oil 1.45 PIanFLUAR DIC objectives. Data was obtained using a Hamamatsu ORCA ER CCD camera with Zeiss Axiovision Rel 4.8 acquisition software. We acquired 20-image 0.1 m Z-stacks. Timelapse series were acquired every 30 seconds to 6 minutes, with a median interval of 2 minutes. 10-image 0.1-micron Z-stacks were superimposed on each timelapse image in a series. With live cells, GFP-Atb2 was imaged at 50-60 ms exposure and mCherry-Atb2 was imaged at 500 ms exposure. Only GFP-Atb2 was used in timelapse. Average temperature in the imaging room was 23 C. Using 20 C. methanol fixation we were able to preserve GFP signal for quantifying phenotypes. In immunocytochemistry, microtubules were stained with primary TAT1 antibody (1:25).sup.67, followed by secondary goat anti-mouse Alexa Fluor 488 IgG (1:50; Life Technologies cat. A-11001) and DNA was stained in 1 g/mL Hoechst. Monoclonal anti-V5 primary antibody conjugated to FITC was used for viewing V5-tagged Cut7 constructs in fixed cells (1:500; Life Technologies cat. R963-25). Cells were imaged immediately using the Zeiss Observer.ZI system. In
(81) Human cells were fixed on glass coverslips in 20 C. methanol for 10 minutes, washed with 1PBS and permeabilized in 0.5% Triton X-100 for 20 minutes. Following further washes, cells were blocked for 30 minutes in 1% bovine serum albumin/knock out serum replacement (BSA/KOSR). For peptide localization to centrosomes, 1 g/mL of peptide was applied after blocking and before primary antibody application. Antibodies used were primary mouse anti--tubulin monoclonal (1:5,000; Sigma-Aldrich cat. T5326) or primary mouse anti--tubulin monoclonal DM1A (1:1,000; Santa Cruz Biotech cat. sc-32293), primary His-tag polyclonal antibody (1:1,000; Cell Signaling cat. 2365), secondary goat anti-mouse Alexa Fluor 488 IgG (1:1,000; Life Technologies cat. A-11001) and secondary goat anti-rabbit Texas Red (1:1,000; Life Technologies cat. T-6391). Antibodies were diluted in 1% BSA/KOSR antibody dilution buffer. After secondary antibody application and washes, DNA was stained with 1 g/mL Hoechst solution in 1PBS for 10 minutes followed by 3 final PBS washes and mounted on slides with ProLong Gold anti-fade (Life Technologies). 40-image 0.1 m Z-stacks were made into maximum intensity 2D projections using ImageJ.
(82) In Vitro Microtubule Nucleation Assays.
(83) In vitro microtubule nucleation assays were performed in a total volume of 5 L. That is, 3 L for the sample and 2 L of tubulin at a 1:5 ratio of Rhodamine:unlabeled tubulin (Cytoskeleton, Inc.). Total tubulin concentration was 3.75 g/L in 2.5 tubulin working buffer (2.5BRB80: 200 mM PIPES, 2.5 mM MgCl.sub.2, 2.5 mM EGTA at pH 6.8 and 2.5 mM GTP). For whole cell extract nucleation analysis with peptide, 2 L of whole cell extract was added with 1 L of peptide at 300 nM for a final peptide concentration of 60 nM. This 3 L combination was added first followed by tubulin working buffer. For samples with no peptide, the 5 L final volume was comprised of 3 L RIPA buffer and 2 L of whole cell extract. The 5 L reaction was combined on ice, quickly spun and returned to ice before incubating in a 37 C. water bath for 4 minutes. Sample incubation was staggered at 20 s intervals to allow for pipetting. After 4 minutes, 50 L of 1% glutaraldehyde fixing solution was added and tubes were incubated at room temperature for 3 minutes. Samples were completed by addition of 1 mL 1BRB80, inverting multiple times to mix. For analysis, 50 l of this mixture per sample was sedimented by ultracentrifugation at 173,000g through a 15% glycerol cushion onto glass cover slips and imaged by Rhodamine epifluorescence using the Zeiss system at 630. Images of multiple fields were collected and the average microtubule number per field was determined.
(84) Structural Analysis.
(85) PyMol molecular visualization software (V1.5) was used for structural analysis of the conserved --tubulin heterodimer 1TUB.sup.10 and conserved -tubulin monomer 1Z5V.sup.6,11,14,69 in
(86) Statistical Analysis.
