MALARIA VACCINE
20170035871 ยท 2017-02-09
Assignee
Inventors
Cpc classification
Y02A50/30
GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
C12N2770/36134
CHEMISTRY; METALLURGY
A61K2300/00
HUMAN NECESSITIES
A61P33/02
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
A61K39/015
HUMAN NECESSITIES
C12N2770/36034
CHEMISTRY; METALLURGY
International classification
Abstract
The present invention provides a particle comprising a polypeptide and at least one malaria antigen, and a composition or vaccine comprising thereof, its use in medicine, particularly in the prevention or treatment of malaria infections.
Claims
1-44. (canceled)
45. A virus-like particle comprising a virus structural polypeptide and at least one malaria antigen, wherein said virus structural polypeptide is a polypeptide derived from alphavirus or flavivirus.
46. The virus-like particle according to claim 45, wherein said virus structural polypeptide is a polypeptide derived from alphavirus.
47. The virus-like particle according to claim 45, wherein said virus structural polypeptide comprises the capsid and/or the envelope proteins E1 and E2.
48. The virus-like particle according to claim 47, wherein said at least one malaria antigen is inserted into E2 of the envelope protein.
49. The virus-like particle according to claim 45, wherein said virus structural polypeptide is a polypeptide derived from Chikungunya virus (CHIKV) or Venezuelan equine encephalitis virus (VEEV).
50. The virus-like particle according to claim 45, wherein said at least one malaria antigen is a fragment derived from the circumsporozoite protein.
51. The virus-like particle according to claim 45, wherein said at least one malaria antigen is an antigen comprising (NPNA).sub.n wherein n is from 4 to 30 and/or an antigen comprising (EYLNKIQSLSTEWSPCSVT).sub.y wherein y is from 1 to 6.
52. The virus-like particle according to claim 49, wherein said at least one malaria antigen is inserted between 509-510, 510-511, 511-512, 519-520, 529-530, 530-531 or 531-532 of SEQ ID NO: 1 or 2, or between residues 515-516, 516-517, 517-518, 518-519, 519-520, 536-537, 537-538 or 538-539 of SEQ ID NO: 3.
53. The virus-like particle according to claim 49, wherein the particle is Chikungunya virus-like particle consisting of one or more envelope protein E2 into which the antigen is inserted, one or more envelope protein E1 and one or more capsid, and wherein the envelope protein E2 into which the antigen is inserted consists of an amino acid sequence represented by SEQ ID NO: 50; the envelope protein E1 consists of an amino acid sequence represented by SEQ ID NO: 51; and the capsid consists of an amino acid sequence represented by SEQ ID NO: 52.
54. The virus-like particle according to claim 49, wherein the particle is Venezuelan equine encephalitis virus-like particle consisting of one or more envelope protein E2 into which the antigen is inserted, one or more envelope protein E1 and one or more capsid, and wherein the envelope protein E2 into which the antigen is inserted consists of an amino acid sequence represented by SEQ ID NO: 53; the envelope protein E1 consists of an amino acid sequence represented by SEQ ID NO: 54; and the capsid consists of an amino acid sequence represented by SEQ ID NO: 55.
55. An isolated nucleic acid molecule comprising a nucleotide sequence for expressing the particle according to claim 45.
56. A vector comprising the nucleic acid molecule according to claim 55, wherein the vector optionally comprises an expression control sequence operably linked to the nucleic acid molecule.
57. A pharmaceutical composition comprising: (a) the virus-like particle according to claim 45 and/or a nucleic acid molecule comprising a nucleotide sequence for expressing the particle according to claim 45; and (b) a pharmaceutically acceptable carrier.
58. A vaccine composition comprising the virus-like particle according to claim 45.
59. A method of treating malaria in a mammal, comprising administering an effective amount of the virus-like particle according to claim 45 and/or a nucleic acid molecule comprising a nucleotide sequence for expressing the particle according to claim 45 to the mammal in need thereof.
60. A method of treating malaria in a mammal, comprising administering a priming composition comprising at least one first malaria antigen or at least one polynucleotide encoding at least one first malaria antigen; and a boosting composition comprising at least one polypeptide comprising at least one second malaria antigen or at least one polynucleotide encoding at least one second malaria antigen, wherein at least one of said compositions comprises the virus-like particle according to claim 45 and/or a nucleic acid molecule comprising a nucleotide sequence for expressing the particle according to claim 45 to the mammal in need thereof.
61. The method according to claim 60, wherein the polynucleotide encodes substantially all of the circumsporozoite protein.
62. The vaccine composition according to claim 58 for use in the prevention or treatment of malaria, comprising a plurality of malaria-derived antigens.
63. A kit comprising (a) a vaccine composition comprising the virus-like particle according to claim 45; and (b) another vaccine composition comprising the virus-like particle according to claim 45, wherein the particle contained in (a) is a virus-like particle which is different from the particle contained in (b).
64. The kit according to claim 63, further comprising (c) a third vaccine composition comprising a virus-like comprising a virus structural polypeptide and at least one malaria antigen, wherein said virus structural polypeptide is a polypeptide derived from alphavirus or flavivirus, wherein said first vaccine composition is used for priming immunization and said second and third vaccine compositions are used for boosting immunization, and wherein the virus-like particle contained in said third vaccine composition is different from the virus-like particle contained in said first and second vaccine compositions, or is the same as a virus-like particle contained in either said first or second vaccine composition.
Description
BRIEF DESCRIPTION OF THE INVENTION
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
DETAILED DESCRIPTION OF THE INVENTION
(1) A Particle Comprising a Polypeptide and at Least One Malaria Antigen
[0030] In the first aspect, the present invention provides a particle which is capable of being self-assembled, comprising a polypeptide and at least one malaria antigen, wherein said polypeptide comprises at least one first attachment site and said at least one antigen comprises at least one second attachment site, and wherein said polypeptide and said malaria antigen are linked through said at least one first and said at least one second attachment site.
[0031] As used herein, a particle which is capable of being self-assembled refers to a particle formed by at least one constituent which is spontaneously assembled. The constituent may be a polypeptide or non-peptide chemical compound. In one embodiment, a particle which is capable of being self-assembled may be a particle comprising or consisting of at least one polypeptide. The at least one polypeptide consists of one or more kinds of peptide. In one embodiment, said particle has a diameter of at least 10 nm, for example, at least 20 nm, preferably at least 50 nm. In one embodiment, molecular weight of said particle is from 100 kDa to 100,000 kDa, preferably from 400 kDa to 30,000 kDa.
[0032] A polypeptide used for the present invention may be spontaneously assembled. The polypeptide may be a virus structural polypeptide. Thus, the particle provided by the present invention may be a virus like particle.
[0033] A virus structural polypeptide may be a naturally occurring viral polypeptide or modified polypeptide thereof. In one embodiment, the modified polypeptide has at least 70%, 75%, 80%, 85%, 90%, 95% or 98% amino acid sequence identity to a naturally occurring viral structural polypeptide including capsid and envelope protein. In one embodiment, the modified polypeptide is a mutant where at most 10% of the amino acids are deleted, substituted, and/or added to a naturally occurring viral structural polypeptide including capsid and envelope protein.
[0034] In one embodiment, virus structural polypeptide used for the present invention consists of or comprises capsid and/or envelope protein or fragment thereof. For example, virus structural polypeptide used for the present invention consists of or comprises capsid and E2 and E1. An antigen may be inserted into E2. In one embodiment, a particle provided by the first aspect of the present invention can be formed by assembling 240 capsids, 240 E1 proteins and 240 E2 proteins where a malaria antigen is inserted into each of E2 proteins.
[0035] Virus structural polypeptide used for the present invention may be derived from Alphavirus or Flavivirus. Thus, the particle provided by the present invention may be a virus like particle derived from Alphavirus or Flavivirus. Examples of Alphavirus and Flavivirus include, but not limited to, Aura virus, Babanki virus, Barmah Forest virus (BFV), Bebaru virus, Cabassou virus, Chikungunya virus (CHIKV), Eastern equine encephalitis virus (EEEV), Eilat virus, Everglades virus, Fort Morgan virus, Getah virus, Highlands J virus, Kyzylagach virus, Mayaro virus, Me Tri virus, Middelburg virus, Mosso das Pedras virus, Mucambo virus, Ndumu virus, O'nyong-nyong virus, Pixuna virus, Rio Negro virus, Ross River virus (RRV), Salmon pancreas disease virus, Semliki Forest virus, Sindbis virus, Southern elephant seal virus, Tonate virus, Trocara virus, Una virus, Venezuelan equine encephalitis virus (VEEV), Western equine encephalitis virus (WEEV), Whataroa virus, West Nile virus, dengue virus, tick-borne encephalitis virus and yellow fever virus.
[0036] Malaria is a disease which human or other animal (e.g. mouse) suffers from. Example of malaria include, but are not limited to, a disease caused by Plasmodium (P.) species including P. falciparum, P. malariae, P.ovale, P.vivax, P.knowlesi, P.berghei, P.chabaudi and P.yoelii
[0037] As used herein, the term malaria antigen refers to any antigen or fragment thereof. The term antigen or fragment thereof, means any peptide-based sequence that can be recognized by the immune system and/or that stimulates a cell-mediated immune response and/or stimulates the generation of antibodies.
[0038] According to Scand. J. Immunol. 56, 327-343, 2002, considering the whole parasite life cycle, there are essentially six targets for a malaria vaccine: (1) sporozoites; (2) liver stages; (3) merozoites; (4) infected RBC; (5) parasite toxins; (6) sexual stages.
[0039] Table summarizes the main candidate antigens of each stage identified.
TABLE-US-00001 TABLE 1 Main vaccine candidates from the different phases of Plasmodium life cycle Targets Candidate antigens Sporozoite Circumsporozoite protein (CSP) Thrombospondin-related adhesive protein (TRAP) Sporozoite and liver-stage antigen (SALSA) Sporozoite threonine- and asparagine-rich protein (STARP) Liver stage CSP Liver-stage antigen (LSA)-1 and -3 SALSA STARP Merozoite Merozoite surface protein (MSP)-1, -2, -3, -4 and -5 Erythrocyte-binding antigen (EBA)-175 Apical membrane antigen (AMA)-1 Rhoptry-associated protein (RAP)-1 and -2 Acidic-basic repeat antigen (ABRA) Duffy-binding protein (DBP) (Plasmodium vivax) Blood stage Ring erythrocyte surface antigen (RESA) Serine-rich protein (SERP) Erythrocyte membrane protein (EMP)-1, -2 and -3 Glutamate-rich protein (GLURP) Toxins Glycosilphosphatidylinositol (GPI) Sexual Ps25, Ps28, Ps48/45 and Ps230 stages (Scand. J. Immunol. 56, 327-343, 2002)
[0040] According to the present invention, one or more antigens listed above can be used as long as it is formed to a particle. For example, a circumsporozoite protein and a fragment thereof can be used as an antigen. Examples of circumsporozoite protein include, but are not limited to, Plasmodium falciparum circumsporozoite protein consisting of amino acid sequence described below (SEQ ID No. 56):
TABLE-US-00002 Mmrklailsyssflfvealfqeyqcygsssntrvinelnydnagtn lynelemnyygkqenwyslkknsrslgenddgnnnngdngregkde dkrdgnnedneklrkpkhkklkqpgdgnpdpnanpnvdpnanpnvd pnanpnvdpnanpnanpnanpnanpnanpnanpnanpnanpnanpn anpnanpnanpnanpnanpnanpnvdpnanpnanpnanpnanpnan pnanpnanpnanpnanpnanpnanpnanpnanpnanpnanpnanpn anpnanpnanpnknnqgngqghnmpndpnrnvdenanannavknnn neepsdkhiegylkkiknsistewspcsvtcgngiqvrikpgsank pkdeldyendiekkickmekcssvfnvvnssiglimvlsflflntr.
