METHOD FOR PREPARING INDUCED PLURIPOTENT STEM CELL, COMPOSITION USED IN METHOD, AND USES THEREOF
20170037376 ยท 2017-02-09
Assignee
Inventors
- Duanqing Pei (Guangdong, CN)
- Jing Liu (Guangdong, CN)
- Jiekai Chen (Guangdong, CN)
- Meixiu PENG (Guangdong, CN)
Cpc classification
C12N5/0696
CHEMISTRY; METALLURGY
International classification
Abstract
Provided are a method for preparing an induced pluripotent stem cell and a composition used in the method. The method comprises: introducing a composition for promoting the formation of an induced pluripotent stem cell into a somatic cell, the composition comprising: (i) a c-Jun antagonist and one group of factors from among the following seven such groups: (1) Sox2, Klf4 and c-Myc, (2) Klf4 and c-Myc, (3) Oct3/4, Klf4 and c-Myc, (4) Sox2, Nanog and Lin28, (5) Oct3/4, Nanog and Lin28, (6) Oct3/4, Klf and Sox2, and (7) Klf4 and Sox2; or (ii) the c-Jun antagonist, Jhdm1b and Id1, and at least one of Glis1, Sall4 or Lrh1; or (iii) the c-Jun antagonist, Jhdm1b and Id1, and at least one of: Oct4, Klf4, Sox2, Lin28, Esrrb, Lef1, Utf1 or miRNA C. The present method allows for successful preparation of induced pluripotent stem cells with no generation of abnormal chromosomes.
Claims
1. A method for preparing an induced pluripotent stem cell, comprising introducing a composition for promoting the formation of an induced pluripotent stem cell into a somatic cell, wherein said composition comprises: (i) a c-Jun antagonist and one group of factors selected from the following seven groups of factors: (1) Sox2, Klf4 and c-Myc, (2) Klf4 and c-Myc, (3) Oct3/4, Klf4 and c-Myc, (4) Sox2, Nanog and Lin28, (5) Oct3/4, Nanog and Lin28, (6) Oct3/4, Klf and Sox2, and (7) Klf4 and Sox2; or (ii) a c-Jun antagonist, Jhdm1b and Id1; and at least one of Glis1, Sall4 and Lrh1; or, (iii) a c-Jun antagonist, Jhdm1b and Id1; and at least one of Oct4, Klf4, Sox2, Lin28, Esrrb, Lef1, Utf1 and miRNA C; and wherein when the c-Jun antagonist is c-JunDN, said composition does not comprise the following four groups of factors: (1) Sox2, Klf4 and c-Myc, (2) Oct3/4, Klf4 and c-Myc, (3) Oct3/4, Klf and Sox2, or (4) Klf4 and Sox2.
2. The method of claim 1, wherein the c-Jun antagonist includes an antagonistic factor having a bZIP domain but lacking a transactivation domain and a compound, a nucleic acid, a protein and RNA antagonizing c-Jun activity.
3. The method of claim 2, wherein the c-Jun antagonist comprises a truncated c-Jun gene c-JunDN or Jdp2 or a functional variant thereof, wherein: (a) the c-JunDN has an amino acid sequence of SEQ ID NO. 2, (b) the Jdp2 has an amino acid sequence of SEQ ID NO. 3, (c) the functional variant of the c-JunDN has an amino acid sequence showing at least 70% homology to SEQ ID NO. 2, and (d) the functional variant of the Jdp2 has an amino acid sequence showing at least 70% homology to SEQ ID NO. 3.
4. The method of claim 3, wherein the functional variant includes a functional variant that still has a bZIP domain but lacks a transactivation domain, in which 1 to 100 amino acids among c-JunDN amino acids are substituted, inserted and/or deleted.
5. The method of claim 1, wherein the somatic cell is selected from mouse somatic cell and human somatic cell.
6. The method of claim 5, wherein the mouse somatic cell and the human somatic cell are selected from the group consisting of: fibroblast, bone marrow derived mononuclear cell, skeletal muscle cell, fat cell, peripheral blood mononuclear cell, macrophage, neural stem cell, hepatic cell, keratinocyte, oral keratinocyte, hair follicle dermal cell, gastric epithelial cell, lung epithelial cell, synovial cell, renal cell, skin epithelial cell and osteoblast cell.
7. A composition for promoting the formation of an induced pluripotent stem cell, wherein said composition comprises: (i) a c-Jun antagonist and one group of factors selected from the following seven groups of factors: (1) Sox2, Klf4 and c-Myc, (2) Klf4 and c-Myc, (3) Oct3/4, Klf4 and c-Myc, (4) Sox2, Nanog and Lin28, (5) Oct3/4, Nanog and Lin28, (6) Oct3/4, Klf and Sox2, and (7) Klf4 and Sox2; or (ii) a c-Jun antagonist, Jhdm1b and Id1; and at least one of Glis1, Sall4 and Lrh1; or (iii) a c-Jun antagonist, Jhdm1b and Id1; and at least one of Oct4, Klf4, Sox2, Lin28, Esrrb, Lef1, Utf1 and miRNA C, and wherein when the c-Jun antagonist is c-JunDN, said composition does not comprise the following four groups of factors: (1) Sox2, Klf4 and c-Myc, (2) Oct3/4, Klf4 and c-Myc, (3) Oct3/4, Klf and Sox2, or (4) Klf4 and Sox2.
8. The composition of claim 7, wherein the c-Jun antagonist includes an antagonistic factor having a bZIP domain but lacks a transactivation domain and a compound, a nucleic acid, a protein and RNA antagonizing c-Jun activity.
9. The composition of claim 8, wherein the c-Jun antagonist comprises a truncated c-Jun gene c-JunDN or Jdp2 or a functional variant thereof, wherein: (a) the c-JunDN has an amino acid sequence of SEQ ID NO. 2, (b) the Jdp2 has an amino acid sequence of SEQ ID NO. 3, (c) the functional variant of the c-JunDN has an amino acid sequence showing at least 70% homology to SEQ ID NO. 2, and (d) the functional variant of the Jdp2 has an amino acid sequence showing at least 70% homology to SEQ ID NO. 3.
10. The composition of claim 9, wherein the functional variant includes a functional variant that still has a bZIP domain but lacks a transactivation domain, in which 1 to 100 amino acids among c-JunDN amino acids are substituted, inserted and/or deleted.
11. An induced pluripotent stem cell obtained by the method of claim 1.
12. A method of making an induced pluripotent stem cell preparation comprising use of the composition of claim 7.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
DETAILED DESCRIPTION OF PREFERRED EMBODIMENTS
[0058] Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs.
1. Method for Preparing iPSCs
Overview
[0059] In general, the present invention provides a method for preparing an induced pluripotent stem cell (iPSC) using a composition comprising a c-Jun antagonist and a composition comprising a c-Jun antagonist for promoting the formation of iPSCs as used in the method, wherein, said composition comprises a c-Jun antagonist and one or more kinds of other factors as mentioned herein, and the c-Jun antagonist is for example a c-Jun antagonistic factor having a bZIP domain but lacking a transactivation domain, and a compound, an antibody or a fragment of an antibody that antagonizes c-Jun activity.
[0060] In one aspect, the present invention provides a method for preparing an induced pluripotent stem cell (iPSC), comprising introducing a composition for promoting the formation of an induced pluripotent stem cell (iPSC) into a somatic cell, wherein, said composition comprises:
(i) a c-Jun antagonist, and one group of factors selected from the following seven groups of factors: (1) Sox2, Klf4 and c-Myc, (2) Klf4 and c-Myc, (3) Oct3/4, Klf4 and c-Myc, (4) Sox2, Nanog and Lin28, (5) Oct3/4, Nanog and Lin28, (6) Oct3/4, Klf and Sox2, and (7) Klf4 and Sox2; or
said composition comprises:
(ii) a c-Jun antagonist, Jhdm1b and ld1; and at least one of Glis1, Sall4 and Lrh1; or,
said composition comprises:
(iii) a c-Jun antagonist, Jhdm1b and ld1; and at least one of Oct4, Klf4, Sox2, Lin28, Esrrb, Lef1, Utf1 and miRNA C.
c-Jun Antagonist
[0061] c-Jun is a proto-oncogene known to play an important role in cell proliferation, survival, and transformation. It was the first carcinogenic factor found to have DNA sequence specific binding capability. c-Jun regulates the expression of various genes by binding to conservative sequences TGA(C/G)TCA located in promoter or enhancer regions. Once anchored on the chromatin, c-Jun interacts with the general transcription factor complex through its transactivation domain located at the N-terminus to activate the expression of target genes. c-Jun can also dimerize through its leucine zipper domain with other factors of the AP-1 family to generate diversity of transcription regulatory complexes. As such, c-Jun has been shown to regulate a plethora of downstream targets implicated in carcinogenesis, cell proliferation, apoptosis, etc.
[0062] c-Jun antagonist as described herein refers to a molecule capable of blocking or reducing the activity of c-Jun, for example, a small molecular compound, a substance derived from nucleic acid and the like that can bind to a natural binding partner (such as AP-1) of c-Jun but does not activate a downstream gene of c-Jun and can enter a cell. In some embodiments, the c-Jun antagonist comprises a small molecular compound capable of binding c-Jun or AP-1, e.g., a mRNA drug that can reduce the expression of c-Jun, for example, FSK (Forskolin, Mao Housu, a commonly used adenosine cyclase activator), HDAC (histone deacetylase) inhibitor, etc. In some embodiments, the c-Jun antagonist comprises a nucleic acid capable of binding to c-Jun or AP-1, for example, aptamer. In some embodiments, the c-Jun antagonist comprises a protein capable of inhibiting the expression of c-Jun, for example, antisense nucleic acid (e.g. DNA or RNA or a hybrid thereof).
[0063] In some embodiments, the c-Jun antagonist includes a variant of c-Jun, for example, a functional variant of c-Jun or a fragment of c-Jun. The term functional variant as used herein refers to inclusion of for example only conservative changes or changes in non-critical residues or in non-critical regions and preservation of functions of an original polypeptide. Functional variant may also comprise replacement of similar amino acids, which leads to unchanged or insignificantly changed functions. Said replacement of amino acids includes replacement in amino acid sequences by substituting, eliminating, inserting, fusing, truncating one or more amino acids (for example 1-100 amino acids, e.g., 1-90 amino acids, e.g., 1-80 amino acids, e.g., 1-70 amino acids, e.g., 1-60 amino acids, e.g., 1-50 amino acids, e.g., 1-40 amino acids, e.g., 1-30 amino acids) or any combination thereof. In some embodiments, a plurality of amino acids (e.g., 50 amino acids, e.g., 40 amino acids) are inserted into a truncated amino acid to enhance the stability and expression efficiency of the functional variant of the c-Jun antagonist.
[0064] In the present invention, various different molecules can be used as c-Jun antagonists. In some embodiments, the following steps can be used to select a new c-Jun antagonist (T. S. Huang, et al., Proc. Natl. Acad. Sci. USA, 88, 5292, 1991, B. L. Bennett et al., Proc. Natl. Acad. Sci. USA, 98, 13681, 2001).
(1) Reporter Gene Assay: a candidate antagonist and a reporter gene plasmid are imported into a cell together by using AP-1 reporter gene luciferase plasmid, and fluorescence intensity is detected with a fluorescence illuminance meter after 36 hours.