(87) For statistical analysis of phenotypes, n values were chosen as number of cells per strain needed to ensure adequate power to detect significant outcomes. P-values were generated using Student's t-test and statistical significance was considered for P<0.05 as appropriate. All statistical data in this study is reported as means.d. or s.e.m., as indicated. For cell cycle arrest by 1 g transfection of PTR, 12 fields at 200 were counted. Arrested cells with positive peptide signal were taken as a percentage of the entire population. Cells that were negative for peptide signal did not arrest.
(88) Kinesin-5 is Dispensable in the Absence of Kinesin-14 Pkl1.
(89) Spindle bipolarity in fission yeast requires Kinesin-5 Cut7.sup.27. The mechanism underlying its essential nature remains unclear as another Klp, Kinesin-6 Klp9, is capable of crosslinking antiparallel microtubules and is required for spindle elongation.sup.28. In eukaryotes, an opposing relationship between Kinesin-5 and Kinesin-14 Klps in microtubule regulation is highly conserved. We previously demonstrated that Kinesin-14 Pkl1 directly binds and down regulates -TuRC function.sup.17,23. We tested the hypothesis that a required role of Kinesin-5 Cut7 (cut7 gene), which localizes at spindle poles, is to oppose Kinesin-14 Pkl1 (pkl1 gene). By homologous recombination (
(90) Kinesin-5 Cut7 Binds -TuRC Through Motor and Tail Domains.
(91) Kinesin-14 Pkl1 negatively regulates -TuRC through two internal protein domains that include elements of its Motor and Tail regions.sup.17,22. To determine if Cut7 binds the -TuRC MTOC by a similar mechanism Fast Protein Liquid Chromatography (FPLC).sup.15,17 using V5-tagged deletion derivatives of Cut7 previously generated.sup.29, immunocytology using newly generated V5-tagged deletion and site-directed mutagenesis derivatives and Pkl1 peptide co-immunoprecipitation assays (
(92) We previously demonstrated that mutation of a conserved lysine residue to alanine in -tubulin helix 11 (gtb1-K5A) abolishes Pkl1 Motor domain binding to -TuRC and blocks its full function in vivo.sup.22. To determine if Cut7 similarly binds to -tubulin through helix 11 we examined its FPLC profile in the gtb1-K5A strain (
(93) The Kinesin-5 Cut7 BimC Tail Element Directs Pole Targeting.
(94) The eukaryotic BimC domain is highly conserved across Kinesin-5 members.sup.30,31. The domain was first identified in the Aspergillus nidulans Kinesin-5 BimC protein.sup.32, but its precise role in mitosis has remained unknown for two decades. To examine the consequences of a mutation to the BimC domain of Cut7 on spindle pole localization we used the loss of function temperature sensitive allele cut7-22 that contains a single point mutation within this region (1,021 Pro to Ser).sup.22. To determine if the BimC box is the primary spindle pole targeting site in the Cut7 Tail domain, we utilized V5-tagged Cut7 deletion and/or site-directed mutagenesis constructs with a fused NLS (
(95) Pkl1 Regulates Spindle Morphology from -TuRC.
(96) Mitotic phenotypes in strains carrying single pkl1 or pkl1 cut7 double mutants versus wild type were evaluated by live cell and timelapse imaging of microtubules (-tubulin as mCherry-Atb2 or GFP-Atb2), spindle poles (-TuRC pericentrin protein 1, Pcp1-GFP), antiparallel microtubules and chromatin (anaphase B and chromatin binding Kinesin-6 member Klp9-GFP) as well as Hoechst staining of DNA. An increase in spindle thickness is observed in the pkl1 cut7 double mutant strain versus wild type as seen in single strain imaging (
(97) The nature of the morphological change to spindle thickness could be the result of an increase in the number of antiparallel microtubules from both poles, parallel microtubules that emanate from a single pole, or due to unattached microtubules or disorganized arrays.sup.20 at a single pole. To distinguish amongst these possibilities we used multiple approaches. Kinesin-6 Klp9-GFP crosslinks antiparallel microtubule arrays.sup.28 and can be used to preferentially mark the extent of microtubule overlap (generally midzone) and is used with -tubulin (mCherry-Atb2) to visualize spindle microtubules and length of the mitotic spindle. In wild type cells, the Klp9-GFP signal spans the entire spindle midzone width (
(98) Morphological changes in spindle thickness do not affect mitotic progression in the pkl1 cut7 double mutant cells through anaphase as seen by timelapse imaging and kymographic analysis versus wild type (
(99) Daughter Pole Disorganization Persists in the Double Mutant.