[0041] In one embodiment, malaria antigen is a Plasmodium falciparum circumsporozoite protein B cell epitope. Example of Plasmodium falciparum circumsporozoite protein B cell epitope may be a repeat sequence of NPNA, including (NPNA).sub.4-30 (i.e. 4NPNA, 5NPNA, 6NPNA, 7NPNA, 8NPNA, 9NPNA, 10NPNA, 11NPNA, 12NPNA, 13NPNA 14NPNA, 15NPNA, 16NPNA, 17NPNA, 18NPNA, 19NPNA, 20NPNA, 21NPNA, 22NPNA, 23NPNA, 24NPNA, 25NPNA, 26NPNA, 27NPNA, 28NPNA, 29NPNA or 30NPNA).
[0042] In one embodiment, malaria antigen is a Plasmodium yoelii circumsporozoite protein B cell epitope including (QGPGAP).sub.3-12.
[0043] In one embodiment, malaria antigen is a Plasmodium vivax circumsporozoite protein B cell epitope including (ANGAGNQPG).sub.1-12.
[0044] In one embodiment, malaria antigen is a Plasmodium malariae circumsporozoite protein B cell epitope including (NAAG).sub.4-30.
[0045] In one embodiment, malaria antigen is a Plasmodium falciparum circumsporozoite protein T cell epitope. Example of Plasmodium falciparum circumsporozoite protein T cell epitope may be EYLNKIQNSLSTEWSPCSVT (SEQ ID No. 44) (EYLNKIQNSLSTEWSPCSVT).sub.1-6 may be also used as a malaria antigen.
[0046] In one embodiment, malaria antigen is a Plasmodium yoelii circumsporozoite protein T cell epitope which is YNRNIVNRLLGDALNGPEEK (SEQ ID No.45). (YNRNIVNRLLGDALNGPEEK).sub.1-6 may be also used as a malaria antigen.
[0047] The present invention addresses one or more of the above needs by providing antigens, vectors encoding the antigens, and antibodies (and antibody-like molecules including aptamers and peptides) that specifically bind to the antigen, together with the uses thereof (either alone or in combination) in the prevention or treatment of malaria infections. As used herein, the term antibody refers to molecules which are capable of binding an epitope or antigenic determinant. The term is meant to include whole antibodies and antigen-binding fragments thereof, including single-chain antibodies. Such antibodies include human antigen binding antibody fragments and include, but are not limited to, Fab, Fab and F(ab)2, Fd, single-chain Fvs (scFv), single-chain antibodies, disulfide-linked Fvs (sdFv) and fragments comprising either a VL or VH domain. The antibodies can be from any animal origin including birds and mammals. Preferably, the antibodies are mammalian e.g. human, murine, rabbit, goat, guinea pig, camel, horse and the like, or other suitable animals e.g. chicken. As used herein, human antibodies include antibodies having the amino acid sequence of a human immunoglobulin and include antibodies isolated from human immunoglobulin libraries or from animals transgenic for one or more human immunoglobulins and that do not express endogenous immunoglobulins, as described, for example, in U.S. Pat. No. 5,939,598, the disclosure of which is incorporated herein by reference in its entirety.
[0048] The antigen used for the present invention can be modified polypeptide derived from a naturally occurring protein. The modified polypeptide may be a fragment of the naturally occurring protein. In one embodiment, the modified polypeptide has at least 70%, 75%, 80%, 85%, 90%, 95% or 98% amino acid sequence identity to a polypeptide derived from a naturally occurring protein. In one embodiment, the modified polypeptide derived is a mutant where at most 10% of the amino acids are deleted, substituted, and/or added based on a polypeptide derived from naturally occurring protein.
[0049] In the particle as provided by the present invention, a polypeptide and an antigen may be linked through at least one first attachment site which is present in the polypeptide and at least one second attachment site which is present in the antigen.
[0050] As used herein, each of a first attachment site and a second attachment site refers to a site where more than one substance is linked each other.
[0051] In one embodiment, the polypeptide and the antigen are directly fused. Alternatively, one or two linkers may intervene between N-terminal residue of the antigen and the polypeptide and/or between C-terminal residue of the antigen and the polypeptide.
[0052] The antigen or the polypeptide can be truncated and replaced by short linkers. In some embodiments, the antigen or the polypeptide include one or more peptide linkers. Typically, a linker consists of from 2 to 25 amino acids. Usually, it is from 2 to 15 amino acids in length, although in certain circumstances, it can be only one, such as a single glycine residue.
[0053] In one embodiment, a nucleic acid molecule, in which polynucleotide encoding the polypeptide is genetically fused with polynucleotide encoding the antigen, is expressed in a host cell so that the first attachment site and the second attachment site are linked through a peptide bond. In this case, the polypeptide and the antigen are linked through a peptide bond. Relating to this embodiment, the first attachment site and/or the second attachment site may be genetically modified from the original polypeptide or antigen. For example, the first attachment site is modified from the polypeptide so that through a linker peptide including SG, GS, SGG, GGS and SGSG, the polypeptide is conjugated with the antigen.
[0054] When the polypeptide are chemically conjugated with the antigen, the first attachment site and the second attachment site may be linked through a chemical cross-linker which is a chemical compound.
[0055] Examples of the cross-linker include, but are not limited to, SMPH, Sulfo-MBS, Sulfo-EMCS, Sulfo-GMBS, Sulfo-SIAB, Sulfo-SMPB, Sulfo-SMCC, SVSB, SIA and other cross-linkers available from the Pierce Chemical Company.
[0056] In one embodiment, the particle provided by the present invention comprises a polypeptide linked to an antigen, wherein spatial distance between the N-terminal residue and C-terminal residue of the antigen is 30 or less when the distance is determined in a crystal of the antigen or a naturally occurring protein containing the antigen or modified protein therefrom.
[0057] The antigen used for the present invention can be designed by a person skilled in the art. For example, the antigen used for the present invention may be a naturally occurring protein or a fragment thereof. Alternatively, the antigen used for the present invention may be a protein modified from a naturally occurring protein or a fragment thereof. A person skilled in the art can design the antigen so that spatial distance between the N-terminal residue and C-terminal residue of the antigen is 30 or less when the distance is determined in a crystal of the antigen or a naturally occurring protein containing the antigen or modified protein therefrom. For example, the antigen used for the particle provided by the present invention can be designed using a free software including PyMOL (e.g. PyMOL v0.99: http:/www.pymol.org). In one embodiment, the spatial distance between the N-terminal residue and C-terminal residue of the antigen is 30 (angstrom) or less, 20 or less, or 10 or less (e.g. from 5 to 15 , from 5 to 12 , from 5 to 11 , from 5 to 10 , from 5 to 8 , from 8 to 15 , from 8 to 13 , from 8 to 12 , from 8 to 11 , from 9 to 12 , from 9 to 11 , from 9 to 10 or from 10 to 11 ).
Chikungunya Virus Like Particle or a Venezuelan Equine Encephalitis Virus Like Particle
[0058] In one embodiment, the present invention provides a Chikungunya virus like particle or a Venezuelan equine encephalitis virus like particle comprising a Chikungunya or Venezuelan equine encephalitis virus structural polypeptide and at least one malaria antigen, wherein said Chikungunya virus structural polypeptide or said Venezuelan equine encephalitis virus structural polypeptide comprises at least one first attachment site and said at least one malaria antigen comprises at least one second attachment site, and wherein said Chikungunya or Venezuelan equine encephalitis virus structural polypeptide and said at least one antigen are linked through said at least one first and said at least one second attachment site.
[0059] In one embodiment, a spatial distance between the N-terminal residue and C-terminal residue of the malaria antigen may be 30 or less; 25 or less; 20 or less; 15 or less; 14 or less; 13 or less; 12 or less; 11 or less; 10 or less; 9 or less; or 8 or less (e.g. from 5 to 15 , from 5 to 12 , from 5 to 11 , from 5 to 10 , from 5 to 8 , from 8 to 15 , from 8 to 13 , from 8 to 12 , from 8 to 11 , from 9 to 12 , from 9 to 11 , from 9 to 10 or from 10 to 11 ) when the distance is determined in a crystal of the malaria antigen or a naturally occurring protein containing the malaria antigen or modified protein therefrom.
[0060] In one embodiment, the malaria antigen is linked to the Chikungunya or Venezuelan equine encephalitis virus structural polypeptide by way of chemical cross-linking or as a fusion protein produced by way of genetic engineering.
[0061] A Chikungunya or Venezuelan equine encephalitis virus structural polypeptide used in the present invention may comprise a Chikungunya or Venezuelan equine encephalitis virus envelope protein and/or a capsid.
[0062] Examples of Chikungunya virus include, but are not limited to, strains of 37997 and LR2006 OPY-1.
[0063] Examples of Venezuelan equine encephalitis virus include, but are not limited to, TC-83.
[0064] Chikungunya or Venezuelan equine encephalitis virus structural polypeptide used in the present invention may naturally occurring virus structural polypeptide or modified polypeptide thereof. The modified polypeptide may be a fragment of the naturally occurring virus structural polypeptide. In one embodiment, the modified polypeptide has at least 70%, 75%, 80%, 85%, 90%, 95% or 98% amino acid sequence identity to a naturally occurring viral capsid and/or envelope protein. In one embodiment, the modified polypeptide is a mutant where at most 10% of the amino acids are deleted, substituted, and/or added based on a naturally occurring viral capsid and/or envelope protein. For example, K64A or K64N mutatation may be introduced into a capsid of Venezuelan equine encephalitis virus structural polypeptide used in the present invention.
[0065] Chikungunya or Venezuelan equine encephalitis virus structural polypeptide may consist of or comprise a capsid, E2 and E1.
[0066] Examples of Chikungunya virus structural polypeptide include, but are not limited to, Capsid-E2-E1 of Chikungunya virus Strain 37997, and Capsid-E2-E1 of Chikungunya virus LR2006 OPY-1.
[0067] Examples of Venezuelan equine encephalitis virus structural polypeptide include, but are not limited to, Capsid-E2-E1 of Venezuelan equine encephalitis virus Strain TC-83.