(2) EMSA (gel migration test, Electrophoretic Mobility Shift Assay): a cell is lysed upon treated with a candidate antagonist, followed by co-incubation with a probe comprising AP-1 binding site. Then, electrophoretic separation is conducted using 4% non-denatured polyacrylamide gel, followed by drying and developing the polyacrylamide gel. It is examined whether the antagonist has any effect on the binding of c-Jun to the probe comprising AP-1 binding site.
(3) Western Blotting Assay: a cell is lysed upon treated with a candidate antagonist and the phosphorylation level of c-Jun in the cell is detected using a phosphorylated c-Jun antibody.
(4) RT-PCR detection: A cell is treated with a candidate antagonist. mRNA is extracted from the cell and the extracted mRNA is reversely transcripted to obtain cDNA. Then fluorescence quantitative PCR analysis is conducted using a specific c-Jun primer to detect mRNA expression levels of c-Jun in the sample.
Preparation of iPSCs
[0065] In one aspect, the present invention provides a method for preparing iPSCs by using a c-Jun antagonist and one group of factors selected from the following seven groups of factors:
(1) Sox2, Klf4 and c-Myc,
(2) Klf4 and c-Myc,
(3) Oct3/4, Klf4 and c-Myc,
(4) Sox2, Nanog and Lin28,
(5) Oct3/4, Nanog and Lin28,
(6) Oct3/4, Klf and Sox2, and
(7) Klf4 and Sox2.
[0066] In some embodiments of the present invention, the present invention utilizes a composition comprising a c-Jun antagonist, and Sox2, Klf4 and c-Myc to prepare iPSCs, or, the present invention utilizes a composition comprising a c-Jun antagonist, and Oct3/4, Klf4 and c-Myc to prepare iPSCs, or, the present invention utilizes a composition comprising a c-Jun antagonist, and Oct3/4, Klf4 and c-Myc to prepare iPSCs, or, the present invention utilizes a composition comprising a c-Jun antagonist, and Sox2 and Klf4 to prepare iPSCs.
[0067] In another aspect, the present invention provides a method for preparing iPSCs by using a non-Yamanaka factor, i.e., c-Jun antagonist, Jhdm1b and ld1, and at least one of Glis1, Sall4 and Lrh1.
[0068] In a preferred embodiment of the present invention, the present invention utilizes a c-Jun antagonist, Jhdm1b and Id1; and Glis1, Sall4 or Lrh1 to prepare iPSCs.
[0069] In still another aspect, the present invention provides a method for preparing iPSCs by using a c-Jun antagonist, Jhdm1b and Id1, and at least one factor selected from the group consisting of Oct4, Klf4, Sox2, Lin28, Esrrb, Lef1, Utf1 and miRNA C.
[0070] In some embodiments of the present invention, the present invention utilizes a c-Jun antagonist, Jhdm1b and ld1 as well as Oct4 to prepare iPSCs, or, the present invention utilizes a c-Jun antagonist, Jhdm1b and ld1 as well as Klf4 to prepare iPSCs, or, the present invention utilizes a c-Jun antagonist, Jhdm1b and ld1 as well as Sox2 to prepare iPSCs, or, the present invention utilizes a c-Jun antagonist, Jhdm1b and ld1 as well as Lin28 to prepare iPSCs, or, the present invention utilizes a c-Jun antagonist, Jhdm1b and ld1 as well as Esrrb to prepare iPSCs, or, the present invention utilizes a c-Jun antagonist, Jhdm1b and ld1 as well as Lef1 to prepare iPSCs, or, the present invention utilizes a c-Jun antagonist, Jhdm1b and ld1 as well as Utf1 to prepare iPSCs, or, the present invention utilizes a c-Jun antagonist, Jhdm1b and ld1 as well as miRNA C to prepare iPSCs.
[0071] Generally speaking, the method for preparing iPSCs includes the process of inducing a mammalian somatic cell into a pluripotent stem cell. Said method is accomplished by expressing an exogenous or endogenous polypeptide (especially a protein that plays an important role in maintaining or regulating embryonic stem cell self-renewal and/or pluripotency). The protein that plays an important role in maintaining or regulating embryonic stem cell self-renewal and/or pluripotency is for example transcription factors Oct3/4, Sox2, Klf4 and c-Myc highly expressed in embryonic stem cells. Expressing these transcription factors may include introducing an expression vector that encodes a target polypeptide into a cell, transducing a cell by using a recombinant virus, introducing an exogenous purified target polypeptide into a cell, contacting a cell with a non-naturally occurring inducing reagent that induces the expression of an endogenous gene (for example, Oct3/4, Sox2, Klf4 and c-Myc) encoding a target polypeptide, contacting a cell with one or more inducing reagents or inducing factors, or, contacting a cell with other biological, chemical or physical reagents that induce the expression of a target polypeptide encoding gene (for example, endogenous genes Oct3/4, Sox2, Klf4 and c-Myc). For example, in some cases (depending on the type of the cell to be induced), one or more exogenous inducing factors can be used in combination with a chemical inducing reagent, which is for example histone deacetylase (for instance, valproic acid), histone methyltransferase inhibitor (e.g., BIX01294), DNA demethylation reagent (for example, 5-cytidine), L-type calcium channel agonist (for example, BayK8644), or TFG-beta receptor inhibitor. The basic steps for inducing cell reprogramming comprise: (1) collecting cells from a donor, (2) inducing the cells by for example enabling a polypeptide e.g. Oct3/4, Sox2, Klf4 and c-Myc to express, (3) selecting pluripotent stem cells, (4) isolating and cloning, and (5) optionally, storing the cells. Each step of the above-mentioned steps for inducting cell reprogramming includes cell culture and amplification. The finally obtained induced pluripotent stem cells can be used in various application areas, such as cell transplantation therapy, and so on.
[0072] As used in the method for inducing cell reprogramming of the present invention, the cell from a donor may be various kinds of mammalian cells. Examples of suitable mammalian cell population include but are not limited to: fibroblasts, bone marrow derived mononuclear cells, skeletal muscle cells, fat cells, peripheral blood mononuclear cells, macrophage, neural stem cells, hepatic cells, keratinocytes, oral keratinocytes, hair follicle dermal cells, gastric epithelial cells, lung epithelial cells, synovial cells, renal cells, skin epithelial cells and osteoblast cells.
[0073] Donor-derived cells may also be originated from different types of tissues, such as, bone marrow, skin (e.g. dermis, epidermis), scalp tissue, muscle, adipose tissue, peripheral blood, skeletal muscle or smooth muscle. The cells may also be derived from neonatal tissues, including but not limited to: umbilical cord tissue (e.g., umbilical cord, cord blood, umbilical cord blood vessel), amnion, placenta and other different neonatal tissues (e.g., bone marrow fluid, muscle, adipose tissue, peripheral blood, skin, skeletal muscle, and so on).
[0074] Donor-derived cells preferably are human cells, but may also be derived from cells of non-human mammals. Non-human mammals include but are not limited to: non-human primates (such as, apes, monkeys, chimpanzees), rodent animals (such as, mice, rats), cattle, pigs, sheep, horses, dogs, cats and rabbits.
[0075] In some embodiments of the present invention, cells can be collected from patients suffered from various kinds of diseases, or cells can be collected from non-sick humans. Under some circumstances, cells are collected from humans suffered from or at risk of suffering from the following diseases, for example chronic disease (such as cardiovascular disease), eye disease (such as macular degeneration), hearing disorder (such as deaf), diabetes, cognitive dysfunction, schizophrenia, depression, manic depressive disorders, dementia, neurodegenerative disease, Alzheimer disease, Parkinson's disease, multiple sclerosis, osteoporosis, hepatopathy, nephropathy, autoimmune disease, asthma or proliferative disorder (such as cancer). Under some circumstances, cells may be collected from humans suffered from or at risk of suffering from the following diseases, for example acute diseases, such as, apoplexy, spinal cord injury, burn, trauma, and so on.
[0076] In some embodiments, as used in the method for preparing iPSCs of the present invention, the amino acid sequence of other induced factors (IF) such as Oct3/4, Klf4, Sox2, c-Myc, Nanog and Lin28 may be naturally occurring amino acid sequence of these factors, for example, human or mouse Oct3/4, human or mouse Klf4, human or mouse Sox2, human or mouse c-Myc, human or mouse Nanog and human or mouse Sox2, or may be a variant of naturally occurring amino acid sequence of IFs (i.e., non-naturally occurring amino acid sequence) which however is homologous to naturally occurring amino acid sequence in terms of function and structure.
[0077] A method for evaluating the homology of two or more amino acid sequences in terms of function or structure usually includes determining the percent consistency between amino acid sequences. Percent consistency refers to the number of identical residues (i.e., amino acids or nucleotides) at positions common to the compared sequences. Sequence alignment and comparison may be carried out by the standard algorithms of the art (for example, Smith and Waterman, 1981, Adv. Appl. Math. 2:482; Needleman and Wunsch, 1970, J. MoI. Biol. 48:443; Pearson and Lipman, 1988, Proc. Natl. Acad. Sci., USA, 85:2444) or a computerized version of these algorithms (Wisconsin Genetics Software Package Release 7.0, Genetics Computer Group, 575 Science Drive, Madison, Wis.), wherein said computerized version is publicly available as BLAST and FASTA. Additionally, the ENTREZ available from the National Institutes of Health (Bethesda Md.) may be used for sequence comparison. When BLAST and gapped BLAST programs are used, the default parameters of the respective programs (such as BLASTN, which is available on the internet site of the National Center for Biotechnology Information) may be used. In one embodiment, GCG with a gap weight of 1 may be used to determine the percent identity between two sequences, such that each amino acid gap is given a weight as if it is a single amino acid mismatch between the two sequences. Alternatively, ALIGN program (version 2.0), which is a part of GCG (Accelrys, San Diego, Calif.) sequence alignment software package, may be used.
[0078] Oct3/4 used herein indicates a member of the family of Octamer (Oct) transcription factors and plays a crucial role in maintaining pluripotency. The absence of Oct3/4 in Oct3/4+cells (such as blastomere and embryonic stem cells) leads to spontaneous trophoblast differentiation and thus the presence of Oct3/4 gives rise to the pluripotency and differentiating potential of embryonic stem cells. Various other genes in the Oct family, including Oct3/4's close relatives, Oct1 and Oct6, fail to induce pluripotency, thus demonstrating the exclusiveness of Oct3/4 to the process of pluripotency induction.
[0079] The Sox family of genes is associated with the maintenance of pluripotency similar to Oct3/4, although it is associated with multipotent stem cells and unipotent stem cells in contrast with Oct3/4, which is exclusively expressed in pluripotent stem cells. While Sox2 was the initial gene used for induction by Yamanaka et al., Other genes in the Sox family have been found to work as well in the induction process. Sox1 yields iPSCs with a similar efficiency as Sox2, and Sox3, Sox15 and Sox18 also generate iPSCs, although with decreased efficiency.
[0080] In the preparation of induced pluripotent stem cells, at least one Oct member (such as Oct3/4) and at least one Sox member (such as Sox2) are necessary for promoting the generation of pluripotency. Yamanaka et al. reported that Nanog may not be necessary for the generation of induced pluripotency (Kazutoshi Takahashi, et al., Cell, 131:1-12, 2007), although Junying Yu et al. reported that Nanog may be used as one of the factors for promoting the formation of iPSCs and Nanog certainly enhances reprogramming efficiency in a dose-dependent manner (Junying Yu, et al. Science, 318: 1917-1920, 2007).