(100) An asymmetric effect on SPB organization with loss of the typical plaque-like appearance at one pole has been observed by TEM analysis of the pkl1 strain.sup.20. Similarly in the pkl1 cut7 double mutant we observe an asymmetric effect on spindle poles, including altered astral microtubule arrays as previously shown.sup.33. Here we additionally identify the daughter pole as being primarily affected (
(101) Pkl1 and Pkl1 Cut7 Share Chromosome Segregation Defects.
(102) We monitored chromosome segregation in the double mutant by live cell timelapse fluorescence microscopy and immunocytology of microtubules and DNA as well as mini chromosome loss (
(103) In wild type cells, Mad2 monitors proper bipolar attachment of spindle microtubules to the kinetochore (KT), then transitions from KTs to both SPBs coincident with anaphase A onset. In anaphase B, Mad2 becomes asymmetric and makes a subsequent transition from the daughter pole to the equatorial MTOC, but remains asymmetrically localized at the mother pole.sup.26. We observe Mad2-GFP associated with the lost chromosome that is attached by an intranuclear microtubule (
(104) An Asymmetric Block on -TuRC Nucleation Competency by Pkl1.
(105) We previously demonstrated that Kinesin-14 Pkl1 physically interacts with -TuRC in prophase to down regulate its function and oppose bipolar spindle assembly.sup.17,22. We established an in vivo assay system to examine the impact of elevated levels of Pkl1 in double mutant cells where Kinesin-5 Cut7 is absent (
(106) We envision three possible models in which spindle assembly would fail via a spindle pole based mechanism that are based on tubulin seeding at -TuRC (
(107) Kinesin-14 PTR Peptide Arrests Human Breast Cancer Cells.
(108) All human -TuSC proteins are functional in fission yeast.sup.14,15. This makes fission yeast a suitable model for examining the role and function of these proteins in humans.
(109) We previously developed biochemical tools in the form of Kinesin-14 Tail peptides.sup.17 that regulate -TuRC in vitro and here tested the conserved capability of these peptides to block microtubule nucleation in human MCF-7 breast cancer cells (
(110) By live cell transfection of human MCF-7 breast cancer cells that exhibit low aggressiveness or MDA-MB-231 cells that are highly aggressive, we show that PTR is a potent mitotic spindle protein (MSP) class regulator of mitotic arrest (
(111) Effective targeting of the MTOC complex to induce mitotic arrest requires (1) binding of Kinesin-14 (or a Kinesin-14 Tail peptide, such as PTR) to -TuRC to block nucleation and (2) blocking the BimC domain of Kinesin-5 to prevent the Kinesin-14 action of (1) to be overridden. In other words, to arrest proliferation, Kinesin-14 should be active and Kinesin-5 should be inactive.
(112) In one embodiment, eukaryotic cells transfected to express the Kinesin-14 Tail peptide, PTR, can be used to screen for agents that block kinesin-5 BimC. Agents that do not block the Kinesin-5 BimC domain, including Ispinisib, will leave the BimC domain intact, thereby rendering it ineffective to remove the ability of kinesin-5 to counter Kinesin-14 at the MTOC. In other words, in the presence of an active kinesin-5 BimC domain the ability of kinesin-14 to inactivate the MTOC is blocked, promoting spindle formation by the MTOC.
(113) Conversely, an agent that is able to block Kinesin-5 BimC will permit the unimpeded action of Kinesin-14 or a Kinesin-14 Tail peptide such as PTR to block nucleation at -TuRC and ultimately to cause mitotic arrest.