[0068] An exemplary Chikungunya virus structural polypeptide sequence is provided at Genbank Accession No. ABX40006.1, which is described below (SEQ ID No. 1):
TABLE-US-00003 mefiptqtfynrryqprpwtprptiqvirprprpqrqagqlaqlis avnkltmravpqqkprrnrknkkqkqkqqapqnntnqkkqppkkkp aqkkkkpgrrermcmkiendcifevkhegkvtgyaclvgdkvmkpa hvkgtidnadlaklafkrsskydlecaqipvhmksdaskfthekpe gyynwhhgavgysggrftiptgagkpgdsgrpifdnkgrvvaivig ganegartalsvvtwnkdivtkitpegaeewslaipvmcilanttf pcsqppctpccyekepeetlrmlednvmrpgyyqllqasltcsphr grrstkdnfnvykatrpylahcpdcgeghschspvalerirneatd gtlkiqvslgigiktddshdwtklrymdnhmpadaeraglevrtsa pctitgtmghfilarcpkgetltvgftdsrkishscthpfhhdppv igrekfhsrpqhgkelpcstyvqstaatteeievhmppdtpdrtlm sqqsgnvkitvngqtvrykencggsnegltttdkvinnckvdgcha avtnhkkwqynsplvprnaelgdrkgkihipfplanvtcrvpkarn ptvtygknqvimllypdhptilsyrnmgeepnyqeewvmhkkevvl tvpteglevtwgnnepykywpqlstngtahghpheiilyyyelypt mtvvvvsvatfillsmvgmaagmcmcarrrcitpyeltpgatvpfl isliccirtakaatyqeaaiylwneqqplfwlqaliplaalivlcn cirlipcccktlaflavmsvgahtvsayehvtvipntvgvpyktlv nrpgyspmvlemellsvtleptlsidyitceyktvipspyvkccgt aeckdknipdysckvftgvypfmwggaycfcdaentqlseahveks escktefasayrahtasasakirylyqgnnitvtayangdhavtvk dakfivgpmssawtpfdnkivvykgdvynmdyppfgagrpgqfgdi gsrtpeskdvyantqlvlqrpavgtvhvpysqapsgfkywlkerga slqhtapfgcgiatnpvravncavgnmpisidipeaaftrvvdaps ltdmscevpacthssdfggvaiikyaaskkgkcavhsmtnavtire aeievegnsqlqisfstalasaefrvqvcstqvhcaaechppkdhi vnypashttlgvgdisatamswvqkitggvglvvavaalilivvlc vsfsrh
[0069] Another exemplary Chikungunya virus structural polypeptide sequence is provided at Genbank Accession No. ABX40011.1, which is described below (SEQ ID No. 2):
TABLE-US-00004 mefiptqtfynrryqprpwaprptiqvirprprpqrqagqlaqlis avnkltmravpqqkprrnrknkkqrqkkqapqndpkqkkqppqkkp aqkkkkpgrrermcmkiendcifevkhegkvmgyaclvgdkvmkpa hvkgtidnadlaklafkrsskydlecaqipvhmksdaskfthekpe gyynwhhgavqysggrftiptgagkpgdsgrpifdnkgrvvaivlg ganegartalsvvtwnkdivtkitpegaeewslalpvlcllanttf pcsqppctpccyekepestlrmlednvmrpgyyqllkasltcsphr qrrstkdnfnvykatrpylahcpdcgeghschspialerirneatd gtlkiqvslqigiktddshdwtklrymdshtpadaeragllvrtsa pctitgtmghfilarcpkgetltvgftdsrkishtcthpfhheppv igrerfhsrpqhgkelpcstyvqstaataeeievhmppdtpdrtlm tqqsgnvkitvngqtvrykcncggsnegltttdkvinnckidqcha avtnhknwqynsplvprnaelgdrkgkihipfplanvtcrvpkarn ptvtygknqvtmllypdhptllsyrnmgqepnyheewvthkkevtl tvpteglevtwgnnepykywpqmstngtahghpheiilyyyelypt mtvvivsvasfvllsmvgtavgmcvcarrrcitpyeltpgatvpfl lsllccvrttkaatyyeaaaylwneqqplfwlqaliplaalivlcn clkllpcccktlaflavmsigahtvsayehvtvipntvgvpyktlv nrpgyspmvlemelqsvtleptlsldyitceyktvipspyvkccgt aeckdkslpdysckvftgvypfmwggaycfcdaentqlseahveks escktefasayrahtasasaklrvlyqgnnitvaayangdhavtvk dakfvvgpmssawtpfdnkivvykgdvynmdyppfgagrpgqfgdi qsrtpeskdvyantqlvlqrpaagtvhvpysqapsgfkywlkerga slqhtapfgcqiatnpvravncavgnipisidipdaaftrvvdaps vtdmscevpacthssdfggvaiikytaskkgkcavhsmtnavtire advevegnsqlqisfstalasaefrvqvcstqvhcaaachppkdhi vnypashttlgvqdisttamswvqkitggvglivavaalilivvlc vsfsrh.
[0070] An exemplary Venezuelan equine encephalitis virus structural polypeptide is provided at Genbank Accession No. L01443.1 (http://www.ncbi.nlm.nih.gov/nuccore/L01443.1), which is described below (SEQ ID No. 3):
TABLE-US-00005 mfpfqpmypmqpmpyrnpfaaprrpwfprtdpflamqvqeltrsma nitfkqrrdappegpsaakpkkeasqkqkgggqgkkkknqgkkkak tgppnpkaqngnkkktnkkpqkrqrmvmklesdktfpimiegking yacvvggklfrpmhvegkidndvlaalktkkaskydleyadvpqnm radtfkythekpqgyyswhhgavqyengrftvpkgvgakgdsgrpi ldnqgrvvaivaggvnegsrtalsvvmwnekgvtvkytpenceqws lvttmcilanvtfpcaqppicydrkpaetlamlsvnvdnpgydell eaavkcpgrkrrsteelfneykltrpymarcircavgschspiaie avksdghdgyvraqtssqygldssgnikgrtmrydmhgtikeiplh qvslytsrpchivdghgyfllarepagdsitmefkkdsvrhscsvp yevkfnpvgrelythppehgveqacqvyahdaqnrgayvemhlpgs evdsslvslsgssvtvtppdgtsalvececggtkisetinktkqfs qctkkeqcrayrlqndkwvynsdklpkaagatlkgklhvpflladg kctvplapepmitfgfrsyslkihpknptylitrqladephythel isepavrnftvtekgwefvwgnhppkrfwagetapgnphglphevi thyyhrypmstilglsicaaiatvsvaastwlfcrsrvacltpyrl tpnaripfclaviccartaraettwesldhlwnnnqqmfwiqllip laalivvtrllrcvccvvpflvmagaagagayehattmpsqagisy ntivnragyaplpisitptkikliptvnleyvtchyktgmdspaik ccgsqectptyrpdeqckvftgvypfmwggaycfcdtentqvskay vmksddcladhaeaykahtasvqaflnitvgehsivttvyvngetp vnfngvkitagplstawtpfdrkivqyageiynydfpeygagqpga fgdiqsrtvsssdlyantnlvlqrpkagaihvpytqapsgfeawkk dkapsikftapfgceiytnpiraencavgsiplafdipdalftrvs etptisaaectlnecvyssdfggiatvkysasksgkcavhvpsgta tikeaaveltecosatihfstanihpefrlqictsyvtckgdchpp kdhivthpqyhaqtftaaysktawtwltsllggsaviiiiglvlat ivamyvltnqkhn.
[0071] In one embodiment, a first attachment site comprises an amino group, preferably an amino group of a lysine residue. In one embodiment, the second attachment site comprises sulfhydryl group, preferably, a sulfhydryl group of a cysteine.
[0072] In one embodiment, a conjugation of more than two substances (e.g. antigen and Chikungunya or Venezuelan equine encephalitis virus structural polypeptide) through a first attachment site or a second attachment site is achieved using chemical cross linker. Examples of the cross-linker include, but are not limited to, SMPH, Sulfo-MBS, Sulfo-EMCS, Sulfo-GMBS, Sulfo-SIAB, Sulfo-SMPB, Sulfo-SMCC, SVSB, SIA and other cross-linkers available from the Pierce Chemical Company.
[0073] According to the present invention, a Chikungunya or Venezuelan equine encephalitis virus like particle comprising a Chikungunya or Venezuelan equine encephalitis virus structural polypeptide and an antigen, wherein said Chikungunya or Venezuelan equine encephalitis virus structural polypeptide and said antigen are expressed as a fusion protein can be provided.
[0074] In one embodiment, the antigen can be fused with any site of the Chikungunya or Venezuelan equine encephalitis virus structural polypeptide. For example, the antigen may be directly or indirectly linked to N- or C-terminal of the Chikungunya or Venezuelan equine encephalitis virus structural polypeptide, or the antigen may be inserted into Chikungunya or Venezuelan equine encephalitis virus structural protein.
[0075] In one embodiment, at least one antigen is inserted into E2 of Chikungunya or Venezuelan equine encephalitis virus structural protein. For example, regarding Chikungunya virus structural protein, at least one antigen is inserted between residues 519 and 520 of SEQ ID Nos.1 or 2 (i.e. between G at 519-position and Q at 520-position of SEQ ID Nos.1 or 2); between residues 530 and 531 of SEQ ID Nos.1 or 2 (i.e. between G at 530-position and S at 531-position of SEQ ID Nos.1 or 2); between residues 531 and 532 of SEQ ID Nos.1 or 2 (i.e. between S at 531-position and N at 532-position of SEQ ID Nos.1 or 2); between residues 529 and 530 of SEQ ID Nos.1 or 2(i.e. between G at 529-position and G at 530-position of SEQ ID Nos.1 or 2); or between residues 510 and 511 of SEQ ID Nos.1 or 2(i.e. between S at 510-position and G at 511-position of SEQ ID Nos.1 or 2); or between residues 511 and 512 of SEQ ID Nos.1 or 2(i.e. between G at 511-position and N at 512-position of SEQ ID Nos.1 or 2); or between residues 509 and 510 of SEQ ID Nos.1 or 2(i.e. between Q at 509-position and S at 510-position of SEQ ID Nos.1 or 2).
[0076] For example, regarding Venezuelan equine encephalitis virus structural protein, at least one antigen is inserted between residues 517 and 518 of SEQ ID No.3 (i.e. between G at 517-position and S at 518-position of SEQ ID No.3); between residues 518 and 519 of SEQ ID No.3 (i.e. between S at 518-position and S at 519-position of SEQ ID No.3); between residues 519 and 520 of SEQ ID No.3 (i.e. between S at 519-position and V at 520-position of SEQ ID No.3); between residues 515 and 516 of SEQ ID No.3(i.e. between L at 515-position and S at 516-position of SEQ ID No.3); between residues 516 and 517 of SEQ ID No.3(i.e. between S at 516-position and G at 517-position of SEQ ID No.3); between residues 536 and 537 of SEQ ID No.3(i.e. between C at 536-position and G at 537-position of SEQ ID No.3); between residues 537 and 538 of SEQ ID No.3(i.e. between G at 537-position and G at 538-position of SEQ ID No.3); between residues 538 and 539 of SEQ ID No.3(i.e. between G at 538-position and T at 539-position of SEQ ID No.3).
[0077] The fusion protein may be expressed using a conventional technique in the art. A variety of expression systems can be used for the expression of the fusion protein. For example, the fusion protein can be expressed in 293 cells, Sf9 cells or E. coli.