[0081] Lin28 is an mRNA binding protein expressed in embryonic stem cells and embryonic carcinoma cells associated with differentiation and proliferation. Junying Yu et al. demonstrated it is a factor in iPSC generation, although it is unnecessary (Junying Yu, et al. Science, 318: 1917-1920, 2007).
[0082] Klf4 of the Klf family of genes was initially identified by Yamanaka et al., and confirmed by Jaenisch et al. as a factor useful for the generation of mouse iPSCs (Jaenisch, Science, 240:1468-1474, 1998), and was demonstrated by Yamanaka et al. as a factor useful for the generation of human iPSCs (Kazutoshi Takahashi, et al., Cell, 131:1-12, 2007). Klf2 and Klf4 are factors capable of generating iPSCs, and related genes Klf1 and Klf5 do as well, although with reduced efficiency.
[0083] The Myc family of genes are proto-oncogenes implicated in cancer. It was demonstrated by Yamanaka et al. and Jaenisch et al. that c-Myc is a factor implicated in the generation of mouse iPSCs (Jaenisch, Science, 240: 1468-1474, 1998). Yamanaka et al. confirmed that c-Myc is a factor implicated in the generation of human iPSCs. However, c-Myc is unnecessary for the generation of human iPSCs. n-Myc and L-Myc have been identified to induce the generation of iPSCs with an efficiency similar to c-Myc.
[0084] Jhdm1b is a member of the family of JmjC-domain-containing histone demethylase (JHDM) that is evolutionarily conserved and widely expressed. It is also called Fbx110.
[0085] Glis1 is a Gli-like transcription factor 1 (Glis family zinc finger 1), which is enriched in unfertilized oocytes and in embryos at the single cell stage. Glis1 can promote multiple early steps of reprogramming and promote the formation of induced pluripotent stem cells in place of c-Myc.
[0086] Sall4 is a sal-like gene 4 (sal-like4, SALL4) located at chromosome 20q13.13-13.2. Its encoding protein is a transcription factor containing eight zinc finger motifs. Sall4 gene plays a key role in early embryonic development, organ formation as well as embryonic stem cell proliferation and pluripotency maintenance.
[0087] Lrh1, a member of the subfamily of nuclear receptors FTZ-F1, can replace Oct4.
[0088] Id1, a downstream factor of bone morphogenetic protein (BMP), can promote the reprogramming of somatic cells in Oct4 and Sox2 2-factor system.
[0089] Esrrb is a protein of the family of orphan receptors, which plays an important role in embryonic stem cells. Specifically, silent Esrrb may lead to differentiation of embryonic stem cells in the presence of LIF (leukocyte inhibitory factor). In addition, proteomics research finds that Esrrb may have protein-protein interaction with Nanog.
[0090] Lef1, lymphoid enhancer-binding factor 1, is a nuclear protein having a molecular weight of 48 kD and expressed in B and T precusor cells. Lef1 binds to functionally important sites in T-cell receptor (TCRA) enhancer and presents highest enhancer activity. Lef1 belongs to regulatory protein family homologous to high mobility group protein-1 (HMG1).
[0091] Utf1, undifferentiated embryonic cell transcription factor 1, is highly expressed in stem cells and located in nucleus. Utf1 may adjust chromatin state of stem cells and inhibit differentiation of stem cells.
[0092] miRNA C represents miRNA gene cluster 302-367. miRNA gene cluster improves the reprogramming efficiency of somatic cells by accelerating the conversion of mesenchymal cells to epithelial cells (B. Liao et al., J Biol Chem, 286 (19): 17359-17364, 2011).
[0093] A variety of pluripotent factors have been known to a person skilled in the art. Preferably, the pluripotent factors include Oct4, Sox2, c-Myc, Klf4, Esrrb, Nanog and Lin28. The aforementioned pluripotent factors may be derived from any source according to the cells to be introduced. Preferable pluripotent factors are mouse pluripotent factors and variants thereof, for example, Sox2, NCBI accession number: NM_011443.3; Oct4, NCBI accession number: NM_013633.2; Klf4, NCBI accession number: NM_010637.2; c-Myc, NCBI accession number: NM_010849.4; Nanog, NCBI accession number: NM_028016; Lin28, NCBI accession number: NM_145833. c-Myc may be replaced by its mutant L-myc (NCBI accession number: NM_008506.2) or N-Myc (NCBI accession number: NM_008709.3).
Method for Introducing into Cells a Factor or Composition for Promoting the Reprogramming of Somatic Cells
[0094] iPSCs are typically prepared by transfection of certain stem cell-associated genes into non-pluripotent cells (such as fibroblasts). Transfection is typically achieved through integrating viral vectors in the current practice, such as retroviruses. Transfected genes include the master transcriptional regulators (such as Oct3/4 and Sox). After a critical period in transfection, small number of transfected cells begin to become morphologically and biochemically similar to pluripotent stem cells, and are typically isolated through morphological selection, doubling time, or through a reporter gene and antibiotic infection.
[0095] In 2007, iPSCs were inductively generated from adult somatic cells by each of the two research groups Yamanaka and Junying YU, respectively. Yamanaka's research group had successfully transformed human fibroblasts into induced pluripotent stem cells using four pivotal genes Oct3/4, Sox2, Klf4 and c-Myc with a retroviral system. Junying Yu's research group had successfully transformed human fibroblasts into induced pluripotent stem cells using Oct4, Sox2, Nanog and Lin28 with a lentivirus system.
[0096] In some embodiments, the reprogramming vector may be a viral vector, for example, a retroviral vector, to express these reprogramming factors in cells.
Vectors
[0097] One of skill in the art would be well equipped to construct a vector through standard recombinant techniques (see, for example, Sambrook and Russell, Molecular Cloning: A Laboratory Manual 3rd Ed., Cold Spring Harbor Laboratory Press, 2001; and Ausubel et al., Current Protocols in Molecular Biology, GreenePubl. Assoc. Inc. & John Wiley & Sons, Inc., MA, 1994). Vectors include but are not limited to, plasmids, cosmids, viruses (bacteriophage, animal viruses, and plant viruses), and artificial chromosomes (e.g., YACs), wherein virus vectors include retroviral vectors (e.g. vectors derived from Moloney Murine Leukemia Virus (MoMLV), MSCV, SFFV, MPSV, SNV etc.), lentiviral vectors (e.g. vectors derived from HIV-1, HIV-2, SIV, BIV, FIV etc.), adenoviral (Ad) vectors (including replication competent, replication deficient and gutless forms thereof), adeno-associated viral (AAV) vectors, simian virus 40 (SV-40) vectors, bovine papilloma virus vectors, Epstein-Barr virus, herpes virus vectors, vaccinia virus vectors, Harvey murine sarcoma virus vectors, murine mammary tumor virus vectors, and Rous sarcoma virus vectors.
[0098] In some embodiments, the vector is a viral vector. Retroviral and lentiviral vectors have been successfully used in reprogramming somatic cells. Viral vectors can efficiently transduce cells and introduce their own DNA into a host cell. Viral vectors are a kind of expression construct that utilizes viral sequences to introduce nucleic acid into a cell. The ability of certain viruses to infect cells or enter cells via receptor-mediated endocytosis, and to integrate into host cell genome and express viral genes stably and efficiently has made them attractive candidates for the transfer of exogenous nucleic acids into cells (e.g., mammalian cells). Non-limiting examples of vectors that may be used to deliver a composition or factor combination for preparing iPSCs of the present invention are described below.
a. Retrovirus Vectors
[0099] Retroviruses have promise as gene delivery vectors due to their ability to integrate their genes into the host genome, to transfer a large amount of foreign genetic material, to infect a broad spectrum of species and cell types and to be packaged in special cell-lines.
[0100] In order to construct a retroviral vector, a nucleic acid is inserted into the viral genome in the place of certain viral sequences to produce a virus that is replication-defective. In order to produce virions, a packaging cell line containing the gag, pol, and env genes but without the LTR and packaging components is constructed. When a recombinant plasmid containing a cDNA, together with the retroviral LTR and packaging sequences is introduced into a special cell line (e.g., by calcium phosphate precipitation for example), the packaging sequence allows the RNA transcript of the recombinant plasmid to be packaged into viral particles, which are then secreted into the culture media. The media containing the recombinant retroviruses is then collected, optionally concentrated, and used for gene transfer. Retroviruses are able to infect a broad variety of cell types.
b. Lentiviral Vectors
[0101] Lentiviruses are complex retroviruses, which, in addition to the common retroviral genes gag, pol, and env, also contain other genes with regulatory or structural function. Lentiviral vectors are well known in the art, see for example U.S. Pat. No. 6,013,516 and No. 5,994,136.
[0102] Recombinant lentiviral vectors are capable of infecting non-dividing cells and can be used for both in vivo and ex vivo gene transfer and expression of nucleic acid sequences. For example, recombinant lentivirus capable of infecting a non-dividing cell wherein a suitable host cell is transfected with two or more vectors carrying the genes with packaging functions (i.e., gag, pol and env), as well as rev and tat is described in U.S. Pat. No. 5,994,136.
c. RNA Virus Vectors
[0103] The virus vectors of the present invention can also be constructed by RNA viruses, including single-stranded RNA (ssRNA) viruses and double-stranded RNA (dsRNA) viruses. In some embodiments, the virus is a dsRNA virus, including, but not limited to: Infectious pancreatic necrosis virus, Infectious bursal disease virus, Helminthosporium victoriae virus, Cystovirus, Hypovirus, Partitivirus, Alphacryptoviruses, Betacryptoviruses, Rotavirus, and etc. In some embodiments, the virus is a ssRNA virus, including, but not limited to: Coronavirus, SARS, Okavirus, Himetobi P virus, Plautia stali intestine virus, Rhopalosiphum padi virus, Homalodisca coagulata virus 1 (HoCV-1), Acheta domesticus virus, Marnavirus, Enterovirus, Rhinovirus, Poliovirus, the common cold virus, Hepatitis A virus, Encephalomyocarditis virus, Parechovirus, Equine rhinitis B virus, Seneca Valley virus, Poliovirus, Cheravirus, Sadwavirus, Sequivirus, Torradovirus, Waikavirus, Nepovirus, Black raspberry necrosis virus, Norwalk virus, Yellow fever virus, West Nile virus, Hepatitis C virus, Dengue fever virus, Betatetravirus, Omegatetravirus, Rubella virus, Ross River virus, Sindbis virus, Chikungunya virus, Hepatitis E virus, Herpesvirus, Ebola virus, Marburg virus, Measles virus, Mumps virus, Nipah virus, Hendra virus, Rabies virus, Ippy virus, Lassa virus, Lujo virus, Lymphocytic choriomeningitis virus, Mobala virus, Mopeia virus, Amapari virus, Chapare virus, Flexal virus, Guanarito virus, Junin virus, Latino virus, Machjupo virus, Oliveros virus, Parana virus, Pichinde virus, Pirital virus, Sabia virus, Tacaribe virus, Tamiami virus, Whitewater Arroyo virus, Hantaan virus, Dugbe virus, Bunyamwera virus, Rift Valley fever virus, Influenzavirus, Isavirus, Thogotovirus, Hepatitis D virus, Hepatitis B virus, and etc.