(114) TABLE-US-00001 TABLE 1 Schizosaccharomyces pombe strains used in this study Strain Genotype FY392 h his3-D1 leu1-32 ade6-M210 ura4-D18 JP163 h+ his3-D1 leu1-32 ura4-D18 ade6-M216 pkl1D::his3+ JP164 h his3-D1 leu1-32 ura4-D18 ade6-M216 pkl1D::his3+ JPZ047 h+ his3-D1 leu1-32 ura4-D18 ade6-M216 pkl1D::his3+ cut4D::ura4+ JPZ048 h his3-D1 leu1-32 ura4-D18 ade6-M216 pkl1D::his3+ cut4D::ura4+ JP181 h+ his3-D1 leu1-32 ura4-D18 ade6-M216 cut4-22ts JP183 h+ his3-D1 leu1-32 ura4-D18 ade6-M216 pkl1D::his3+ cut4-22ts JPZ049 h his3-D1 leu1-32 ade6-M210 ura4-D18 [a rs1::p rep41GFP/atb2] JPZ050 h+ his3-D1 leu1-32 ura4-D18 ade6-M216 pkl1D::his3+ [ars1::p rep41GFP/atb2] JPZ051 h+ his3-D1 leu1-32 ura4-D18 ade6-M216 pkl1D::his3+ cut4D::ura4+[ars1::p JPZ052 h+ his3-D1 leu1-32 ura4-D18 ade6-M216 cut4-22ts [ars1::p rep41GFP/atb2] JPZ053 h+ his3-D1 leu1-32 ura4-D18 ade6-M216 pkl1D::his3+ cut4-22ts [ars1::p JPZ054 h+ his3-D1 leu1-32 ura4-D18 ade6-M216 cut4-22ts [ars1::pJPGFP/gtb1] JPZ055 h+ his3-D1 leu1-32 ura4-D18 ade6-M216 pkl1D::his3+ cut4-22ts JP114 h his3-D1 leu1-32 ura4-D18 ade6-M210 pcp1-GFP::G418.sub.R JP265 h his3-D1 leu1-32 ura4-D18 pcp1-GFP::G418.sub.R pkl1D::his3+ JPZ056 his3-D1 leu1-32 ura4-D18 pcp1-GFP-G418.sub.R pkl1D::his3+ cut4D::ura4+ JPZ057 h his3-D1 leu1-32 ura4-D18 pcp1-GFP::G418.sub.R [ars1::p rep81GFP/P450] JPZ058 h his3-D1 leu1-32 ura4-D18 pcp1-GFP::G418.sub.R pkl1D::his3+ [ars1::p JPZ059 h+ his3-D1 leu1-32 ura4-D18 pcp1-GFP::G418.sub.R pkl1D::his3+ cut4D::ura4+ [ars1::p 1PZ060 h his3-D1 leu1-32 ura4-D18 pcp1-GFP::G418.sub.R [ars1::p rep41mCherry/atb2] JPZ061 h his3-D1 leu1-32 ura4-D18 pcp1-GFP::G418.sub.R pkl1D::his3+ [ars1::p JPZ062 his3-D1 leu1-32 ura4-D18 pcp1-GFP::G418.sub.R pkl1D::his3+ cut4D::ura4+ [ars1::p JPZ063 h+ his3-D1 leu1-32 ura4-D18 ade6-M216 pcp1-GFP::G418.sub.R pkl1D::his3+ JPZ064 h+ his3-D1 leu1-32 ura4-D18 ade6-M216 pkl1D::his3+ cut4D::ura4+ JP81 h leu1-32 ura4-D18 ade6-404 [pSp(cen1-4L)sup3E::ura4+] JPZ065 leu1-32 ura4-D18 ade6-404 pkl1D::his3+ [pSp(cen1-4L)sup3E::ura4+] JPZ066 leu1-32 ura4-D18 ade6-404 pkl1D::his3+ cut4D::ura4+ [pSp(cen1-4L)sup3E::ura4+] JP113 h+ leu1-32 ura4-D18 ade6-M210 mad2D::ura4+ JPZ067 his3-D1 leu1-32 ura4-D18 pkl1D::his3+ cut4D::ura4+ mad2D::ura4+ ColP16 h leu1-32 mad2-eGFP::ura4+ JP113 leu1-32 pkl1D::his3+ mad2-eGFP::ura4+ JPZ068 leu1-32 pkl1D::his3+ cut4D::ura4+ mad2-eGFP::ura4+ JPZ069 leu1-32 pkl1D::his3+ cut4D::ura4+ mad2-eGFP::ura4+ [ars1::prep41mCherry/atb2] JP136 h leu1-32 ura4-D18 ade6-M210 gtb1-PL302 JPZ070 leu1-32 ura4-D18 ade6-M210 gtb1-PL302 pkl1D::his3+ cut4D::ura4+ JPZ071 leu1-32 ura4-D18 ade6-M210 gtb1-PL302 pkl1D::his3+ cut4D::ura4+ JP129 his4-336/his4- leu1-32/1eu1-32 ura4-D18/ura4-D18 ade6-M210/ade6-M216 JPZ072 his4 leu1-32 ura4-D18 gtb1D::his4+ [ars1::prep81GFP/gtb1-K5A] JPZ073 his4 leu1-32 ura4-D18 gtb1D::his4+ [ars1::prep81GFP/gtb1-K5A] pkl1D::his3+ JPZ074 his4 leu1-32 ura4-D18 gtb1D::his4+ [ars1::prep81GFP/qtb1-K5A1 cut4D::ura4+ JPZ075 his4 leu1-32 ura4-D18 gtb1D::his4+ [ars1::prep42/gtb1-K5A] [pREP81FLAG/pkl1] JPZ076 his4 leu1-32 ura4-D18 gtb1D::his4+ [ars1::prep42/gtb1-K5A] [pREP81V5 cut4] JPZ077 his4 leu1-32 ura4-D18 gtb1D::his4+ [ars1::prep42/gtb1-K5A] [pREP81V5/cut4- JPZ078 his4 leu1-32 ura4-D18 gtb1D::his4+ [ars1::prep42/gtb1-K5A] [pREP81V5/cut4-ST] JPZ079 