[0078] A polypeptide derived from Chikungunya virus (CHIKV) or Venezuelan equine encephalitis virus (VEEV) may be a naturally occurring viral polypeptide or modified polypeptide thereof. In addition, a polypeptide derived from malaria antigen may be a naturally occurring polypeptide or modified polypeptide of the naturally occurring polypeptide or a fragment of the naturally occurring polypeptide or the modified peptide. The modified polypeptide may be a fragment of the naturally occurring virus structural polypeptide.
[0079] In one embodiment, the modified polypeptide derived from malaria antigen has at least 70%, 75%, 80%, 85%, 90%, 95% or 98% amino acid sequence identity to a naturally occurring polypeptide. In one embodiment, the modified peptide derived from malaria antigen is a mutant where at most 10% of the amino acids are deleted, substituted, and/or added based on a naturally occurring polypeptide derived from malaria antigen.
[0080] When a polypeptide derived from a virus is conjugated with a polypeptide derived from an antigen, a linker peptide including SG, GS, SGG, GGS SGSG and TRGGS may be used. Examples of conjugation of the polypeptide derived from a virus (referred to as PFV below) with the polypeptide derived from the antigen (referred to as PFA below) include, but not limited to: PFV-SG-PFA-GS-PFV; PFV-SG-PFA-GGS-PFV; PFV-SSG-PFA-GS-PFV; PFV-SGG-PFA-GGS-PFV; PFV-SGSG-PFA-GS-PFV; and PFA-SGG-PFA-TRGGS-PFV.
[0081] In one embodiment, the present invention provides a virus like particle comprising a fusion protein of a polypeptide derived from Chikungunya virus (CHIKV) or Venezuelan equine encephalitis virus (VEEV) and a polypeptide derived from malaria antigen, wherein the virus like particle is prepared by transfecting an expression vector comprising a nucleic acid molecule corresponding to the amino acid sequence represented by SEQ ID NO. 28, 31, 34, 37, 39, 41 or 43 into a mammalian cell (e.g. 293F cell). Regarding this embodiment, modified fusion protein can be also used for a virus like particle provided by the present invention, which can be prepared by transfecting an expression vector comprising a nucleic acid molecule corresponding to the amino acid sequence having at least 70%, 75%, 80%, 85%, 90%, 95% or 98% amino acid sequence identity to SEQ ID NO. 28, 31, 34, 37, 39, 41 or 43 into a mammalian cell (e.g. 293F cell).
[0082] In one embodiment, the present invention provides a virus like particle comprising or consisting of:
one or more capsid of Chikungunya virus (CHIKV) or Venezuelan equine encephalitis virus (VEEV);
one or more E1 of Chikungunya virus (CHIKV) or Venezuelan equine encephalitis virus (VEEV); and
one or more E2 of Chikungunya virus (CHIKV) or Venezuelan equine encephalitis virus (VEEV), wherein malaria antigen is inserted into E2 of Chikungunya virus (CHIKV) or Venezuelan equine encephalitis virus (VEEV). For example, present invention provides a virus like particle comprising or consisting of:
240 capsids of Chikungunya virus (CHIKV) or Venezuelan equine encephalitis virus (VEEV);
240 E1s of Chikungunya virus (CHIKV) or Venezuelan equine encephalitis virus (VEEV); and
240 E2s of Chikungunya virus (CHIKV) or Venezuelan equine encephalitis virus (VEEV), wherein malaria antigen is inserted into each of E2s of Chikungunya virus (CHIKV) or Venezuelan equine encephalitis virus (VEEV).
[0083] In this embodiment, the E2 into which the antigen is inserted may consist of an amino acid sequence represented by SEQ ID No.50; the E1 may consist of an amino acid sequence represented by SEQ ID No.51; and the capsid may consist of an amino acid sequence represented by SEQ ID NO.: 52; or
the E2 into which the antigen is inserted may consist of an amino acid sequence represented by SEQ ID NO.53; the E1 may consist of an amino acid sequence represented by SEQ ID NO.54; and the capsid may consist of an amino acid sequence represented by SEQ ID NO.: 55.
[0084] Further, regarding this embodiment, modified capsid of Chikungunya virus (CHIKV) or Venezuelan equine encephalitis virus (VEEV), modified E1 of Chikungunya virus (CHIKV) or Venezuelan equine encephalitis virus (VEEV) and modified E2 of Chikungunya virus (CHIKV) or Venezuelan equine encephalitis virus (VEEV) may be used for the virus like particle. For example, the modified capsid of Chikungunya virus (CHIKV) or Venezuelan equine encephalitis virus (VEEV) may have at least 70%, 75%, 80%, 85%, 90%, 95% or 98% amino acid sequence identity to the amino acid sequence represented by SEQ ID NO.: 52 or SEQ ID No. 55; the modified E1 of Chikungunya virus (CHIKV) or Venezuelan equine encephalitis virus (VEEV) may have at least 70%, 75%, 80%, 85%, 90%, 95% or 98% amino acid sequence identity to the amino acid sequence represented by SEQ ID NO.: 51 or SEQ ID No. 54; and/or the modified E2 of Chikungunya virus (CHIKV) or Venezuelan equine encephalitis virus (VEEV) may have at least 70%, 75%, 80%, 85%, 90%, 95% or 98% amino acid sequence identity to the amino acid sequence represented by SEQ ID NO.: 50 or SEQ ID No. 53.
[0085] Also, the modified capsid, E1 or E2 may be a mutant where at most 10% of the amino acids are deleted, substituted, and/or added based on the capsid consisting of an amino acid sequence represented by SEQ ID NO.: 52 or SEQ ID No. 55; E1 consisting of an amino acid sequence represented by SEQ ID NO.: 51 or SEQ ID No. 54; and/or E2 consisting of an amino acid sequence represented by SEQ ID NO.: 50 or SEQ ID No. 53.
(2) Nucleotide, Vector, Host cell
[0086] In the second aspect, the present invention provides a nucleic acid molecule which is designed for expression of a particle as provided in the first aspect of the present invention.
[0087] In one embodiment, the present invention provides a nucleic acid molecule comprising a nucleotide sequence that encodes the Chikungunya or Venezuelan equine encephalitis virus like particle as described above.
[0088] Examples of the nucleotide sequence that encodes the Chikungunya or Venezuelan equine encephalitis virus like particle include, but are not limited to, a nucleotide sequence encoding envelope of Chikungunya virus Strain 37997, a nucleotide sequence encoding Capsid-envelope of Chikungunya virus Strain 37997, a nucleotide sequence encoding envelope of Chikungunya virus Strain LR2006 OPY-1, a nucleotide sequence encoding Capsid-envelope of Chikungunya virus LR2006 OPY-1, a nucleotide sequence encoding envelope of Venezuelan equine encephalitis virus Strain TC-83 and a nucleotide sequence encoding Capsid-envelope of Venezuelan equine encephalitis virus TC-83.
[0089] Regarding Chikungunya virus, an exemplary nucleotide sequence that encodes envelope is described below (SEQ ID No.4):
TABLE-US-00006 Atgagcctcgccctcccggtcttgtgcctgttggcaaacactacat tcccctgctctcagccgccttgcacaccctgctgctacgaaaagga accggaaagcaccttgcgcatgcttgaggacaacgtgatgagaccc ggatactaccagctactaaaagcatcgctgacttgctctccccacc gccaaagacgcagtactaaggacaattttaatgtctataaagccac aagaccatatctagctcattgtcctgactgcggagaagggcattcg tgccacagccctatcgcattggagcgcatcagaaatgaagcaacgg acggaacgctgaaaatccaggtctctttgcagatcgggataaagac agatgacagccacgattggaccaagctgcgctatatggatagccat acgccagcggacgcggagcgagccggattgcttgtaaggacttcag caccgtgcacgatcaccgggaccatgggacactttattctcgcccg atgcccgaaaggagagacgctgacagtgggatttacggacagcaga aagatcagccacacatgcacacacccgttccatcatgaaccacctg tgataggtagggagaggttccactctcgaccacaacatggtaaaga gttaccttgcagcacgtacgtgcagagcaccgctgccactgctgag gagatagaggtgcatatgcccccagatactcctgaccgcacgctga tgacgcagcagtctggcaacgtgaagatcacagttaatgggcagac ggtgcggtacaagtgcaactgcggtggctcaaacgagggactgaca accacagacaaagtgatcaataactgcaaaattgatcagtgccatg ctgcagtcactaatcacaagaattggcaatacaactcccctttagt cccgcgcaacgctgaactcggggaccgtaaaggaaagatccacatc ccattcccattggcaaacgtgacttgcagagtgccaaaagcaagaa accctacagtaacttacggaaaaaaccaagtcaccatgctgctgta tcctgaccatccgacactcttgtcttaccgtaacatgggacaggaa ccaaattaccacgaggagtgggtgacacacaagaaggaggttacct tgaccgtgcctactgagggtctggaggtcacttggggcaacaacga accatacaagtactggccgcagatgtctacgaacggtactgctcat ggtcacccacatgagataatcttgtactattatgagctgtacccca ctatgactgtagtcattgtgtcggtggcctcgttcgtgcttctgtc gatggtgggcacagcagtgggaatgtgtgtgtgcgcacggcgcaga tgcattacaccatatgaattaacaccaggagccactgttcccttcc tgctcagcctgctatgctgcgtcagaacgaccaaggcggccacata ttacgaggctgcggcatatctatggaacgaacagcagcccctgttc tggttgcaggctcttatcccgctggccgccttgatcgtcctgtgca actgtgcaactgtctgaaactcttgccatgctgctgtaagaccctg gcttttttagccgtaatgagcatcggtgcccacactgtgagcgcgt acgaacacgtaacagtgatcccgaacacggtgggagtaccgtataa