Regulating Elements
[0104] Vectors can also comprise other components or functionalities that further modulate gene delivery and/or gene expression, or that provide beneficial properties to the targeted cells. Such other components include, for example, components that influence binding or targeting to cells (including components that mediate cell-type or tissue-specific binding); components that influence uptake of the vector nucleic acid by the cell; components that influence localization of the polynucleotide within the cell after uptake (such as agents mediating cell localization); and components that influence expression of the polynucleotide.
[0105] Eukaryotic cell expression cassettes included in the vectors preferably contain (in a 5-to-3 direction) a eukaryotic cell transcriptional promoter operatively linked to a protein-encoding sequence, splice signals (including intervening sequences), and a transcriptional termination/polyadenylation sequence.
Promoters/Enhancers
[0106] A promoter is a control sequence that is a region of a nucleic acid sequence at which initiation and rate of transcription are controlled. It may contain genetic elements at which regulatory proteins and molecules may bind, such as RNA polymerase and other transcription factors, to initiate the specific transcription of a nucleic acid sequence. The phrases operatively positioned, operatively linked, under the control of . . . , and under the transcriptional control of . . . mean that a promoter is in a correct functional location and/or orientation in relation to a nucleic acid sequence to control transcriptional initiation and/or expression of that sequence.
[0107] A promoter generally comprises a sequence that functions to position the start site for RNA synthesis. The best known example of this is the TATA box, but in some promoters lacking a TATA box, such as, for example, the promoter for the mammalian terminal deoxynucleotidyl transferase gene and the promoter for the SV40 late genes, a discrete element overlying the start site itself helps to fix the place of initiation. Additional promoter elements regulate the frequency of transcriptional initiation. Typically, these are located in the region 30-110 bp upstream of the start site, although a number of promoters have been shown to contain functional elements downstream of the start site as well. To bring an encoding sequence under the control of a promoter, one positions the 5 end of the transcription initiation site of the transcriptional reading frame downstream (i.e., 3 end) of the chosen promoter. The upstream promoter stimulates transcription of the DNA and promotes expression of the encoded RNA.
[0108] The spacing between promoter elements frequently is flexible, so that promoter function is preserved when elements are inverted or moved relative to one another. In the tk promoter, the spacing between promoter elements can be increased to 50 bp apart before activity begins to decline. Depending on the promoter, it appears that individual elements can function either cooperatively or independently to activate transcription. A promoter may or may not be used in conjunction with an enhancer, which refers to a cis-acting regulatory sequence involved in the transcriptional activation of a nucleic acid sequence.
[0109] A promoter may be one naturally associated with a nucleic acid sequence, as may be obtained by isolating the 5 non-coding sequences located upstream of the encoding segment and/or exon. Such a promoter can be referred to as endogenous. Similarly, an enhancer may be one naturally associated with a nucleic acid sequence, located either downstream or upstream of that sequence. Alternatively, certain advantages will be gained by positioning the encoding nucleic acid segment under the control of a recombinant or heterologous promoter, which refers to a promoter that is not normally associated with a nucleic acid sequence in its natural environment. A recombinant or heterologous enhancer refers also to an enhancer not normally associated with a nucleic acid sequence in its natural environment. Such promoters or enhancers may include promoters or enhancers of other genes, and promoters or enhancers isolated from any other virus, or prokaryotic or eukaryotic cell, and promoters or enhancers not naturally occurring, i.e., containing different elements of different transcriptional regulatory regions, and/or mutations that alter expression. For example, promoters that are most commonly used in recombinant DNA construction include the -lactamase (penicillinase), lactose and tryptophan (trp) promoter systems. In addition to producing nucleic acid sequences of promoters and enhancers synthetically, sequences may be produced using recombinant cloning and/or nucleic acid amplification technology, for example PCR. Furthermore, the control sequences that direct transcription and/or expression of sequences within non-nuclear organelles (such as mitochondria, chloroplasts, and the like), can be employed as well.
[0110] Naturally, it will be important to employ a promoter and/or enhancer that effectively directs the expression of the DNA segment in the organelle, cell type, tissue, organ, or organism chosen for expression. Those of skill in the art of molecular biology generally know promoters, enhancers, and cell type for protein expression. The promoters employed may be constitutive, tissue-specific, inducible, and/or useful under the appropriate conditions to direct high level expression of the introduced DNA segment, which is advantageous in the large-scale production of recombinant proteins and/or peptides. The promoter may be heterologous or endogenous.
[0111] Additionally any promoter/enhancer combination (as per, for example, the Eukaryotic Promoter Data Base EPDB, http://www.epd.isb-sib. Ch/) could also be used to drive expression. Use of a T3, T7 or SP6 cytoplasmic expression system is another possible embodiment. Eukaryotic cells can support cytoplasmic transcription from certain bacterial promoters if the appropriate bacterial polymerase is provided (either as part of the delivery complex or as an additional genetic expression construct).
[0112] Non-limiting examples of promoters include early or late viral promoters, such as, SV40 early or late promoters, cytomegalovirus (CMV) immediate early promoters, Rous sarcoma virus (RSV) early promoters; eukaryotic cell promoters, such as, e. g., beta actin promoter (Ng, Nuc. Acid Res., 17:601-615, 1989, Quitsche et al., 1989), GADPH promoter (Alexander et al., Proc. Nat. Acad. Sci. USA, 85:5092-5096, 1998; Ercolani et al., J. Biol. Chem., 263:15335-15341, 1988), metallothionein promoter (Karin et al. Cell, 36: 371-379, 1989; Richards et al., Cell, 37: 263-272, 1984); and concatenated response element promoters, such as cyclic AMP response element promoters (ere), serum response element promoter (sre), phorbol ester promoter (TPA) and response element promoters (tre) near a minimal TATA box. It is also possible to use human growth hormone promoter sequences (e.g., the human growth hormone minimal promoter described at Genbank, Accession No. X05244, nucleotide 283-341) or a mouse mammary tumor promoter (available from the ATCC, Cat. No. ATCC 45007). A specific example could be a phosphoglycerate kinase (PGK) promoter.
Initiation Signals
[0113] A specific initiation signal also may be required for efficient translation of encoding sequences. These signals include the ATG initiation codon or adjacent sequences. Exogenous translational control signals, including the ATG initiation codon, may need to be provided. One of ordinary skill in the art would readily be capable of determining this and providing the necessary signals. It is well known that the initiation codon must be in-frame with the reading frame of the desired coding sequence to ensure translation of the entire insert. The exogenous translational control signals and initiation codons can be either natural or synthetic. The efficiency of expression may be enhanced by the inclusion of appropriate transcription enhancer elements.
Multiple Cloning Sites
[0114] Vectors can include a multiple cloning site (MCS), which is a nucleic acid region that contains multiple restriction enzyme sites, any of which can be used in conjunction with standard recombinant technology to digest the vector (see, for example, Carbonelli et al., FEMS Microbiol. Lett., 177 (1): 75-82, 1999; Levenson et al., Hum. Gene Ther, 9(8):1233-1236, 1998; Cocea, Biotechniques, 23(5):814-816, 1997, incorporated herein by reference). Restriction enzyme digestion refers to catalytic cleavage of a nucleic acid molecule with an enzyme that functions only at specific locations in a nucleic acid molecule. Many of these restriction enzymes are commercially available. Use of such enzymes is widely understood by those of skill in the art. Generally, a vector is linearized or fragmented using a restriction enzyme that cuts within the MCS to enable exogenous sequences to be ligated into the vector. Ligation refers to the process of forming phosphodiester bonds between two nucleic acid fragments, which may or may not be contiguous with each other. Techniques involving restriction enzymes and ligation reactions are well known to those of skill in the art of recombinant technology.
Splicing Sites
[0115] Most transcribed eukaryotic RNA molecules will undergo RNA splicing to remove introns from the primary transcripts. Vectors containing genomic eukaryotic sequences may require donor and/or receptor splicing sites to ensure proper processing of the transcript for protein expression (see, for example, Chandler et al., Proc. Natl. Acad. Sci. USA, 94 (8): 3596-601, 1997, herein incorporated by reference.)
Termination Signals
[0116] The vectors or constructs of the present invention may require at least one termination signal. A termination signal or terminator is comprised of the DNA sequences involved in specific termination of an RNA transcript by an RNA polymerase. Thus, in certain embodiments a termination signal that ends the production of an RNA transcript is involved. A terminator may be necessary in vivo to achieve desirable message levels.
[0117] In eukaryotic systems, the terminator region may also comprise specific DNA sequences that permit site-specific cleavage of the new transcript so as to expose a polyadenylation site. This signals a specialized endogenous polymerase to add a stretch of about 200 A residues (polyA) to the 3 end of the transcript. RNA molecules modified with this polyA tail appear more stable and are translated more efficiently. Thus, in other embodiments involving eukaryotes, it is preferred that terminator comprises a signal for the cleavage of the RNA, and it is more preferred that the terminator signal promotes polyadenylation of the message. The terminator and/or polyadenylation site elements can serve to enhance message levels and to minimize read through from the cassette into other sequences.
[0118] Terminators contemplated for use in the present invention include any known terminator of transcription described herein or known to one of ordinary skill in the art, including but not limited to, for example, the termination sequences of genes, such as the bovine growth hormone terminator or viral termination sequences, such as the SV40 terminator. In certain embodiments, the termination signal may be a lack of transcribable or translatable sequence, such as due to a sequence truncation.
Polyadenylation Signals
[0119] In expression, particularly eukaryotic expression, one will typically include a polyadenylation signal to effect proper polyadenylation of the transcript. Preferred embodiments include the SV40 polyadenylation signal or the bovine growth hormone polyadenylation signal. Polyadenylation may increase the stability of the transcript or may facilitate cytoplasmic transport.