h+ his3-D1 leu1-32 ura4-D18 ade6-M216 pkl1D::his3+ [pREP81FLAG/pkl1] JPZ080 h+ his3-D1 leu1-32 ura4-D18 ade6-M216 pkl1D::his3+ [pREP90x/pkl1D95NLS] JPZ081 h+ his3-D1 leu1-32 ura4-D18 ade6-M216 pkl1D::his3+ cut4D::ura4+ JPZ082 h+ his3-D1 leu1-32 ura4-D18 ade6-M216 pkl1D::his3+ cut4D::ura4+ JPZ083 h+ his3-D1 leu1-32 ura4-D18 ade6-M216 pcp1-GFP::G418.sub.R pkl1D::his3+ cut4D::ura4+ [pREP81FLAG/pkl1] JPZ084 h+ his3-D1 leu1-32 ura4-D18 ade6-M216 pkl1D::his3+ [pREP81V5/cut4] JPZ085 h+ his3-D1 leu1-32 ura4-D18 ade6-M216 pkl1D::his3+ cut4D::ura4+ JPZ086 h+ his3-D1 leu1-32 ura4-D18 ade6-M216 pkl1D::his3+ cut4D::ura4+ JPZ087 h+ his3-D1 leu1-32 ura4-D18 ade6-M216 pkl1D::his3+ cut4D::ura4+ JPZ088 h+ his3-D1 leu1-32 ura4-D18 ade6-M216 pkl1D::his3+ cut4D::ura4+ JPZ089 h+ his3-D1 leu1-32 ura4-D18 ade6-M216 pkl1D::his3+ cut4D::ura4+ JPZ090 h+ his3-D1 leu1-32 ura4-D18 ade6-M216 pkl1D::his3+ cut4D::ura4+ JPZ091 h+ his3-D1 leu1-32 ura4-D18 ade6-M216 pkl1D::his3+ cut4D::ura4+ [pREP81V5NLS/cut4T.sup.22] LV15 h leu1-32 alp4-HI::G418.sub.r JPZ092 h leu1-32 alp4-HI::G418.sub.r [pREP81V5/cut4] JPZ093 h leu1-32 alp4-HI::G418.sub.r [pREP81V5NLS/cut4ST] JP272 h his3-D1 leu1-32 ura4-D18 ade6-M210 klp9-GFP::ura4+ JP270 h his3-D1 leu1-32 ura4-D18 ade6-M210 pkl1D::his3+ klp9-GFP::ura4+ JPZ094 his3-D1 leu1-32 ura4-D18 pkl1D::his3+ cut4D::ura4+ klp9-GFP::ura4+ JPZ095 his3-D1 leu1-32 ura4-D18 pkl1D::his3+ cut4D::ura4+ klp9-GFP::ura4+ JPZ096 h his3-D1 leu1-32 ura4-D18 pkl1D::his3+ [pREP82GFP/klp9] JPZ097 his3-D1 leu1-32 ura4-D18 cdc4-GFP::ura4+ pkl1D::his3+ cut4D::ura4+ JPZ098 his3-D1 leu1-32 ura4-D18 cut4-22ts pcp1-GFP::G418.sub.R [ars1::p
REFERENCES
(115) 1. Rieder, C. & Khodjakov, A. Mitosis through the microscope: advances in seeing inside live dividing cells. Science 300, 91-96 (2003). 2. Riehlman, T. R., Olmsted, Z. T. & Paluh, J. L. The Nanobiotechnology Handbook. Chapter 4: Molecular Motors. CRC Press (2012). ISBN 9781439838693. 3. Manchado, E., Guillamot, M. & Malumbres, M. Killing cells by targeting mitosis. Cell Death Differ. 19, 369-377 (2012). 4. Pickett-Heaps, J. D. The evolution of the mitotic apparatus: an attempt at comparative ultrastructural plant cytology in dividing plant cells. Cytobios. 1, 257-280 (1969). 5. Oakley, C. E. & Oakley, B. R. Identification of gamma-tubulin, a new member of the tubulin superfamily encoded by mipA gene of Aspergillus nidulans. Nature 338, 662-664 (1989). 6. Stearns, T., Evans, L. & Kirschner, M. -tubulin is a highly conserved component of the centrosome. Cell 65, 625-636 (1991). 7. Moritz, M. et al. Structure of the -tubulin ring complex: a template for microtubule nucleation. Nat. Cell Biol. 2, 365-370 (2000). 8. Wiese, C. & Zheng, Y. Microtubule nucleation: -tubulin and beyond. J. Cell Sci. 119, 4143-4153 (2006). 9. Lders, J. & Stearns, T. Microtubule-organizing centres: a re-evaluation. Nat. Rev. Mol. Cell Biol. 8, 161-167 (2007). 10. Nogales, E., Wolf, S. G. & Downing, K. H. Structure of the /-tubulin dimer by electron crystallography. Nature 391, 199-203 (1998). 11. Aldaz, H., Rice, L. M., Stearns, T. & Agard, D. A. Insights into microtubule nucleation from the crystal structure of human -tubulin. Nature 435, 523-527 (2005). 