gactcttgtcaacagaccgggttacagccccatggtgttggagatg gagctacaatcagtcaccttggaaccaacactgtcacttgactaca tcacgtgcgagtacaaaactgtcatcccctccccgtacgtgaagtg ctgtggtacagcagagtgcaaggacaagagcctaccagactacagc tgcaaggtctttactggagtctacccatttatgtggggcggcgcct actgcttttgcgacgccgaaaatacgcaattgagcgaggcacatgt agagaaatctgaatcttgcaaaacagagtttgcatcggcctacaga gcccacaccgcatcggcgtcggcgaagctccgcgtcctttaccaag gaaacaacattaccgtagctgcctacgctaacggtgaccatgccgt cacagtaaaggacgccaagtttgtcgtgggcccaatgtcctccgcc tggacaccttttgacaacaaaatcgtggtgtacaaaggcgacgtct acaacatggactacccaccttttggcgcaggaagaccaggacaatt tggtgacattcaaagtcgtacaccggaaagtaaagacgtttatgcc aacactcagttggtactacagaggccagcagcaggcacggtacatg taccatactctcaggcaccatctggcttcaagtattggctgaagga acgaggagcatcgctacagcacacggcaccgttcggttgccagatt gcgacaaacccggtaagagctgtaaattgcgctgtggggaacatac caatttccatcgacataccggatgcggcctttactagggttgtcga tgcaccctctgtaacggacatgtcatgcgaagtaccagcctgcact cactcctccgactttgggggcgtcgccatcatcaaatacacagcta gcaagaaaggtaaatgtgcagtacattcgatgaccaacgccgttac cattcgagaagccgacgtagaagtagaggggaactcccagctgcaa atatccttctcaacagccctggcaagcgccgagtttcgcgtgcaag tgtgctccacacaagtacactgcgcagccgcatgccaccctccaaa ggaccacatagtcaattacccagcatcacacaccacccttggggtc caggatatatccacaacggcaatgtcttgggtgcagaagattacgg gaggagtaggattaattgttgctgttgctgccttaattttaattgt ggtgctatgcgtgtcgtttagcaggcac
[0090] Regarding Chikungunya virus, another exemplary nucleotide sequence that encodes envelope is described below (SEQ ID No. 5):
TABLE-US-00007 Atgagtcttgccatcccagttatgtgcctgttggcaaacaccacgtt cccctgctcccagcccccttgcacgccctgctgctacgaaaaggaac cggaggaaaccctacgcatgcttgaggacaacgtcatgagacctggg tactatcagctgctacaagcatccttaacatgttctccccaccgcca gcgacgcagcaccaaggacaacttcaatgtctataaagccacaagac catacttagctcactgtcccgactgtggagaagggcactcgtgccat agtcccgtagcactagaacgcatcagaaatgaagcgacagacgggac gctgaaaatccaggtctccttgcaaatcggaataaagacggatgaca gccacgattggaccaagctgcgttatatggacaaccacatgccagca gacgcagagagggcggggctatttgtaagaacatcagcaccgtgtac gattactggaacaatgggacacttcatcctggcccgatgtccaaaag gggaaactctgacggtgggattcactgacagtaggaagattagtcac tcatgtacgcacccatttcaccacgaccctcctgtgataggtcggga aaaattccattcccgaccgcagcacggtaaagagctaccttgcagca cgtacgtgcagagcaccgccgcaactaccgaggagatagaggtacac atgcccccagacacccctgatcgcacattaatgtcacaacagtccgg caacgtaaagatcacagtcaatggccagacggtgcggtacaagtgta attgcggtggctcaaatgaaggactaacaactacagacaaagtgatt aataactgcaaggttgatcaatgtcatgccgcggtcaccaatcacaa aaagtggcagtataactcccctctggtcccgcgtaatgctgaacttg gggaccgaaaaggaaaaattcacatcccgtttccgctggcaaatgta acatgcagggtgcctaaagcaaggaaccccaccgtgacgtacgggaa aaaccaagtcatcatgctactgtatcctgaccacccaacactcctgt cctaccggaatatgggagaagaaccaaactatcaagaagagtgggtg atgcataagaaggaagtcgtgctaaccgtgccgactgaagggctcga ggtcacgtggggcaacaacgagccgtataagtattggccgcagttat ctacaaacggtacagcccatggccacccgcatgagataattctgtat tattatgagctgtaccccactatgactgtagtagttgtgtcagtggc cacgttcatactcctgtcgatggtgggtatggcagcggggatgtgca tgtgtgcacgacgcagatgcatcacaccgtatgaactgacaccagga gctaccgtccctttcctgcttagcctaatatgctgcatcagaacagc taaagcggccacataccaagaggctgcgatatacctgtggaacgagc agcaacctttgttttggctacaagcccttattccgctggcagccctg attgttctatgcaactgtctgagactcttaccatgctgctgtaaaac gttggcttttttagccgtaatgagcgtcggtgcccacactgtgagcg cgtacgaacacgtaacagtgatcccgaacacggtgggagtaccgtat aagactctagtcaatagacctggctacagccccatggtattggagat ggaactactgtcagtcactttggagccaacactatcgcttgattaca tcacgtgcgagtacaaaaccgtcatcccgtctccgtacgtgaagtgc tgcggtacagcagagtgcaaggacaaaaacctacctgactacagctg taaggtcttcaccggcgtctacccatttatgtggggcggcgcctact gcttctgcgacgctgaaaacacgcagttgagcgaagcacacgtggag aagtccgaatcatgcaaaacagaatttgcatcagcatacagggctca taccgcatctgcatcagctaagctccgcgtcctttaccaaggaaata acatcactgtaactgcctatgcaaacggcgaccatgccgtcacagtt aaggacgccaaattcattgtggggccaatgtcttcagcctggacacc tttcgacaacaaaattgtggtgtacaaaggtgacgtctataacatgg actacccgccctttggcgcaggaagaccaggacaatttggcgatatc caaagtcgcacacctgagagtaaagacgtctatgctaatacacaact ggtactgcagagaccggctgtgggtacggtacacgtgccatactctc aggcaccatctggctttaagtattggctaaaagaacgcggggcgtcg ctgcagcacacagcaccatttggctgccaaatagcaacaaacccggt aagagcggtgaactgcgccgtagggaacatgcccatctccatcgaca taccggaagcggccttcactagggtcgtcgacgcgccctctttaacg gacatgtcgtgcgaggtaccagcctcgacccattcctcagactttgg gggcgtcgccattattaaatatgcagccagcaagaaaggcaagtgtg cggtgcattcgatgactaacgccgtcactattcgggaagctgagata gaagttgaagggaattctcagctgcaaatctctttctcgacggcctt agccagcgccgaattccgcgtacaagtctgttctacacaagtacact gtgcagccgagtgccaccccccgaaggaccacatagtcaactacccg gcgtcacataccaccctcggggtccaggacatctccgctacggcgat gtcatgggtgcagaagatcacgggaggtgtgggactggttgttgctg ttgccgcactgattctaatcgtggtgctatgcgtgtcgttcagcagg cac
[0091] Regarding Chikungunya virus, an exemplary nucleotide sequence that encodes a Capsid-envelope is described below (SEQ ID No. 6):
TABLE-US-00008 atggagttcatcccgacgcaaactttctataacagaaggtaccaacc ccgaccctgggccccacgccctacaattcaagtaattagacctagac cacgtccacagaggcaggctgggcaactcgcccagctgatctccgca gtcaacaaattgaccatgcgcgcggtacctcaacagaagcctcgcag aaatcggaaaaacaagaagcaaaggcagaagaagcaggcgccgcaaa acgacccaaagcaaaagaagcaaccaccacaaaagaagccggctcaa aagaagaagaaaccaggccgtagggagagaatgtgcatgaaaattga aaatgattgcatcttcgaagtcaagcatgaaggcaaagtgatgggct acgcatgcctggtgggggataaagtaatgaaaccagcacatgtgaag ggaactatcgacaataccgatctggctaaactggcctttaagcggtc gtctaaatacgatcttgaatgtgcacagataccggtgcacatgaagt ctgatgcctcgaagtttacccacgagaaacccgaggggtactataac tggcatcacggagcagtgcagtattcaggaggccggttcactatccc gacgggtgcaggcaagccgggagacagcggcagaccgatcttcgaca acaaaggacgggtggtggccatcgtcctaggaggggccaacgaaggt gcccgcacggccctotccgtggtgacgtggaacaaagacatcgtcac aaaaattacccctgagggagccgaagagtggagcctcgccctcccgg tcttgtgcctgttggcaaacactacattcccctgctctcagccgcct tgcacaccctgctgctacgaaaaggaaccggaaagcaccttgcgcat gcttgaggacaacgtgatgagacccggatactaccagctactaaaag catcgctgacttgctctccccaccgccaaagacgcagtactaaggac aattttaatgtctataaagccacaagaccatatctagctcattgtcc tgactgcggagaagggcattcgtgccacagccctatcgcattggagc gcatcagaaatgaagcaacggacggaacgctgaaaatccaggtctct ttgcagatcgggataaagacagatgacagccacgattggaccaagct gcgctatatggatagccatacgccagcggacgcggagcgagccggat tgcttgtaaggacttcagcaccgtgcacgatcaccgggaccatggga cactttattctcgcccgatgcccgaaaggagagacgctgacagtggg atttacggacagcagaaagatcagccacacatgcacacacccgttcc atcatgaaccacctgtgataggtagggagaggttccactctcgacca caacatggtaaagagttaccttgcagcacgtacgtgcagagcaccgc tgccactgctgaggagatagaggtgcatatgcccccagatactcctg accgcacgctgatgacgcagcagtctggcaacgtgaagatcacagtt aatgggcagacggtgcggtacaagtgcaactgcggtggctcaaacga gggactgacaaccacagacaaagtgatcaataactgcaaaattgatc agtgccatgctgcagtcactaatcacaagaattggcaatacaactcc cctttagtcccgcgcaacgctgaactcggggaccgtaaaggaaagat ccacatcccattcccattggcaaacgtgacttgcagagtgccaaaag caagaaaccctacagtaacttacggaaaaaaccaagtcaccatgctg ctgtatcctgaccatccgacactcttgtcttaccgtaacatgggaca ggaaccaaattaccacgaggagtgggtgacacacaagaaggaggtta ccttgaccgtgcctactgagggtctggaggtcacttggggcaacaac gaaccatacaagtactggccgcagatgtctacgaacggtactgctca tggtcacccacatgagataatcttgtactattatgagctgtacccca ctatgactgtagtcattgtgtcggtggcctcgttcgtgcttctgtcg atggtgggcacagcagtgggaatgtgtgtgtgcgcacggcgcagatg cattacaccatatgaattaacaccaggagccactgttcccttcctgc tcagcctgctatgctgcgtcagaacgaccaaggcggccacatattac gaggctgcggcatatctatggaacgaacagcagcccctgttctggtt gcaggctcttatcccgctggccgccttgatcgtcctgtgcaactgtc tgaaactcttgccatgctgctgtaagaccctggcttttttagccgta atgagcatcggtgcccacactgtgagcgcgtacgaacacgtaacagt gatcccgaacacggtgggagtaccgtataagactcttgtcaacagac cgggttacagccccatggtgttggagatggagctacaatcagtcacc ttggaaccaacactgtcacttgactacatcacgtgcgagtacaaaac tgtcatcccctccccgtacgtgaagtgctgtggtacagcagagtgca aggacaagagcctaccagactacagctgcaaggtctttactggagtc tacccatttatgtggggcggcgcctactgcttttgcgacgccgaaaa tacgcaattgagcgaggcacatgtagagaaatctgaatcttgcaaaa cagagtttgcatcggcctacagagcccacaccgcatcggcgtcggcg aagctccgcgtcctttaccaaggaaacaacattaccgtagctgccta cgctaacggtgaccatgccgtcacagtaaaggacgccaagtttgtcg tgggcccaatgtcctccgcctggacaccttttgacaacaaaatcgtg gtgtacaaaggcgacgtctacaacatggactacccaccttttggcgc aggaagaccaggacaatttggtgacattcaaagtcgtacaccggaaa gtaaagacgtttatgccaacactcagttggtactacagaggccagca gcaggcacggtacatgtaccatactctcaggcaccatctggcttcaa gtattggctgaaggaacgaggagcatcgctacagcacacggcaccgt tcggttgccagattgcgacaaacccggtaagagctgtaaattgcgct gtggggaacataccaatttccatcgacataccggatgcggcctttac tagggttgtcgatgcaccctctgtaacggacatgtcatgcgaagtac cagcctgcactcactcctccgactttgggggcgtcgccatcatcaaa tacacagctagcaagaaaggtaaatgtgcagtacattcgatgaccaa cgccgttaccattcgagaagccgacgtagaagtagaggggaactccc agctgcaaatatccttctcaacagccctggcaagcgccgagtttcgc gtgcaagtgtgctccacacaagtacactgcgcagccgcatgccaccc tccaaaggaccacatagtcaattacccagcatcacacaccacccttg gggtccaggatatatccacaacggcaatgtcttgggtgcagaagatt acgggaggagtaggattaattgttgctgttgctgccttaattttaat tgtggtgctatgcgtgtcgtttagcaggcactaa.