Vector Delivery
[0120] Introduction of a reprogramming vector into somatic cells with the present invention may use any suitable methods for nucleic acid delivery for transformation of a cell, as described herein or as would be known to one of ordinary skill in the art. Such methods include, but are not limited to, direct delivery of DNA, such as by ex vivo transfection (Wilson et al., Science, 244:1344-1346, 1989; Nabel et al, 1989), by injection (U.S. Pat. Nos. 5,994,624, 5,981,274, 5,945,100, 5,780,448, 5,736,524, 5,702,932, 5,656,610, 5,589,466 and 5,580,859, each incorporated herein by reference), including microinjection (Harland and Weintraub, J. Cell Biol, 101 (3): 1094-1099, 1985; U.S. Pat. No. 5,789,215, incorporated herein by reference); by electroporation (U.S. Pat. No. 5,384,253, incorporated herein by reference; Tur-Kaspa et al., Mol. Cell Biol. 6:716-718, 1986; Potter et al., Proc. Natl. Acad. Sci. USA, 81:7161-7165, 1984); by calcium phosphate precipitation (Graham and Van Der Eb, Virilogy, 52:456-467, 1973; Chen and Okayama, Mol. Cell Biol., 7 (8): 2745-2752, 1987; Rippe et al., Mol. Cell Biol. 10:689-695, 1990); by using DEAE-dextran followed by polyethylene glycol (Gopal, Mol. Cell Biol., 5:1188-1190, 1985); by direct sonic loading (Fechheimer et al., Proc Natl. Acad. Sci. USA. 84: 8463-8467, 1987); by liposome mediated transfection (Nicolau and Sene, Biochim. Biophys. Acta, 721:185-190, 1982; Fraley et al., Proc. Natl. Acad. Sci. USA, 76:3348-3352, 1979; Nicolau et al., Methods Enzymol., 149:157-176, 1987; Wong et al., Gene, 10:87-94, 1980; Kaneda et al., Science, 243:375-378, 1989; Kato et al., J. Biol. Chem., 266:3361-3364, 1991) and receptor-mediated transfection (Wu and Wu, Biochemistry, 27:887-892, 1988; Wu and Wu, J. Biol. Chem., 262:4429-4432, 1987); by microprojectile bombardment (PCT Application Nos. WO 94/09699 and WO 95/06128; U.S. Pat. Nos. 5,610,042; 5,322,783, 5,563,055, 5,550,318, 5,538,877 and 5,538,880, each incorporated herein by reference); by agitation with silicon carbide fibers (Kaeppier et al., Plant Cell Reports, 9:415-418, 1990; U.S. Pat. No. 5,302,523 and No. 5,464,765, each incorporated herein by reference); by agrobacterium-mediated transformation (U.S. Pat. Nos. 5,591,616 and 5,563,055, each incorporated herein by reference); by PEG-mediated transformation of protoplasts (Omirulleh et al., Plant Mol. Biol., 21 (3): 415-428, 1993; U.S. Pat. No. 4,684,611 and No. 4,952,500, each incorporated herein by reference); by desiccation/inhibition-mediated DNA uptake (Potrykus et al., Mol. Gen. Genet., 199 (2): 169-177, 1985), and any combination of such methods. Through the application of the above-mentioned techniques and the like, organelle(s), cell(s), tissue(s) or organism(s) may be stably or transiently transformed.
Liposome-Mediated Transfection
[0121] In some embodiments of the present invention, a nucleic acid may be entrapped in a lipid complex such as, a liposome. Liposomes are vesicular structures characterized by a phospholipid bilayer membrane and an inner aqueous medium. Multilamellar liposomes have multiple lipid layers separated by aqueous medium. They form spontaneously when phospholipids are suspended in an excess of aqueous solution. The lipid components undergo self-rearrangement before the formation of closed structures and entrap water and dissolved solutes between the lipid bilayers (Ghosh and Bachhawat, Gopal, 1985). Also contemplated is a nucleic acid complexed with Lipofectamine (Gibco BRL) or Superfect (Qiagen). The amount of liposomes used may vary upon the nature of the liposome as well as the cell used, for example, about 5 to about 20 g vector DNA/1-1010.sup.6 cells may be contemplated.
[0122] Liposome-mediated nucleic acid delivery and expression of exogenous DNA in vitro has been very successful (Nicolau and Sene, 1982; Fraley et al., 1979; Nicolau et al., 1987). The feasibility of liposome-mediated delivery and expression of exogenous DNA in cultured chick embryo, HeLa and hepatoma cells has also been demonstrated (Wong et al., Gene, 10:87-94, 1980).
[0123] In certain embodiments of the present invention, a liposome may be complexed with a hemagglutinating virus (HVJ). This has been shown to facilitate fusion with the cell membrane and promote cell entry of liposome-encapsulated DNA (Kaneda et al., 1989). In other embodiments, a liposome may be complexed or employed in conjunction with nuclear non-histone chromosomal proteins (HMG-I) (Kato et al., J. Biol. Chem., 266:3361-3364, 1991). In yet further embodiments, a liposome may be complexed or employed in conjunction with both HVJ and HMG-I. In other embodiments, a delivery vehicle may comprise a ligand and a liposome.
Electroporation
[0124] In certain embodiments of the present invention, a nucleic acid is introduced into a cell via electroporation. Electroporation involves the exposure of a suspension of cells and DNA to a high-voltage electric discharge. Recipient cells can be made more susceptible to transformation by mechanical wounding. Also the amount of vectors used may vary upon the nature of the cells used, for example, about 5 g to about 20 g vector DNA/1-1010.sup.6 cells.
[0125] Transfection of eukaryotic cells using electroporation has been quite successful. Mouse pre-B lymphocytes have been transfected with human kappa-immunoglobulin genes (Potter et al., 1984), and rat hepatocytes have also been transfected with chloramphenicol acetyltransferase genes in this manner (TurKaspa et al., 1986).
Calcium Phosphate
[0126] In other embodiments of the present invention, a nucleic acid is introduced into the cells using calcium phosphate precipitation. Human KB cells have been transfected with adenovirus 5DNA using this technique (Grahamand Van Der Eb, 1973). Also in this manner, mouse L(A9), mouse C127, CHO, CV-1, BHK, NIH3T3 and HeLa cells were transfected with a neomycin marker gene (Chen and Okayama, 1987), and rat hepatocytes were transfected with a variety of marker genes (Rippe et al., 1990).
DEAE-Dextran
[0127] In other embodiments, a nucleic acid is delivered into a cell using DEAE-dextran followed by polyethylene glycol. In this manner, reporter molecule plasmids have been introduced into mouse myeloma and erythroleukemia cells (Gopal, 1985).
Sonication Loading
[0128] Additional embodiments of the present invention include the introduction of a nucleic acid by direct sonic loading. LTK-fibroblasts have been transfected with the thymidine kinase gene by sonication loading (Fechheimer et al., 1987).
Receptor-Mediated Transfection
[0129] In addition, a nucleic acid may be delivered to a target cell via receptor-mediated delivery vehicles. These take advantage of the selective uptake of macromolecules by receptor-mediated endocytosis that will be occurring in a target cell. In view of the cell type-specific distribution of various receptors, this delivery method adds another degree of specificity to the present invention.
[0130] Some receptor-mediated gene targeting vesicles comprise a cell receptor-specific ligand and a nucleic acid-binding agent. Others comprise a cell receptor-specific ligand to which the nucleic acid to be delivered has been operatively attached. Several ligands have been used for receptor-mediated gene transfer (Wagner et al., Proc. Natl. Acad. Sci. USA 87(9):3410-3414, 1990. Perales et al., Proc. Natl. Acad. Sci. USA, 91:4086-4090, 1994; Myers, EPO 273085), which establishes the operability of the technique. Specific delivery in the context of another mammalian cell type has been described (Wu and Wu, Adv. Drug Delivery Rev., 12:159-167, 1993; incorporated herein by reference). In certain aspects of the present invention, a ligand will be chosen to correspond to a receptor specifically expressed on the target cell population.
[0131] In other embodiments, a nucleic acid delivery vehicle component of a cell-specific nucleic acid targeting vesicle may comprise a specific binding ligand in combination with a liposome. The nucleic acid(s) to be delivered are housed within the liposome and the specific binding ligand is functionally incorporated into the liposome membrane. The liposome will thus specifically bind to the receptor(s) of a target cell and deliver the contents to a cell. Such systems have been shown to be functional using systems in which, for example, epidermal growth factor (EGF) is used in the receptor-mediated delivery of a nucleic acid to cells that exhibit upregulation of the EGF receptor.
[0132] In other embodiments, the nucleic acid delivery vehicle component of a targeted delivery vehicle may be a liposome itself, which will preferably comprise one or more lipids or glycoproteins that direct cell-specific binding. For example, lactosyl-ceramide, a galactose-terminal ganglioside, has been incorporated into liposomes and an increase in the uptake of the insulin gene by hepatocytes has been observed (Nicolau et al., 1987). It is contemplated that the tissue-specific transforming constructs of the present invention can be specifically delivered into a target cell in a similar manner.
Microprojectile Bombardment
[0133] Microprojectile bombardment techniques can be used to introduce a nucleic acid into at least one organelle, cell, tissue or organism (U.S. Pat. No. 5,550,318; U.S. Pat. No. 5,538,880; U.S. Pat. No. 5,610,042; and PCT Application WO 94/09699; each of which is incorporated herein by reference). This method depends on the ability to accelerate DNA-coated microprojectiles to a high velocity allowing them to pierce cell membranes and enter cells without killing them (Klein et al., Nature, 327:70-73, 1987). There are a wide variety of microprojectile bombardment techniques known in the art, many of which are applicable to the present invention.
[0134] In this microprojectile bombardment, one or more particles may be coated with at least one nucleic acid and delivered into cells by a propelling force. Several devices for accelerating small particles have been developed. One such device relies on a high voltage discharge to generate an electrical current, which in turn provides the motive force (Yang et al., 1990). The microprojectiles used have consisted of biologically inert substances such as tungsten or gold particles or beads. Exemplary particles include those comprised of tungsten, molybdenum, and preferably, gold. In some instances DNA precipitation onto metal particles would not be necessary for DNA delivery to a recipient cell using microprojectile bombardment. On the other hand, particles may contain DNA rather than be coated with DNA. DNA-coated particles may increase the level of DNA delivery via particle bombardment but are not, in and of themselves, necessary.
[0135] For the bombardment, cells in suspension are concentrated on filters or solid culture medium. Alternatively, immature embryos or other target cells may be arranged on solid culture medium. The cells to be bombarded are positioned at an appropriate distance below the microprojectile stopping plate.
[0136] In addition, in the method of the present invention, iPSCs can also be prepared by transfecting certain stem cell associated genes into non-pluripotent cells (e.g., fibroblasts) with a non-viral vector. Examples of said non-viral vector include the oligonucleotide alone or in combination with a suitable protein, polysaccharide or lipid formulation.
[0137] The term oligonucleotide refers to an oligomer or polymer of ribonucleic acid (RNA) or deoxyribonucleic acid (DNA) or mimetics thereof. The term oligonucleotide includes linear or circular oligomers of natural and/or modified monomers or linkages, including deoxyribonucleosides, ribonucleosides, substituted and alpha-anomeric forms thereof, peptide nucleic acids (PNA), linked nucleic acids (LNA), phosphorothioate, methylphosphonate, and the like. Oligonucleotides are capable of specifically binding to a target polynucleotide by way of a regular pattern of monomer-to-monomer interactions, such as Watson-Crick type of base pairing, Hosteen or reverse Hogsteen types of base pairing, or the like. The oligonucleotide may be chimeric, that is, composed of different regions. Chimeric oligonucleotides or chimeras, in the context of this invention, are oligonucleotides which contain two or more chemically distinct regions, each made up of at least one nucleotide. These oligonucleotides typically contain at least one region of modified nucleotides that confers one or more beneficial properties (such as, for example, increased nuclease resistance, increased uptake into cells, increased binding affinity for the RNA target) and a region that is a substrate for enzymes capable of cleaving RNA:DNA or RNA:RNA hybrids.
[0138] Non-viral vectors mainly include modified natural polymers and synthetic polymers. Modified natural polymers are mainly lipids (such as sterols), polysaccharides (such as chitosan, dextran and algal acid), proteins (such as collagen, protamine, etc.) and polypeptide substances. Synthetic polymers are mainly some biologically degradable polymers (such as polylysine, polylactic acid, polyvinyl alcohol and block or graft copolymer thereof, etc.) and cationic polymers (polyethylene imine, polyamide dendritic polymer, etc.). The modified natural polymers and synthetic polymers act as delivery vector which encapsulates DNA in the form of microspheres, vesicles or glue beam respectively and releases DNA upon arrival at the pathological site.