12. Guillet, V. et al. Crystal structure of -tubulin complex protein GCP4 provides insight into microtubule nucleation. Nat. Struc. Mol. Biol. 18, 915-921 (2011). 13. Kollman, J. M. et al. The structure of the -tubulin small complex: implications of its architecture and flexibility for microtubule nucleation. MBoC 19, 207-215 (2008). 14. Horio, T. & Oakley, B. R. Human -tubulin functions in fission yeast. J. Cell Biol. 126, 1465-1473 (1994). 15. Riehlman, T. R. et al. Functional replacement of fission yeast -tubulin small complex proteins Alp4 and Alp6 by human GCP2 and GCP3. J. Cell Sci. 126, 4406-4413 (2013). 16. Masuda, H., Mori, R., Yukawa, M. & Toda, T. Fission yeast MOZART/Mzt1 is an essential -tubulin complex component for complex recruitment to the microtubule organizing center, but not its assembly. MBoC 24, 2894-2906 (2013). 17. Olmsted, Z. T. et al. Kinesin-14 Pkl1 targets -tubulin for release from the -tubulin ring complex (-TuRC). Cell Cycle 12, 842-848 (2013). 18. Pidoux, A. L., LeDizet, M., & Cande, W. Z. Fission yeast pkl1 is a kinesin-related protein involved in mitotic spindle function. MBoC 7, 1639-1655 (1996). 19. Saunders, W., Hornack, D., Lengyel, V. & Deng, C. The Saccharomyces cerevisiae kinesin-related motor Kar3p acts a preanaphase spindle poles to limit the number and length of cytoplasmic microtubules. J. Cell Biol. 137, 417-431 (1997). 20. Grishchuk, E. L., Spiridonov, I. S. & McIntosh, J. R. Mitotic chromosome biorientation in fission yeast is enhanced by dynein and a minus-end directed, kinesin-like protein. MBoC 18, 2216-2225 (2007). 21. Cai, S., Weaver, L. N., Ems-McClung, S. C. & Walczak, C. E. Proper organization of microtubule minus-ends is needed for midzone stability and cytokinesis. Curr. Biol. 20, 880-885 (2010). 22. Rodriguez, A. S. et al. Protein complexes at the microtubule organizing center regulate bipolar spindle assembly. Cell Cycle 7, 1246-1253 (2008). 23. Simeonov, D. R. et al. Distinct kinesin-14 mitotic mechanisms in spindle bipolarity. Cell Cycle 8, 3563-3575 (2009). 24. Paluh, J. L. et al. A mutation in -tubulin alters microtubule dynamics and organization and is synthetically lethal with the Klp Pkl1p. MBoC 11, 1225-1239 (2000). 25. Tange, Y., Fujita, A., Toda, T. & Niwa, O. Functional dissection of the -tubulin complex by suppressor analysis of gtb1 and alp4 mutations in Schizosaccharomyces pombe. Genetics 167, 1095-1107 (2004). 26. Mayer, C., Filopei, J., Batac, J., Alford, L. & Paluh, J. L. An extended anaphase signaling pathway for Mad2p includes microtubule organizing center proteins and multiple motor transitions. Cell Cycle 5, 1456-1463 (2006). 27. Hagan, I. & Yanagida, M. Novel potential mitotic motor protein encoded by the fission yeast cut7+ gene. Nature 347, 563-566 (1990). 28. Fu, C. et al. Phosphoregulated interaction between Kinesin-6 Klp9 and microtubule bundler Ase1p promotes spindle elongation. Dev. Cell 17, 257-267 (2009). 29. Drummond, D. R. & Hagan, I. M. Mutations in the bimC box of Cut7 indicate divergence of regulation within the bimC family of kinesin related proteins. J. Cell Sci. 111, 853-865 (1998). 30. Heck, M. M. S. et al. The Kinesin-like Protein KLP61F Is Essential for Mitosis in Drosophila. J. Cell Biol. 123, 665-679 (1993). 31. Lawrence, C. J. et al. A standardized kinesin nomenclature. J. Cell Biol. 167, 19-22 (2004). 