[0092] Regarding Chikungunya virus, another exemplary nucleotide sequence that encodes a Capsid-envelope is described below (SEQ ID No. 7):
TABLE-US-00009 atggagttcatcccaacccaaactttttacaataggaggtaccagcc tcgaccctggactccgcgccctactatccaagtcatcaggcccagac cgcgccctcagaggcaagctgggcaacttgcccagctgatctcagca gttaataaactgacaatgcgcgcggtaccacaacagaagccacgcag gaatcggaagaataagaagcaaaagcaaaaacaacaggcgccacaaa acaacacaaatcaaaagaagcagccacctaaaaagaaaccggctcaa aagaaaaagaagccgggccgcagagagaggatgtgcatgaaaatcga aaatgattgtattttcgaagtcaagcacgaaggtaaggtaacaggtt acgcgtgcctggtgggggacaaagtaatgaaaccagcacacgtaaag gggaccatcgataacgcggacctggccaaactggcctttaagcggtc atctaagtatgaccttgaatgcgcgcagatacccgtgcacatgaagt ccgacgcttcgaagttcacccatgagaaaccggaggggtactacaac tggcaccacggagcagtacagtactcaggaggccggttcaccatccc tacaggtgctggcaaaccaggggacagcggcagaccgatcttcgaca acaagggacgcgtggtggccatagtcttaggaggagctaatgaagga gcccgtacagccctctcggtggtgacctggaataaagacattgtcac taaaatcacccccgagggggccgaagagtggagtcttgccatcccag ttatgtgcctgttggcaaacaccacgttcccctgctcccagccccct tgcacgccctgctgctacgaaaaggaaccggaggaaaccctacgcat gcttgaggacaacgtcatgagacctgggtactatcagctgctacaag catccttaacatgttctccccaccgccagcgacgcagcaccaaggac aacttcaatgtctataaagccacaagaccatacttagctcactgtcc cgactgtggagaagggcactcgtgccatagtcccgtagcactagaac gcatcagaaatgaagcgacagacgggacgctgaaaatccaggtctcc ttgcaaatcggaataaagacggatgacagccacgattggaccaagct gcgttatatggacaaccacatgccagcagacgcagagagggcggggc tatttgtaagaacatcagcaccgtgtacgattactggaacaatggga cacttcatcctggcccgatgtccaaaaggggaaactctgacggtggg attcactgacagtaggaagattagtcactcatgtacgcacccatttc accacgaccctcctgtgataggtcgggaaaaattccattcccgaccg cagcacggtaaagagctaccttgcagcacgtacgtgcagagcaccgc cgcaactaccgaggagatagaggtacacatgcccccagacacccctg atcgcacattaatgtcacaacagtccggcaacgtaaagatcacagtc aatggccagacggtgcggtacaagtgtaattgcggtggctcaaatga aggactaacaactacagacaaagtgattaataactgcaaggttgatc aatgtcatgccgcggtcaccaatcacaaaaagtggcagtataactcc cctctggtcccgcgtaatgctgaacttggggaccgaaaaggaaaaat tcacatcccgtttccgctggcaaatgtaacatgcagggtgcctaaag caaggaaccccaccgtgacgtacgggaaaaaccaagtcatcatgcta ctgtatcctgaccacccaacactcctgtcctaccggaatatgggaga agaaccaaactatcaagaagagtgggtgatgcataagaaggaagtcg tgctaaccgtgccgactgaagggctcgaggtcacgtggggcaacaac gagccgtataagtattggccgcagttatctacaaacggtacagccca tggccacccgcatgagataattctgtattattatgagctgtacccca ctatgactgtagtagttgtgtcagtggccacgttcatactcctgtcg atggtgggtatggcagcggggatgtgcatgtgtgcacgacgcagatg catcacaccgtatgaactgacaccaggagctaccgtccctttcctgc ttagcctaatatgctgcatcagaacagctaaagcggccacataccaa gaggctgcgatatacctgtggaacgagcagcaacctttgttttggct acaagcccttattccgctggcagccctgattgttctatgcaactgtc tgagactcttaccatgctgctgtaaaacgttggcttttttagccgta atgagcgtcggtgcccacactgtgagcgcgtacgaacacgtaacagt gatcccgaacacggtgggagtaccgtataagactctagtcaatagac ctggctacagccccatggtattggagatggaactactgtcagtcact ttggagccaacactatcgcttgattacatcacgtgcgagtacaaaac cgtcatcccgtctccgtacgtgaagtgctgcggtacagcagagtgca aggacaaaaacctacctgactacagctgtaaggtcttcaccggcgtc tacccatttatgtggggcggcgcctactgcttctgcgacgctgaaaa cacgcagttgagcgaagcacacgtggagaagtccgaatcatgcaaaa cagaatttqcatcagcatacagggctcataccgcatctgcatcagct aagctccgcgtcctttaccaaggaaataacatcactgtaactgccta tgcaaacggcgaccatgccgtcacagttaaggacgccaaattcattg tggggccaatgtcttcagcctggacacctttcgacaacaaaattgtg gtgtacaaaggtgacgtctataacatggactacccgccctttggcgc aggaagaccaggacaatttggcgatatccaaagtcgcacacctgaga gtaaagacgtctatgctaatacacaactggtactgcagagaccggct gtgggtacggtacacgtgccatactctcaggcaccatctggctttaa gtattggctaaaagaacgcggggcgtcgctgcagcacacagcaccat ttggctgccaaatagcaacaaacccggtaagagcggtgaactgcgcc gtagggaacatgcccatctccatcgacataccggaagcggccttcac tagggtcgtcgacgcgccctctttaacggacatgtcgtgcgaggtac cagcctgcacccattcctcagactttgggggcgtcgccattattaaa tatgcagccagcaagaaaggcaagtgtgcggtgcattcgatgactaa cgccgtcactattcgggaagctgagatagaagttgaagggaattctc agctgcaaatctctttctcgacggccttagccagcgccgaattccgc gtacaagtctgttctacacaagtacactgtgcagccgagtgccaccc cccgaaggaccacatagtcaactacccggcgtcacataccaccctcg gggtccaggacatctccgctacggcgatgtcatgggtgcagaagatc acgggaggtgtgggactggttgttgctgttgccgcactgattctaat cgtggtgctatgcgtgtcgttcagcaggcactaa.
[0093] In one embodiment, the present invention provides a vector comprising the nucleic acid molecule as described above, wherein the vector optionally comprises an expression control sequence operably linked to the nucleic acid molecule.
[0094] Examples of an expression control sequence include, but are not limited to, promoter such as CMV promoter, phage lambda PL promoter, the E. coli lac, phoA and tac promoters, the SV40 early and late promoters, and promoters of retroviral LTRs.
[0095] In this embodiment, the vector comprising an expression control sequence operably linked to the nucleic acid molecule as described above can be used as an expression vector for preparing the particle provided by the first aspect of the present invention.
[0096] The expression vectors can be prepared by a person skilled in the art based on WO/2012/006180, the entire contents of which are incorporated by reference herein.
[0097] Examples of vectors which can be used for expressing a virus like particle comprising a fusion protein of a polypeptide derived from Chikungunya virus (CHIKV) and a polypeptide of antigen include a vector shown in VLP_CHI 512 vector (SEQ ID No. 8) containing CHIKV VLP polynucleotide (SEQ ID No. 13; corresponding amino acid sequence represented by SEQ ID No.14); and VLP_CHI 532 vector (SEQ ID No.: 9) containing CHIKV VLP polynucleotide (SEQ ID No. 15; corresponding amino acid sequence represented by SEQ ID No. 16)
[0098] The expression vectors can be prepared by a person skilled in the art based on US2012/0003266, the entire contents of which are incorporated by reference herein.
[0099] Examples of vectors which can be used for expressing a virus like particle comprising a fusion protein of a polypeptide derived from Venezuelan equine encephalitis virus (VEEV) and a polypeptide of antigen include a vector shown in VLP_VEEV VLP 518 vector (SEQ ID No. 10) containing VEEV VLP polynucleotide (SEQ ID No. 17; corresponding amino acid sequence represented by SEQ ID No.18); VLP_VEEV VLP 519 vector (SEQ ID No.11) containing VEEV VLP polynucleotide (SEQ ID No. 19; corresponding amino acid sequence represented by SEQ ID No.20); and VLP_VEEV VLP 538 vector (SEQ ID No.: 12) containing VEEV VLP polynucleotide (SEQ ID No. 21; corresponding amino acid sequence represented by SEQ ID No. 22)
[0100] In one embodiment, the present invention provides a nucleic acid molecule which is designed for expression of a virus like particle comprising a fusion protein of a polypeptide derived from Chikungunya virus (CHIKV) or Venezuela equine encephalitis virus (VEEV) and a polypeptide derived from malaria antigen, which consists of a nucleotide sequence represented by SEQ ID Nos.26-27, 29-30, 32-33, 35-36, 38, 40 or 42.
[0101] In one embodiment, the present invention provides a nucleic acid molecule which is modified from the nucleic acid molecule having a nucleotide sequence represented by any one of SEQ ID Nos.26-27, 29-30, 32-33 or 35-36, 38, 40 or 42. The modified nucleic acid molecule may have at least 70%, 75%, 80%, 85%, 90%, 95% or 98% nucleotide sequence identity to the nucleic acid molecule having a nucleotide sequence represented by any one of SEQ ID Nos.26-27, 29-30, 32-33, 35-36, 38, 40 or 42. Also, the modified nucleic acid molecule may be a mutant where at most 10% of the amino acids are deleted, substituted, and/or added based on the nucleic acid molecule having a nucleotide sequence represented by any one of SEQ ID Nos.26-27, 29-30, 32-33, 35-36, 38, 40 or 42.
(3) Composition or Vaccine
[0102] In the third aspect, the present invention provides a composition or vaccine comprising the particle provided in the first aspect of the present invention and/or the nucleic acid molecule provided in the second aspect of the present invention.
[0103] In one embodiment, the present invention provides a composition or vaccine comprising the Alphavirus or Flavivirus virus like particle (e.g. Chikungunya virus like particle or Venezuelan equine encephalitis virus like particle) as described above or the nucleic acid molecule as described above. The content of the Alphavirus or Flavivirus virus like particle and the content of the nucleic acid molecule may be 0.00001-1 w/w %.
[0104] Dosage amount of the particle provided in the first aspect of the present invention (e.g. CHIKV VLP or VEEV VLP) may be 1-500 g/day.
[0105] One or more malaria antigens may be used for one composition or one vaccine provided by the third aspect of the present invention.