Selection of iPSCs
[0139] In some aspects of the present invention, after a reprogramming vector is introduced into somatic cells, these cells will be cultured for expansion. Cells could be selected for the presence of vector elements (like reporters or selection markers) to concentrate transfected cells. Reprogramming vectors will express reprogramming factors in these cells and replicate and partition along with cell division. These expressed reprogramming factors will induce somatic cell genome to reprogram so as to establish a self-sustaining pluripotent state, and in the meantime or after removal of positive selection of the presence of vectors, exogenous genetic elements will be lost gradually. This silencing of transgene expression permits selection of induced pluripotent stem cells for tuning off reporter gene expression alone or in combination with selection for other embryonic stem cell characteristics because they are expected to be substantially identical to pluripotent embryonic stem cells.
[0140] As used herein, the term stem cell refers to a cell capable of self replication and having pluripotency. Typically, stem cells can regenerate an injured tissue. Stem cells herein may be, but are not limited to, embryonic stem (ES) cells or tissue stem cells (also called tissue-specific stem cell, or adult stem cell). Embryonic stem (ES) cells are pluripotent stem cells derived from early embryos. An ES cell was first established in 1981, which has also been applied to production of knockout mice since 1989. In 1998, a human ES cell was established, which is currently becoming available for regenerative medicine. Unlike ES cells, tissue stem cells have a limited differentiation potential. Tissue stem cells are present at particular locations in tissues and have an undifferentiated intracellular structure. Therefore, the pluripotency of tissue stem cells is typically low. Tissue stem cells have a higher nucleus/cytoplasm ratio and have few intracellular organelles. Most tissue stem cells have low pluripotency, a long cell cycle, and proliferative ability beyond the life of the individual. Tissue stem cells are separated into various categories, based on the sites from which the cells are derived, such as the dermal system, the digestive system, the bone marrow system, the nervous system, and the like. Tissue stem cells in the dermal system include epidermal stem cells, hair follicle stem cells, and the like. Tissue stem cells in the digestive system include pancreatic (common) stem cells, liver stem cells, and the like. Tissue stem cells in the bone marrow system include hematopoietic stem cells, mesenchymal stem cells, and the like. Tissue stem cells in the nervous system include neural stem cells, retinal stem cells, and the like.
[0141] Induced pluripotent stem cells used herein, commonly abbreviated as iPSCs, refer to a type of pluripotent stem cell artificially prepared from a non-pluripotent cell, typically an adult somatic cell, or terminally differentiated cell, such as fibroblast, a hematopoietic cell, a myocyte, a neuron, an epidermal cell, or the like, by inserting certain genes, referred to as reprogramming factors. Pluripotency used herein refers to a stem cell that has the potential to differentiate into all cells constituting one or more tissues or organs, or preferably, any of the three germ layers: endoderm (interior stomach lining, gastrointestinal tract, the lungs), mesoderm (muscle, bone, blood, urogenital), or ectoderm (epidermal tissues and nervous system). Pluripotent stem cells used herein refer to cells that can differentiate into cells derived from any of the three germ layers, for example, descendants of totipotent cells or induced pluripotent cells.
Reporter Genes
[0142] Certain embodiments of the present invention utilize reporter genes to indicate successful transformation. For example, the reporter gene can be located within expression cassettes and under the control of the regulatory elements normally associated with the encoding region of a reprogramming gene for simultaneous expression. A reporter molecule allows the cells containing the reprogramming vector to be isolated without placing them under drug or other selective pressures or otherwise risking cell viability. An additional advantage is to enrich induced pluripotent stem cells with silenced reporter molecule expression.
[0143] Examples of such reporters include genes encoding cell surface proteins (e.g., CD4, HA epitope), fluorescent proteins, antigenic determinants and enzymes (e.g., galactosidase). The vector containing cells may be isolated, e.g., by FACS using fluorescently-tagged antibodies to the cell surface protein or substrates that can be converted to fluorescent products by a vector encoded enzyme.
[0144] In specific embodiments, the reporter gene is a fluorescent protein. A broad range of fluorescent protein genetic variants have been developed whose feature fluorescence emission spectral profiles span almost the entire visible light spectrum. Mutagenesis in the original Aequorea victoria jellyfish green fluorescent protein has resulted in new fluorescent probes that range in color from blue to yellow, and are some of the most widely used in vivo reporter molecules in biological research. Longer wavelength fluorescent proteins, emitting in the orange and red spectral regions, have been developed from the marine anemone, and reef corals belonging to the class Anthozoa. Still other species have been mined to produce similar proteins having cyan, green, yellow, orange, and deep red fluorescence emission. Developmental research efforts are ongoing to improve the brightness and stability of fluorescent proteins, thus improving their overall usefulness.
Selection of iPSCs Based on Reporter Genes Expression
[0145] Cells introduced with a reprogramming factor combination in this invention could express a reporter molecule and a reprogramming factor simultaneously and selected for the presence or absence of reporter gene expression in different time points. For example, cells could be selected for the presence of reporter genes and transfection could be optimized by using reporter genes. Induced pluripotent stem cells may be screened for the loss of reporter genes as transgenes are silenced during reprogramming. Such selection or screening is based on a detectable signal generated by expression of reporter genes as an indication of transgene expression.
[0146] A detectable signal may be generated in any one of a number of ways, depending on the nature of the reporter gene employed in the method of the present invention. For example, the detectable signal may be a luminescent, such as a fluorescent signal, e.g., GFP. GFP is a fluorescent polypeptide which produces a fluorescent signal without the need for a substrate or cofactors. GFP expression and detection techniques are well known in the art, and kits are available commercially, for example from Clontech. GFP expression may be assayed in intact cells without the need to lyse them or to add further reagents. Alternatively, the detectable signal may be a signal generated as a result of enzymatic activity or the recognition of a cell surface marker, e.g., LNGFR.
[0147] Flow cytometry, for example, fluorescence-activated cell sorting (FACS), is commonly used to select detectable signals based on reporter gene expression. FACS provides a method for sorting a heterogeneous mixture of cells into two or more containers, one cell at a time, based upon the specific light scattering and fluorescent characteristics of each cell. This provides fast, objective and quantitative recording of fluorescent signals from individual cells as well as physical separation of induced pluripotent cells.
[0148] Luciferase may also be used as a basis for an assay. Luciferase expression is known in the art, and luciferase expression and detection kits are available commercially from Clontech (Palo Alto, Calif.). The presence of luciferase is advantageously assessed by cell lysis and addition of luciferin substrate to the cells, before monitoring a luminescent signal by scintillation counting.
[0149] Enzyme-based assays are conducted in a manner similar to a luciferase-based assay, except that the detection is not necessarily via luminescence. The detection technique will depend on the enzyme, and may therefore be optical (such as in the case of galactosidase).
[0150] Physical and biochemical methods may also be used to identify or quantify expression of the reporter genes of the present invention. These methods include but are not limited to: 1) Southern analysis or PCR amplification for detecting and determining the structure of the recombinant DNA insert; 2) Northern blot, S-IRNase protection, primer-extension or reverse transcriptase-PCR amplification for detecting and examining RNA transcripts of the gene constructs; 3) enzymatic assays for detecting enzyme activity, where such gene products are encoded by the gene construct; 4) protein gel electrophoresis, Western blot techniques, immunoprecipitation, or enzyme-linked immunoassays, where the gene construct products are proteins; and 5) biochemical measurements of compounds produced as a consequence of the expression of the introduced gene constructs. Additional techniques, such as in situ hybridization, enzyme staining, and immunostaining, may also be used to detect the presence or expression of the reporter gene in specific cells.
Selection for Embryonic Stem Cell Characteristics
[0151] The successfully generated iPSCs from previous studies were remarkably similar to naturally-isolated pluripotent stem cells (such as mouse and human embryonic stem cells, mESCs and hESCs, respectively) in the following respects, thus confirming the identity, authenticity, and pluripotency of iPSCs to naturally-isolated pluripotent stem cells. Thus, induced pluripotent stem cells generated from the methods disclosed in this invention could be selected based on one or more of following embryonic stem cell characteristics in addition to presence or absence of reporter gene expression.
a. Cellular Biological Properties
[0152] Morphology: iPSCs are morphologically similar to ESCs. Each cell may have round shape, large nucleolus and scant cytoplasm. Colonies of iPSCs could be also similar to that of ESCs. Human iPSCs form sharp-edged, flat, tightly-packed colonies similar to hESCs and mouse iPSCs form the colonies similar to mESCs, less flatter and more aggregated colonies than that of hESCs.
[0153] Growth properties: Doubling time and mitotic activity are cornerstones of ESCs, as stem cells must self-renew. iPSCs could be mitotically active, actively self-renewing, proliferating, and dividing at a rate equal to ESCs.
[0154] Stem Cell Markers: iPSCs may express cell surface antigenic markers expressed on ESCs. Human iPSCs expressed the markers specific to hESC, including, but not limited to, SSEA-3, SSEA-4, TRA-1-60, TRA-1-81, TRA-2-49/6E, and Nanog. Mouse iPSCs express SSEA-1 but not SSEA-3 nor SSEA-4, similarly to mESCs.
[0155] Stem Cell Genes: iPSCs may express genes expressed in undifferentiated ESCs, including Oct-3/4, Sox2, Nanog, GDF3, REX1, FGF4, ESG1, DPPA2, DPPA4, and hTERT.
[0156] Telomerase Activity: Telomerases are necessary to sustain cell division unrestricted by the Hayflick limit of 50 cell divisions. ESCs express high telomerase activity to sustain self-renewal and proliferation, and iPSCs also demonstrate high telomerase activity and express TERT (human telomerase reverse transcriptase), a necessary component in the telomerase protein complex.
[0157] Pluripotency: iPSCs will be capable of differentiation in a fashion similar to ESCs into fully differentiated tissues.
[0158] Neural Differentiation: iPSCs can be differentiated into neurons, expressing III-tubulin, tyrosine hydroxylase, AADC, DAT, ChAT, LMXIB, and MAP2. The presence of catecholamine-associated enzymes may indicate that iPSCs, like hESCs, may be differentiated into dopaminergic neurons. Stem cell-associated genes will be down-regulated after differentiation.
[0159] Cardiac Differentiation: iPSCs can be differentiated into cardiomyocytes that spontaneously begin beating. Cardiomyocytes express TnTc, MEF2C, MYL2A, MYHC0 and NKX2.5. Stem cell-associated genes will be down-regulated after differentiation.
[0160] Teratoma Formation: iPSCs injected into immunodeficient mice may spontaneously form teratomas after certain time, such as nine weeks. Teratomas are tumors of multiple lineages containing tissue derived from the three germ layers (endoderm, mesoderm and ectoderm); this is unlike other tumors, which typically are of only one cell type. Teratoma formation is a landmark test for pluripotency.
[0161] Embryoid Body: ESCs in culture spontaneously form ball-like embryo-like structures termed as embryoid bodies, which consist of a core of mitotically active and differentiating ESCs and a periphery of fully differentiated cells from all three germ layers. iPSCs may also form embryoid bodies and have peripheral differentiated cells.