32. Enos, A. P. & Morris, N. R. Mutation of a gene that encodes a kinesin-like protein blocks nuclear division in A. nidulans. Cell 60, 1019-1027 (1990). 33. Syrovatkina, V., Fu, C. & Tran, P. T. Antagonistic spindle motors and MAPs regulate metaphase spindle length and chromosome segregation. Curr. Biol. 23, 2423-2429 (2013). 34. Schmidt, S., Sohrmann, M., Hofmann, K., Woollard, A. & Simanis, V. The Spg1p GTPase is an essential, dosage-dependent inducer of septum formation in Schizosaccharomyces pombe. Genes Dev. 11, 1519-1534 (1997). 35. Grallert, A., Krapp, A., Bagley, S., Simanis, V. & Hagan, I. M. Recruitment of NIMA kinase shows that maturation of the S. pombe spindle-pole body occurs over consecutive cell cycles and reveals a role for NIMA in modulating SIN activity. Genes Dev. 18, 1007-1021 (2004). 36. Gachet, Y. et al. Sister kinetochore recapture in fission yeast occurs by two distinct mechanisms, both requiring Dam1 and Klp2. MBoC 19, 1646-1662 (2008). 37. Hagan, I. & Yanagida, M. Kinesin-related cut7 protein associates with mitotic and meiotic spindles in fission yeast. Nature 356, 74-76 (1992). 38. Tanenbaum, M. E. & Medema, R. H. Mechanisms of centrosome separation and bipolar spindle assembly. Dev. Cell 19, 797-806 (2010). 39. Tsou, M-F. B. et al. Polo kinase and separase regulate the mitotic licensing of centriole duplication in human cells. Dev. Cell 17, 344-354 (2009). 40. Marschall, L. G., Jeng, R. L., Mulholland, J. & Stearns, T. Analysis of Tub4p, a yeast -tubulin-like protein: implications for microtubule-organizing center function. J. Cell Biol. 134, 443-454 (1996). 41. Kobayashi, T., Tsang, W. Y., Li, J., Lane, W. & Dynlacht, B. D. Centriolar kinesin Kif24 interacts with CP110 to remodel microtubules and regulate ciliogenesis. Cell 145, 914-925 (2011). 42. Leisner, C. et al. Regulation of mitotic spindle asymmetry by SUMO and the spindle-assembly checkpoint in yeast. Curr. Biol. 18, 1249-1255 (2008). 43. Yamashita, Y. M. & Fuller, M. T. Asymmetric centrosome behavior and the mechanisms of stem cell division. J. Cell Biol. 180, 261-266 (2008). 44. Campbell, E. K. M., Werts, A. D. & Goldstein, B. A cell cycle timer for asymmetric spindle positioning. PLoS Biol. DOI: 10.1371/journal.pbio.1000088 (2009). 45. Caydasi, A. K., Ibrahim, B. & Pereira, G. Monitoring spindle orientation: spindle position checkpoint in charge. Cell Division 5, 1-15 (2010). 46. Hotz, M., Lengefeld, J. & Barral, Y. The MEN mediates the effects of the spindle assembly checkpoint on Kar9-dependent spindle pole body inheritance in budding yeast. Cell Cycle 11, 3109-3116 (2012). 47. Johnson, A. E., McCollum, D. & Gould, K. L. Polar opposites: fine-tuning cytokinesis through SIN asymmetry. Cytoskeleton 69, 686-699 (2012). 48. Furuta, K., Edamatsu, M., Maeda, T., Toyoshima, Y. Y. Diffusion and directed movement: in vitro motile properties of fission yeast kinesin-14 Pkl1. J. Biol. Chem. 283, 36465-36473 (2008). 49. Craik, D. J., Fairlie, D. P., Liras, S. & Price, D. The future of peptide-based drugs. Chem. Biol. Drug Des. 81, 136-147 (2013). 50. Mayer, T. U. et al. Small molecule inhibitor of mitotic spindle bipolarity identified in a phenotype-based screen. Science 286, 971-974 (1999). 