[0106] The composition or vaccine may further comprise a pharmaceutical acceptable carrier and/or adjuvant. Examples of adjuvant include, but are not limited to, aluminium salts, sodium hydroxide, Freund's complete adjuvant, Freund's incomplete adjuvant and Ribi solution (Sigma Adjuvant system, Sigma-Aldrich). The composition or vaccine provided in the third aspect of the present invention may contain buffering agent such as dibasic sodium phosphate hydrate, sodium dihydrogen phosphate and sodium chloride; and preserving agent such as thimerosal. In one embodiment, the composition or vaccine is an aqueous solution containing 0.001-1 w/w % of the particle provided in the first aspect of the present invention (e.g. CHIKV VLP or VEEV VLP), 1-10w/w % of buffering agent, 0.01-1w/w % of adjuvant and 0.00001-0.001w/w % of preserving agent.
[0107] A skilled person can prepare the pharmaceutical composition and vaccine using conventional technique. For example, the particle provided in the first aspect of the present invention is mixed with buffer solution having physiological pH (e.g. pH 5-9, pH7) to prepare the pharmaceutical composition and vaccine provided in the third aspect of the present invention.
[0108] The pharmaceutical composition of the present invention may contain a single active ingredient or a combination of two or more active ingredients, as far as they are not contrary to the objects of the present invention. For example, cytokines including chemokines, anti-body of cytokines such as anti TNF antibody (e.g. infliximab, adalimumab), anti-VEGF antibody (e.g. bevacizumab and ranibizumab), cytokine receptor antagonist such as anti HER2 antibody (e.g. Trastuzumab), anti EGF receptor antibody (e.g. Cetuximab), anti VEGF aptamer (e.g. Pegaptanib) and immunomodulator such as cyclosporine, tacrolimus, ubenimex may be used for the combination therapy.
[0109] In a combination of plural active ingredients, their respective contents may be suitably increased or decreased in consideration of their therapeutic effects and safety.
[0110] The term combination used herein means two or more active ingredient are administered to a patient simultaneously in the form of a single entity or dosage, or are both administered to a patient as separate entities either simultaneously or sequentially with no specific time limits, wherein such administration provides therapeutically effective levels of the two components in the body, preferably at the same time.
[0111] In one embodiment, the composition is a vaccine composition including a DNA vaccine. In one embodiment, the DNA vaccine provided by the present invention comprises CpG containing oligonucleotide.
[0112] The composition or vaccine provided in the third aspect of the present invention can be administered one or more times. When the composition or vaccine provided in the third aspect of the present invention is administered more than one time, different particle provided in the first aspect of the present invention (e.g. CHIKV VLP or VEEV VLP) may be used for each of the administration. In one embodiment, combination of immunization using CHIKV VLP provided in the first aspect of the invention and immunization using VEEV VLP provided in the first aspect of the invention is employed. For example, CHIKV VLP provided in the first aspect of the present invention may be used for the 1st immunization and VEEV VLP provided in the first aspect of the present invention may be used for the 2nd immunization, or VEEV VLP provided in the first aspect of the present invention may be used for the 1st immunization and CHIKV VLP provided in the first aspect of the present invention may be used for the 2nd immunization.
[0113] A skilled person can determine timing of immunization using the composition or vaccine provided in the third aspect of the present invention. For example, 2nd immunization is performed 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 weeks after 1st immunization.
[0114] In one embodiment, the present invention provides a kit comprising
(a) a vaccine composition comprising the particle provided in the first aspect of the present invention; and
(b) another vaccine composition comprising the particle provided in the first aspect of the present invention, wherein the particle contained in (a) is a virus like particle which is different from the particle contained in (b). In this embodiment, the particle contained in (a) may be Chikungunya virus like particle and the particle contained in (b) may be Venezuelan equine encephalitis virus like particle.
[0115] In one embodiment, the present invention provides a kit comprising
(a) a vaccine composition comprising the particle provided in the first aspect of the present invention; and
(b) another vaccine composition comprising the particle provided in the first aspect of the present invention,
(c) one or more vaccine composition, each of which comprises the particle provided in the first aspect of the present invention,
wherein (a) is used for priming immunization and (b) and (c) are used for boosting immunization; and the particle contained in (a) is a virus like particle which is different from the particle contained in (b); and the particle contained in (c) is different from the particle contained in (a) and (b), or the same as the particle contained in (a) or (b).
[0116] The respective vaccine compositions contained in the above-described kit may be administered simultaneously, separately or sequentially.
[0117] The Alphavirus or Flavivirus virus like particle (e.g. Chikungunya virus or Venezuelan equine encephalitis virus) provided in the first aspect of the present invention or the nucleic acid molecule provided by the second aspect of the invention can be used for the composition and vaccine provided in the third aspect of the present invention.
[0118] For example, Chikungunya or Venezuelan equine encephalitis virus like particle comprising or consisting of:
one or more (e.g. 240) capsid of Chikungunya virus (CHIKV) or Venezuelan equine encephalitis virus (VEEV);
one or more (e.g. 240) E1 of Chikungunya virus (CHIKV) or Venezuelan equine encephalitis virus (VEEV); and
one or more (e.g. 240) E2 of Chikungunya virus (CHIKV) or Venezuelan equine encephalitis virus (VEEV), wherein malaria antigen is inserted into E2 of Chikungunya virus (CHIKV) or Venezuelan equine encephalitis virus (VEEV) may be used for preparing the composition or vaccine provided in the third aspect of the present invention. The E2 into which the antigen is inserted may consist of an amino acid sequence represented by SEQ ID No.50; the E1 may consist of an amino acid sequence represented by SEQ ID No.51; and the capsid may consist of an amino acid sequence represented by SEQ ID NO.: 52; or
the E2 into which the antigen is inserted may consist of an amino acid sequence represented by SEQ ID NO.53; the E1 may consist of an amino acid sequence represented by SEQ ID NO.54; and the capsid may consist of an amino acid sequence represented by SEQ ID NO.: 55.
[0119] The composition or vaccine provided in the third aspect of the present invention can be administered to a mammal (e.g. human) intramuscularly (i.m.), intracutaneously (i.c.), subcutaneously (s.c.), intradermally (i.d.) or intraperitoneally (i.p.).
[0120] The composition or vaccine provided in the third aspect of the present invention may be used for treating or preventing malaria.
[0121] Thus, use of the Alphavirus or Flavivirus (e.g. Chikungunya virus or Venezuelan equine encephalitis virus) virus like particle provided in the first aspect of the present invention or the nucleic acid molecule provided by the second aspect of the invention for manufacturing a pharmaceutical composition or vaccine for treating or preventing malaria is also provided by the present invention.
(4) Method of Producing an Antibody, Method of Immunomodulation, Method of Treating Malaria, Method of Inducing and/or Enhancing Immune Response Against a Malaria Antigen in a Mammal, Method of Passive Immunization, Method of Presenting an Antigen on Macrophage, and Method for Producing a Particle
[0122] In the fourth aspect, the present invention provides a method of producing an antibody, comprising contacting the particle provided in the first aspect of the present invention and/or the nucleic acid molecule provided in the second aspect of the present invention to a mammal.
[0123] The antibody produced in the fourth aspect of the present invention may be humanized using a conventional technique. Thus, in one embodiment, the method provided in the fourth aspect of the invention further comprises a step of humanizing non-human mammal produced antibody.
[0124] The particle provided in the first aspect of the present invention and/or the nucleic acid molecule provided in the second aspect of the present invention may be administered directly into the patient, into the affected organ or systemically, or applied ex vivo to cells derived from the patient or a human cell line which are subsequently administered to the patient, or used in vitro to select a subpopulation from immune cells such as B-cell and T-cell derived from the patient, which are then re-administered to the patient.
[0125] According to the present invention, the virus like particle can be applied for the immune therapy.
[0126] In the fifth aspect, the present invention provides a method of immunomodulation, a method of treating malaria, a method of inducing and/or enhancing immune response against a malaria antigen in a mammal comprising administering the composition provided in the third aspect of the present invention to a mammal.
[0127] In sixth aspect, the present invention provides a method of passive immunization against a malaria-causing pathogen, comprising administering the antibody provided in the fourth aspect of the present invention to a mammal.
[0128] In seventh aspect, the present invention provides a method of presenting a malaria antigen on macrophage, comprising contacting the particle provided in the first aspect of the present invention and/or the nucleic acid molecule provided in the second aspect of the present invention to a mammal.
[0129] In eighth aspect, the present invention provides a method for producing the particle provided in the first aspect of the present invention, comprising preparing a vector designed for expression of said particle; culturing a cell which is transfected with said vector to express said particle; and recovering said particle.
[0130] Examples of mammal include, but are not limited to, a human.
[0131] In one embodiment, the present invention provides a method of producing an antibody against malaria antigen, comprising contacting the Chikungunya or Venezuelan equine encephalitis virus like particle as described above and/or the nucleic acid molecule as described above to a mammal. The produced antibody may be an antibody which can specifically bind to a malaria antigen comprised in the Chikungunya or Venezuelan equine encephalitis virus like particle or a malaria antigen encoded by the nucleic acid molecule. The method of producing an antibody provided by the present invention may be a useful for producing a monoclonal or polyclonal antibody against a malaria antigen.
[0132] In one embodiment, an antibody against malaria antigen obtained by the method of producing an antibody according to the present invention is used for passive immunization. The method of passive immunization may comprise administering the obtained antibody to a mammal.
[0133] In one preferred embodiment, the immunomodulation provided by the present invention is inducing and/or enhancing immune response against malaria antigen in a mammal. Thus, in one embodiment, the present invention provides a method of inducing and/or enhancing immune response against malaria antigen in a mammal, comprising administering an effective amount of the composition as described above to the mammal.
[0134] Given the symptom of patients infected with Chikungunya or Venezuelan equine encephalitis together with unusual big molecule of Chikungunya or Venezuelan equine encephalitis, this VLP can act effectively and efficiently to target macrophage and its composition such as cytokines and immunomodulative compounds.
[0135] In one aspect, the present invention provides a method of presenting an antigen on macrophage, comprising administering the Chikungunya or Venezuelan equine encephalitis virus like particle as described above and/or the nucleic acid molecule as described above to a mammal. The Chikungunya or Venezuelan equine encephalitis virus like particle provided by the present invention is good to target macrophage. In one embodiment, the Chikungunya or Venezuelan equine encephalitis virus like particle provided by the present invention is a kind of delivery system of the at least one antigen, which is comprised in the Chikungunya or Venezuelan equine encephalitis virus like particle, to macrophage.
[0136] In one embodiment, the present invention provides a method for producing Chikungunya or Venezuelan equine encephalitis virus like particle provided in the first aspect of the present invention, comprising preparing a vector designed for expression of said particle; culturing a cell which is transfected with said vector to express said particle; and recovering said particle. In this embodiment, transfection can be conducted using a conventional method. Cells using for the transfection may be 293 cells. Recovering VLP may include collecting a conditioned medium after cells are transfected with a vector, and may further include purify VLP from the conditioned medium using ultracentrifugation.
[0137] The present invention will be described in detail with reference to the following example, which, however, is not intended to limit the scope of the present invention.