[0162] Blastocyst Injection: ESCs naturally reside within the inner cell mass (embryoblast) of blastocysts, and in the embryoblast, differentiate into the embryo while the blastocyst's shell (trophoblast) differentiates into extraembryonic tissues. The hollow trophoblast is unable to form a living embryo, and thus it is necessary for the embryonic stem cells within the embryoblast to differentiate and form the embryo. iPSCs injected by micropipette into a trophoblast to generate a blastocyst transferred to recipient females, may result in chimeric living mouse pups: mice with iPSC derivatives incorporated all across their bodies with 10%-90% chimerism.
b. Epigenetic Reprogramming
[0163] Promoter Demethylation: Methylation is the transfer of a methyl group to a DNA base, typically the transfer of a methyl group to a cytosine molecule in a CpG site (adjacent cytosine/guanine sequence). Widespread methylation of a gene interferes with expression by preventing the activity of expression proteins or recruiting enzymes that interfere with expression. Thus, methylation of a gene effectively silences it by preventing transcription. Promoters of endogenous pluripotency-associated genes, including Oct-3/4, Rex1, and Nanog, may be demethylated in iPSCs, showing their promoter activity and the active promotion and expression of pluripotency-associated genes in iPSCs.
[0164] Histone Demethylation: Histones are compacting proteins that are structurally localized to DNA sequences that can effect their activity through various chromatin-related modifications. H3 histones associated with Oct-3/4, Sox2, and Nanog may be demethylated to activate the expression of Oct-3/4, Sox2, and Nanog.
Culturing of iPSCs
[0165] During the preparation of induced pluripotent stem cells in accordance with the method of the invention, induction reprogramming factors and the selection marker are expressed in the stage of cell culturing, after which the obtained cells are selected for the aforementioned cell biology properties and epigenetic properties. In some embodiments, the cells may be cultured for a period of time prior to the induction process. Alternatively, the cells may be induced and selected directly without a prior culture period. In some embodiments, different cell culture media are used at different points. For example, one type of culture medium may be used before the induction process, while a second type of culture medium is used during the induction process. At times, a third type of culture medium is used during the selection process.
[0166] After collecting cells from donor samples such as tissue or cellular samples, a suitable medium can be used according to different cell types or tissue types. Some representative media include but are not limited to: multipotent adult progenitor cell (MAPC) medium; FBM (manufactured by Lonza); embryonic stem cell (ESC) medium; mesenchymal stem cell growth medium (MSCGM) (manufactured by Lonza); MCDB202 modified medium; endothelial cell medium kit-2 (EBM2) (manufactured by Lonza); IMDM; DMEM; MEF-conditioned ES; and mTeSR.
[0167] In this invention, the culture media used for the induction of iPSs are mainly as follows:
[0168] mES culture medium: DMEM (High Glucose, Gibco)+15% FBS (Gibco)+1non-essential amino acid+1glutamine GlutaMAX (1, Gibco)+sodium pyruvate (1, Gibco)+penicillin/streptomycin (50 untis/ml P, 50 mg/ml S, Hyclone)+0.1 mM -mercaptoethanol+1000 u leukocyte inhibitory factor LIF (millipore).
[0169] Serum-free culture medium iSF1: the components contained in the medium and the amounts thereof have been disclosed in Chinese Patent Application No. CN200910038883.4 (PCT/CN2009/074358), which is incorporated herein by reference.
[0170] Chemically defined serum-free culture medium iCD1: the components contained in the medium and the amounts thereof have been disclosed in Chinese Patent Application No. 201010167062.3 and Rational optimization of reprogramming culture conditions for the generation of induced pluripotent stem cells with ultra-high efficiency and fast kinetics. Cell Res 21, 884-894.
[0171] MEF culture medium: comprising high glucose DMEM, 2 mM L-glutamine, 1non-essential amino acid.
[0172] ES culture medium: including the following types:
(1) mES culture medium: DMEM (High Glucose, Gibco)+15% FBS (Gibco)+1non-essential amino acid+2 mM glutamine GlutaMAX (1, Gibco)+sodium pyruvate (1, Gibco)+penicillin/streptomycin (50 untis/ml P, 50 mg/ml S, Hyclone)+0.1 mM -mercaptoethanol+1000 u leukocyte inhibitory factor (LIF) (millipore);
(2) mKSR culture medium: knock-out DMEM (Gibco)+15% KSR+1non-essential amino acid+2 mM glutamine GlutaMAX (1, Gibco)+penicillin/streptomycin (50 untis/ml P, 50 mg/ml S, Hyclone)+0.1 mM -mercaptoethanol+1000 u leukocyte inhibitory factor (LIF) (millipore);
(3) N2B27+2i culture medium: knock-out DMEM (Gibco)/DMEM (High Glucose, Gibco) (1/1)+N2 without serum additives (Gibco, 0.5)+B27 without serum additives (Gibco, 0.5)+1non-essential amino acid+2 mM glutamine GlutaMAX (1, Gibco)+penicillin/streptomycin (50 untis/ml P, 50 mg/ml S, Hyclone)+0.1 mM -mercaptoethanol+1000 u leukocyte inhibitory factor LIF (millipore)+3 M CHIR99021+1 M PD0325901.
[0173] Primary culture occurs immediately after the cells are isolated from a donor, e.g., human or mouse. The cells can also be sub-cultured after the primary culture. A second subculture describes subculturing primary culture cells once. In some cases, the primary cells are subjected to a subculture once (i.e., second subculture), or twice (i.e., third subculture). The culture techniques are well-known in the art. In the preferred embodiments of the present invention, cells are cultured from the primary culture to the second subculture. In some cases, the cells may be cultured for 1 to 12 days e.g., 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, and so on prior to induction. In other cases, the cells may be cultured for more than 12 days, e.g. from 12 days to 20 days; from 12 days to 30 days; or from 12 days to 40 days. In some embodiments, the cells to be induced are passaged for example one, two or three times prior to induction.
[0174] In some cases, cells are cultured at a low density, e.g., 110.sup.3 cells/cm.sup.2 or 110.sup.4 cells/cm.sup.2. In other cases, cells are cultured at a density e.g., 110.sup.3 cells/cm.sup.2 to 310.sup.4 cells/cm.sup.2.
[0175] Often the cells and/or tissues are cultured in a first medium, prior to the introduction of induction reprogramming factors into the cells; and then the cells are cultured in a second or third medium during and/or after the introduction of the induction reprogramming factors into the cells.
[0176] In some embodiments of the present invention, the cells are cultured in MEF culture medium immediately when a retroviral transfection period begins; and then, following the initiation of expression of induction reprogramming factors, the cells are cultured in mES, mES+Vc, iSF1, iCD1 and other ES cell culture media.
[0177] When a culture medium of either a low or high serum concentration is used for culturing the cells, one or more growth factors such as fibroblast growth factor (basic FGF); platelet-derived growth factor (PDGF), epidermal growth factor (EGF); insulin-like growth factor (IGF); IGF II; or insulin can be included in the culture medium. Other growth factors that can be used to supplement cell culture media include, but are not limited to: Transforming Growth Factor -1 (TGF -1), Activin A, Brain-derived Neurotrophic Factor (BDNF), Nerve Growth Factor (NGF), Neurotrophin (NT)-1, NT-2, or NT-3. In some embodiments, one or more of such factors is used in place of the bFGF or FGF-2 in the MC-ES medium or other cell culture medium.
[0178] The concentration of growth factors (e.g., bFGF, EGF, IGF, insulin, TGF -1, Activin A) in the culture media described herein (e.g., mES, iSF1, iCD1, N2B27+2i, mTeSR1) may be from 4 ng/ml to 50 ng/ml, e.g., 2 ng/ml, 3 ng/ml, 4 ng/ml, 5 ng/ml, 6 ng/ml, 7 ng/ml, 8 ng/ml, 10 ng/ml, 12 ng/ml, 14 ng/ml, 15 ng/ml, 17 ng/ml, 20 ng/ml, 25 ng/ml, 30 ng/ml, 35 ng/ml, 40 ng/ml, 45 ng/ml, or 50 ng/ml.
[0179] In the specific embodiment of the present invention, the iPSCs can be maintained in the following culture media like the mouse embryonic stem cells (mESCs):
(1) DMEM (High Glucose, Gibco)+15% FBS (Gibco)+1non-essential amino acid+2 mM glutamine GlutaMAX (1, Gibco)+sodium pyruvate (1, Gibco)+penicillin/streptomycin (50 untis/ml P, 50 mg/ml S, Hyclone)+0.1 mM -mercaptoethanol+1000 u leukocyte inhibitory factor LIF (millipore);
(2) N2B27+2i culture medium: knock-out DMEM (Gibco)/DMEM (High Glucose, Gibco) (1/1)+N2 without serum additives (Gibco, 0.5)+B27 without serum additives (Gibco, 0.5)+1non-essential amino acid+2 mM glutamine GlutaMAX (1, Gibco)+penicillin/streptomycin (50 untis/ml P, 50 mg/ml S, Hyclone)+0.1 mM -mercaptoethanol+1000 u leukocyte inhibitory factor LIF (millipore)+3 M CHIR99021+1 M PD0325901.
[0180] In the method for preparing iPSCs of the present invention, the cells to be induced may be cultured in a 37 C., 5% CO.sub.2 incubator with medium changes preferably every day. In some embodiments, the cells are cultured for 8 days to 15 days, prior to identifying and selecting induced pluripotent stem cell colonies based on cell biological properties and epigenetic properties as described herein.
Uses of iPSCs Prepared by the Invention
[0181] iPSCs have many uses. They may be further differentiated to generate different types of cells, e.g., neurons, hepatocytes, or cardiomyocytes. They may also give rise to other types of stem cells, e.g., neural stem cells, hepatic stem cells, or cardiac stem cells They have the ability to differentiate into other cells of a specific lineage. The induced cells, and cells differentiated from them, are useful for cell transplantation therapies. Since the induced cells can be induced from non-embryonic cells, a cell transplantation therapy can involve providing a subject with cells derived from his or her own tissue, thereby lessening the possibility of immune rejection.
[0182] iPSCs can also be used for screening chemotherapeutic drugs. iPSCs obtained by the method of the present invention are further differentiated into cells of a specific cell line, such as neurons, hepatocytes, cardiomyocytes, epithelial cells, and so on. Then the drugs to be screened are applied to various types of cells for the determination of cytotoxicity and efficacy, etc. of drugs to be screened, thereby screening the drugs with the lowest cytotoxicity and the highest efficacy.
Differentiation of iPSCs
[0183] iPSCs may be differentiated into various different types of lineages. Examples of differentiated cells include differentiated cells from ectodermal (e.g., neurons and fibroblasts), mesodermal (e.g., cardiomyocytes), or endodermal (e.g., pancreatic cells) lineages. The differentiated cells may be one or more of the following cells: pancreatic -cells, neural stem cells, neurons (e.g., dopaminergic neurons), oligodendrocytes, oligodendrocyte progenitor cells, hepatocytes, hepatic stem cells, astrocytes, cardiomyocytes, hematopoietic cells, or cardiac cells.
[0184] The differentiated cells derived from the induced pluripotent stem cells prepared by the method of the present invention may be terminally differentiated cells, or they may be capable of giving rise to cells of a specific lineage. For example, iPSCs can be differentiated into a variety of multipotent cell types, e.g., neural stem cells, cardiac stem cells, or hepatic stem cells. The stem cells may then be further differentiated into new cell types, e.g., neural stem cells may be differentiated into neurons; cardiac stem cells may be differentiated into cardiomyocytes; and hepatic stem cells may be differentiated into hepatocytes.
[0185] Numerous methods for differentiating iPSCs into cells of a specific cell type are well known in the art. Methods for differentiating iPSCs may be similar to those used to differentiate stem cells, such as embryonic stem cells, hematopoietic stem cells and so on. In some cases, the differentiation occurs in vitro; and in some cases the differentiation occurs in vivo.