51. Chan, K-S. et al. Mitosis-targeted anti-cancer therapies: where they stand. Cell Death Dis. DOI: 10.1038/cddis.2012.148 (2012). 52. Katsetos, C. D. et al. Altered cellular distribution and subcellular sorting of -tubulin in diffuse astrocytic gliomas and human glioblastoma cell lines. J. Neuropathol. Exp. Neurol. 65, 465-477 (2006). 53. Katsetos, C. D. et al. Class III -tubulin and -tubulin are co-expressed and form complexes in human glioblastoma cells. Neurochem. Res. 32, 1387-1398 (2007). 54. Liu, T., Niu, Y., Yu, Y., Liu, Y. & Zhang, F. Increased -tubulin expression and P16.sup.INK4A promoter methylation occur together in preinvasive lesions and carcinomas of the breast. Ann Oncol. 20 Martha Buntin, 441-448 (2009). 55. Niu, Y. et al. Increased expression of centrosomal a, -tubulin in atypical ductal hyperplasia and carcinoma of the breast. Cancer Sci. 100, 580-587 (2009). 56. Syed, M. I. et al. Gamma tubulin: A promising indicator of recurrence in squamous cell carcinoma of the larynx. Otolaryngol. Head Neck Surg. 140, 498-504 (2009). 57. Caracciolo, V. et al. Differential expression and cellular distribution of -tubulin and III-tubulin in medulloblastomas and human medulloblastoma cell lines. J. Cell Physiol. 223, 519-529 (2010). 58. Cho, E. H., Whipple, R. A., Matrone, M. A., Balzer, E. M. & Martin, S. S. Delocalization of -tubulin due to increased solubility in human breast cancer cell lines. Cancer Biol. Ther. 9, 66-76 (2010). 59. Loh, J-K. et al. Differential expression of centrosomal proteins at different stages of human glioma. BMC Cancer 10,268 (2010). 60. Maounis, N. F. et al. Overexpression of -tubulin in non-small cell lung cancer. Histol. Histopathol. 27, 1183-1194 (2012). 61. Rath, O. & Kozielski, F. Kinesins and Cancer. Nat. Rev. Cancer 12, 527-539 (2012). 62. Moreno, S., Klar, A. & Nurse, P. Molecular genetic analysis of fission yeast Schizosaccharomyces pombe. Methods Enzymol. 194, 795-823 (1991). 63. Maundrell, K. Thiamine-repressible expression vectors pRep and pRIP for fission yeast. Gene 123, 127-130 (1993). 64. Huang, Y., Hamada, M., Patel, J. & Maraia, R. J. Construction of FLAG and histidine tagging vectors for Schizosaccharomyces pombe. Yeast 18, 463-468 (2001). 65. Hou, H. et al. Csi1 links centromeres to the nuclear envelope for centromere clustering. J. Cell Biol. 199, 735-744 (2012). 66. Krawchuk, M. D. & Wahls, W. P. High-efficiency gene targeting in Schizosaccharomyces pombe using a modular, PCR-based approach with long tracts of flanking homology. Yeast 15, 1419-1427 (1999). 67. Woods, A. et al. Definition of individual components within the cytoskeleton of Trypanosoma brucei by a library of monoclonal antibodies. J. Cell Sci. 93, 491-500 (1989). 68. Samejima, I., Lourenco, P. C. C., Snaith, H. A. & Sawin, K. E. Fission yeast mto2p regulates microtubule nucleation by the centrosomin-related protein mto1p. MBoC 16, 3040-3051 (2005). 69. Burns, R. G. Analysis of the -tubulin sequences: implications for the functional properties of -tubulin. J Cell Sci. 108, 2123-2130 (1995). 70. Z. T. Olmsted, A. Colliver, T. D. Riehlman, and J. L. Paluh (2014) Kinesin-14 and kinesin-5 antagonistically regulate microtubule nucleation -TuRC in yeast and human cells. Nature Communications 5:5339. doi:10.1038/ncomms 6339.