EXAMPLES
Example 1
Preparation of Chikungunya Virus (CHIKV) Like Particle Comprising a Virus Structural Polypeptide and a Fragment of Malaria Antigen
[0138] The following polynucleotides of malaria CSP1 proteins are used. N terminal linker is SGG and C terminal linker is GGS.
TABLE-US-00010 VLP74(6repeatofNPNAaminoacidsequence) (SEQIDNo.:46) Sggnpnanpnanpnanpnanpnanpnaggs (SEQIDNo.:47) (Tccggaggaaacccgaatgccaatcccaacgcgaaccccaatgcta acccaaatgccaacccaaacgccaaccccaacgctggtggatcc) VLP78(25repeatofNPNAaminoacidsequence) (SEQIDNo.:48) Sggnpnanpnanpnanpnanpnanpnvdpnanpnanpnanpnanpna npnanpnanpnanpnanpnanpnanpnanpnanpnanpnanpnanpn anpnanpnaggs (SEQIDNo.:49) (tccggaggaaacccgaatgccaatcccaacgcgaaccccaacgcta accccaacgccaatccgaatgcaaacccgaacgttgacccaaacgcc aacccgaatgccaatcccaacgcgaaccccaatgctaacccaaatgc caacccaaacgccaaccccaacgctaatccaaacgccaaccctaacg ccaatcccaacgcgaatcctaacgctaatcccaacgcaaatcccaat gctaatccgaacgcgaaccctaatgcaaaccccaacgccaacccgaa cgctaacccgaacgctaatcccaacgccggtggatcc)
[0139] The respective polynucleotides was inserted between the codons encoding Ser at 531-position and Asn at 532-position of SEQ ID Nos.15 or 16 (SEQ ID Nos.1 or 2) to construct a plasmid (hereinafter referred to as CHIKV-VLP74 or 78) for expressing Chikungunya virus like particle where the modified VLP74 or 78-derived peptide is inserted into E2 of Chikungunya virus structural polypeptide.
[0140] 293F cells (Lifetechnology) were transfected with the plasmid using PEI (GE Healthcare) or GeneX (ATCC). 4 days after the transfection, the conditioned medium was collected and centrifuged at 3000 rpm for 15 minutes to separate it from cells. The supernatant was filtrated using 0.45 m filter to obtain virus like particles. The virus like particles were concentrated using TFF column and purified using QXL column (GE Healthcare) to obtain purified virus like particles. When animals were immunized with virus like particles, the purified virus like particles were further concentrated using spin column (Molecular Weight-cutoff: 100 kDa) to prepare the virus like particles for the immunization.
[0141] The expression of VLP comprising VLP74 or 78 conjugated with Chikungunya virus structural polypeptide was confirmed by Western Blot using an antibody specific for CHIKV (ATCC: VR-1241AF) and an antibody specific for VLP74 or 78.
Example 2
Preparation of Venezuelan Equine Encephalitis Virus (VEEV) Like Particle Comprising a Virus Structural Polypeptide and a Fragment of Malaria Antigen
[0142] The same polynucleotides of malaria CSP1 proteins (VLP74 and VLP78) used in EXAMPLE 1 are used. N terminal linker is SGG and C terminal linker is GGS.
[0143] The respective polynucleotides was inserted between the codons encoding Ser at 518-position and Ser at 519-position of SEQ ID Nos.19 or 20 (SEQ ID No.3) to construct a plasmid (hereinafter referred to as VEEV-VLP74 or 78) for expressing Venezuelan equine encephalitis virus like particle where the modified VLP74 or 78-derived peptide is inserted into E2 of Venezuelan equine encephalitis virus structural polypeptide.
[0144] 293F cells (Lifetechnology) were transfected with the plasmid using PEI (GE Healthcare) or GeneX (ATCC). 4 days after the transfection, the conditioned medium was collected and centrifuged at 3000 rpm for 15 minutes to separate it from cells. The supernatant was filtrated using 0.45 m filter to obtain virus like particles. The virus like particles were concentrated using TFF column and purified using QXL column (GE Healthcare) to obtain purified virus like particles. When animals were immunized with virus like particles, the purified virus like particles were further concentrated using spin column (Molecular Weight-cutoff: 100 kDa) to prepare the virus like particles for the immunization.
[0145] The expression of VLP comprising VLP 74 or 78 conjugated with Venezuelan equine encephalitis virus structural polypeptide was confirmed by Western Blot using an antibody specific for VEEV and an antibody specific for VLP74 or 78.
Example 3
Immunogenicity in Non-Human Primate (Monkey)
[0146] The monkeys were immunized with 25-CHI (80 ug) at 0 week and 6-VEE (80 ug) at 3 week by intramuscular injection with or without adjuvant (Sigma Adjuvant System, Sigma, S6322). 25-CHI means 25 times malaria CSP repeat amino acid NPNA on CHIKV VLP particle (VLP78_15). 6-VEE means 6 times malaria CSP repeat amino acid NPNA on VEEV VLP particle (VLP74_25). The blood is taken at 2 and 5 weeks after the first immunization.
[0147] 96 well ELISA plate were coated with 50 ng of Recombinant Circumsporozoite Protein (rCSP) (Reagent Proteins, ATG-422) in 100 ul PBS buffer pre well. The Plates after 2 hours incubation were washed three times TBS buffer containing 0.05% Tween-20 and blocked with TBS buffer containing 0.05% Tween-20 and 5% dry milk. The heat inactivated diluted serum from monkeys were added in the blocking buffer and incubated for 1 h at room temperature. After washing three times, peroxidase labeled goat anti-human IgG or anti-mouse IgG was added at 1:4000 dilution and incubated for 1 h at room temperature. After washing three times, Peroxidase substrate was added for development and incubated for 10 mins and 2N H2SO4 was added to stop the development. The data were analyzed using Gen5 (BioTek) and GraphPad Prism6 (GraphPad software Inc).
[0148] The Immunogenicities are shown in
[0149] Induction of antibodies against CSP was found in the serum of all monkeys immunized with Malaria VLPs (see
[0150] As seen in
[0151] The anti-Pf CSP antibody titer in the serum from the monkeys immunized with 25-CHI (80 ug) at 0 week and 6-VEE (80 ug) at 3 week without using adjuvant was measured by ELISA at Malaria Serology Lab Malaria Vaccine Branch, WRAIR. In the ELISA performed at Malaria Serology Lab Malaria Vaccine Branch, WRAIR, the plates were coated with CSPrp ((NPNA)6 Peptide) [0.2 g/L] (Supplier: Eurogentec EP070034) and Goat -Human IgG (KPL/074-1002 LOT#120714) was used as 2nd antibody. The final titer was determined by the dilution factor that yields an OD of 1.0 (414 nm).
[0152] As a result, the anti-Pf CSP antibody titer in the serum from the monkeys was enhanced after 2nd immunization compared to 1st immunization (see Table 2). Compared to the anti-Pf CSP antibody titer in the serum from the monkeys immunized with RTS,S (GlaxoSmithKline), the anti-Pf CSP antibody titer in the serum from the monkeys immunized with 25-CHI (80 ug) and 6-VEE (80 ug) in the absence of adjuvant was considered to be higher even though RTS,S (GlaxoSmithKline) contains adjuvant.
TABLE-US-00011 TABLE 2 After 1st After 2nd immunization immunization Animal No. Week 2 Week 5 1 8990 29420 2 48210 44100 3 80400 51230 4 16260 19640 Geometric mean 27359 33801
Example 4
Immunogenicity in Mouse
[0153] The mice immunized with 10 ug of VLP78_15 at week 0, 10 ug of VLP74_25 at week 3 and 10 ug of VLP78_15 at week 6 with or without adjuvant (Sigma Adjuvant System, Sigma, S6322) by intramuscular injection.
[0154] The anti-Pf CSP antibody titer in the serum from the immunized mice were measured by ELISA at Malaria Serology Lab Malaria Vaccine Branch, WRAIR, where plates were coated with CSPrp ((NPNA)6 Peptide) [0.2 g/L] (Supplier: Eurogentec EP070034) and Goat -Mouse IgG (KPL/074-1806 LOT#100737) is used as 2nd antibody to detect the antibodies in the serum.
[0155] The final titer was determined by the dilution factor that yields an OD of 1.0 (414 nm).
[0156] The Immunogenicity are shown in Tables 3 and 4.
[0157] Tables 3 and 4 show that higher titer of antibodies against CSP was achieved after immunizing virus like particle three times. In addition, Tables 3 and 4 show that use of adjuvant enhanced the titer of antibodies against CSP.
TABLE-US-00012 TABLE 3 Mouse Week 3 (after 1.sup.st immunization) Mouse No. VLP VLP + Adjuvant 1 6070 QNS 2 5850 13680 3 9610 7610 4 5440 23370 5 16320 27390 Geometric Mean 7875 16066 QNS = Quantity not sufficient to test
TABLE-US-00013 TABLE 4 Mouse Week 9 (after 1st immunization) Mouse No. VLP VLP + Adjuvant 1 35510 729000 2 15040 197800 3 41650 106700 4 37250 436000 5 48200 497600 Geometric Mean 33134 319666
Example 5
Immunogenicity of P. yoelii CSP Inserted VLP in Mice
[0158] QGPGAP seen in the rodent malaria CSP (P.yoelii CSP) was used as an antigen. 6 QGPGAP was inserted into CHIKV VLP. The mice were immunized with the CHIKV VLP 2 times at 0 and 8 week (20 ug VLP per mouse) by intramuscle injection with or without Adjuvant Ribi.
[0159] Immunogenicity was confirmed at 4, 6, 10 and 14 weeks after the first immunization. The anti-P. yoelii
[0160] CSP antibody were measured by ELISA. The ELISA was performed in the same way as ELISA described in Example 3 except that the plates were coated with P. Yoelii CSP repeat sequence peptide at 0.1 ng/l. The secondary antibody was anti-mouse IgG HRP (Cell signal, #7076S). The results are shown in
[0161]
Example 6
Protection of Mice Against Malaria by Intramuscle Injection of CHIKV VLP Comprising P. yoelii CSP Epitope: 6 QGPGAP
[0162] 6 QGPGAP was inserted into CHIKV VLP. The mice (n=5) were immunized with the CHIKV VLP 2 times at 0 and 8 week (20 ug VLP per mouse) by intramuscle injection with or without Adjuvant Ribi (see
[0163] Malaria infection was confirmed by PCR. Genomic DNA was purified from the mice blood day 6 after challenge. 18S malaria DNA was amplified by PCR.
Example 7
Preparation of Vaccine Composition Comprising Chikungunya Virus (CHIKV) Like Particle Comprising NPNA Repeat or Venezuelan Equine Encephalitis Virus (VEEV) Like Particle Comprising NPNA Repeat
[0164] Chikungunya virus (CHIKV) like particle comprising 6 or 25 NPNA was prepared according to Example 1, and Venezuelan equine encephalitis virus (VEEV) like particle comprising 6 NPNA was prepared according to Example 2. To prepare a vaccine composition, 80 g of each of the prepared particles was mixed with 1 ml of Sucrose Phosphate Solution, pH 7.2, Endotoxin Free (Teknova, SP buffer).