[0186] Methods for generating neural stem cells from embryonic stem cells through differentiation as well known to those skilled in the art may be used to generate neural stem cells from iPSCs, see, e.g., Reubinoff et al., Nat, Biotechnol., 19(12): 1134-40, 2001, Nat, Biotechnol., 19(12):1134-40. For example, neural stem cells may be generated by culturing iPSCs in suspension in the presence of growth factors, e.g., FGF-2, see, Zhang et al., Nat. Biotech., (19):1129-1133, 2001. In some cases, the aggregates of iPSCs are cultured in a serum-free culture medium containing FGF-2. In another embodiment, iPSCs may be co-cultured with a mouse stromal cell line in the presence of a serum-free culture medium comprising FGF-2. In yet another embodiment, iPSCs may be directly transferred to a serum-free culture medium containing FGF-2 to directly induce differentiation of iPSCs.
[0187] Neural stem cells derived from iPSCs may be further differentiated into neurons, oligodendrocytes, or astrocytes. Often, the conditions used to generate neural stem cells can also be used to generate neurons, oligodendrocytes, or astrocytes.
[0188] iPSCs may be further differentiated into pancreatic B-cells by methods known in the art, e.g., Lumelsky et al., Science, 292:1389-1394, 2001; Assady et al., Diabetes, 50:1691-1697, 2001; D'Amour et al., Nat. Biotechnol, 24:1392-1401, 2006; D'Amour et al., Nat. Biotechnol, 23:1534-1541, 2005. The method comprises culturing iPSCs in a serum-free culture medium supplemented with Activin A, followed by culturing iPSCs in a serum-free culture medium supplemented with all-trans retinoic acid, followed by culturing iPSCs in a serum-free culture medium supplemented with bFGF and nicotinamide.
[0189] Hepatic cells or hepatic stem cells may be differentiated from iPSCs. For example, culturing iPSCs in the presence of sodium butyrate may generate hepatocytes, see e.g., Rambhatla et al., Cell Transplant, 12:1-11, 2003. In some embodiments, iPSCs may be differentiated into hepatic cells or hepatic stem cells by culturing iPSCs in the presence of Activin A for 2 to 6 days, e.g., 2, 3, 4, 5, or 6 days, and then culturing iPSCs in the presence of hepatocyte growth factor for 5 days to 10 days, e.g., 5, 6, 7, 8, 9, or 10 days.
Composition
[0190] The invention also provides a composition for promoting the formation of a pluripotent stem cell, said composition comprising: [0191] (i) a c-Jun antagonist, and one factor selected from the following seven groups of factors: (1) Sox2, Klf4 and c-Myc, (2) Klf4 and c-Myc, (3) Oct3/4, Klf4 and c-Myc, (4) Sox2, Nanog and Lin28, (5) Oct3/4, Nanog and Lin28, (6) Oct3/4, Klf and Sox2, and (7) Klf4 and Sox2; or said composition comprising: [0192] (ii) a c-Jun antagonist, Jhdm1b and Id1; at least one of Glis1, Sall4 and Lrh1; or said composition comprising: [0193] (iii) a c-Jun antagonist, Jhdm1b and Id1; and at least one of Oct4, Klf4, Sox2, Lin28, Esrrb, Lef1, Utf1 and miRNA C.
[0194] In some embodiments of the present invention, the composition for promoting the formation of an induced pluripotent stem cell of the present invention comprises: a c-Jun antagonist and Sox2, Klf4 and c-Myc, or, the composition comprises a c-Jun antagonist and Oct3/4, Klf4 and c-Myc, or, the composition comprises a c-Jun antagonist and Oct3/4, Klf4 and c-Myc, or, the composition comprises a c-Jun antagonist and Oct3/4, Klf and Sox2, or, the composition comprises a c-Jun antagonist and Sox2 and Klf4.
[0195] In one embodiment of the present invention, the composition for promoting the formation of an induced pluripotent stem cell of the present invention comprises: a c-Jun antagonist, Jhdm1b and Id1; and at least one of Glis1, Sall4 and Lrh1. In a preferred embodiment, the composition comprises a c-Jun antagonist, Jhdm1b and Id1; and Glis1, Sall4 or Lrh1.
[0196] In some embodiments of the present invention, the composition for promoting the formation of an induced pluripotent stem cell of the present invention comprises: a c-Jun antagonist, Jhdm1b and Id1 as well as Oct4; or, the composition comprises: a c-Jun antagonist, Jhdm1b and Id1 as well as Klf4; or, the composition comprises: a c-Jun antagonist, Jhdm1b and Id1 as well as Sox2; or, the composition comprises: a c-Jun antagonist, Jhdm1b and Id1 as well as Lin28; or, the composition comprises: a c-Jun antagonist, Jhdm1b and Id1 as well as Esrrb; or, the composition comprises: a c-Jun antagonist, Jhdm1b and Id1 as well as Lef1; or, the composition comprises: a c-Jun antagonist, Jhdm1b and Id1 as well as Utf1; or, the composition comprises: a c-Jun antagonist, Jhdm1b and Id1 as well as miRNA C.
[0197] In some embodiments, the composition of the invention can be introduced into cells (e.g., mouse embryonic fibroblasts) obtained from a donor (such as mouse or human) for example by a retroviral or lentiviral vector, and then the cells are cultured under the condition for culturing iPSCs as described herein, to reprogram somatic cells in vitro, thereby preparing iPSCs.
[0198] In some embodiments, the composition of the present invention can comprise one or more kinds of viruses transfected with the factor of the invention capable of promoting reprogramming and a virus transfected with a c-Jun antagonist, respectively, wherein said virus is for example a retrovirus, a lentivirus, a pox virus, an adenovirus, and so on. In some embodiments, the composition of the present invention can comprise one or more nucleic acids which encode the factor of the present invention capable of promoting reprogramming and a nucleic acid transfected with a c-Jun antagonist. In some embodiments, the composition of the present invention can comprise a liposome encapsulating one or more viral vectors, wherein said viral vectors are transfected with the factor of the present invention capable of promoting reprogramming and a c-Jun antagonist, respectively.
Kit
[0199] The invention further provides a kit comprising a composition for promoting the formation of an induced pluripotent stem cell, wherein said kit further comprises a package and/or instructions for use of the composition of the present invention. Said kit further comprises a culture plate, a culture medium (for example, ES culture medium, MC-ES culture medium) and a supplement (e.g., fibroblast growth factor (FGF)-2, basic FGF, platelet-derived growth factor (PDGF), epithelial growth factor (EGF) and insulin) required for culturing an induced pluripotent stem cell by using the composition of the present invention, as well as a green fluorescent protein (GFP) capable of indicating the formation of iPSCs. The kit may also include a tool for collecting a cell or tissue sample from a donor, a culture flask for the preservation of the cell or tissue sample, etc. The instructions contained in the kit can provide users with uses of the composition and related information. The instructions can be of any suitable forms, including, but not limited to, publications, videos, computer readable discs or compact discs.
EXAMPLES
Example 1
Inhibitory Effect of c-Jun on Somatic Cell Reprogramming
[0200] (1) c-Jun Plays Different Roles in Somatic Cells and Stem Cells
[0201] In order to study the roles of c-Jun played in somatic cells and stem cells, mouse embryonic stem cells and mouse embryo fibroblasts were selected as models and the total mRNAs were extracted from mouse embryonic stem cells and mouse embryonic fibroblasts using TRIzol. Subsequently, qPCR was carried out using the following steps: cDNAs were prepared with ReverTra Ace (Toyobo) and oligo-dT, and then qPCR (Takara) assay was conducted with Premix Ex Taq.
[0202]
[0203] In order to further verify the results obtained by qPCR, Western blot assay was performed as follows (with GAPDH as control): cell cultures were lysed using a protein lysate, followed by SDS-PAGE gel electrophoresis separation. The resultant proteins were transferred to a membrane and the membrane was blocked and then incubated with a primary antibody corresponding to the protein of interest. The membrane was further incubated with a corresponding secondary antibody. Finally, the membrane was developed with a developer and X-ray film was exposed to the membrane and protein expression amount was observed by the size of a specific band.
[0204] Next, gene knockout was performed on c-Jun through the following steps: by using TALEN gene editing techniques, firstly, a c-Jun gene site-specific TALEN vector was designed, and at the same time a Jun-deficient plasmid having puromycin resistance was constructed to replace c-Jun in genome, and homozygous knockout c-Jun (c-Jun.sup./) and heterozygous knockout c-Jun (c-Jun.sup.+/) were finally obtained through resistance screening and gene identification and verified at the protein level (as shown in
[0205] In the context of the present invention, the primers (5-3) used in the PCR analysis were as follows:
TABLE-US-00001 mFos-q-F GGGAACGGAATAAGATGGCT (SEQIDNO.4) mFos-q-R TGGGCTGCCAAAATAAACTC (SEQIDNO.5) mFosB-q-F TGTCTTCGGTGGACTCCTTC (SEQIDNO.6) mFosB-q-R GATCCTGGCTGGTTGTGATT (SEQIDNO.7) mFra1-q-F GAGACCGACAAATTGGAGGA (SEQIDNO.8) mFra1-q-R CTCCTTCTGGGATTTTGCAG (SEQIDNO.9) mFra2-q-F CCTTGTCTTCACCTACCCCA (SEQIDNO.10) mFra2-q-R TCCCCACTGCTACTGCTTCT (SEQIDNO.11) mATF2-q-F CAAGAAGGCTTCCGAAGATG (SEQIDNO.12) mATF2-q-R AGGTAAAGGGCTGTCCTGGT (SEQIDNO.13) mATF3-q-F ACAACAGACCCCTGGAGATG (SEQIDNO.14) mATF3-q-R TCTTGTTTCGACACTTGGCA (SEQIDNO.15) mJun-q-F TCCCCTATCGACATGGAGTC (SEQIDNO.16) mJun-q-R GAGTTTTGCGCTTTCAAGGT (SEQIDNO.17) mJdp2-q-F AGAAGAGCGAAGGAAAAGGC (SEQIDNO.18) mJdp2-q-R CTCTGCAGAAACTCTGTGCG (SEQIDNO.19) GAPDH-q-f AACTTTGGCATTGTGGAAGGGCTCA (SEQIDNO.20) GAPDH-q-r TTGGCAGCACCAGTGGATGCAGGGA (SEQIDNO.21) Nanog-q-f CTCAAGTCCTGAGGCTGACA (SEQIDNO.22) Nanog-q-r TGAAACCTGTCCTTGAGTGC (SEQIDNO.23) Dppa5-q-f CCGTGCGTGGTGGATAAG (SEQIDNO.24) Dppa5-q-r GCGACTGGACCTGGAATAC (SEQIDNO.25) Rex1-q-f CAGCCAGACCACCATCTGTC (SEQIDNO.26) Rex1-q-r GTCTCCGATTTGCATATCTCCTG (SEQIDNO.27) mDnmt31-q-f CGGAGCATTGAAGACATC (SEQIDNO.28) mDnmt31-q-r CATCATCATACAGGAAGAGG (SEQIDNO.29) Sox2-q-f AGGGCTGGGAGAAAGAAGAG (SEQIDNO.30) Sox2-q-r CCGCGATTGTTGTGATTAGT (SEQIDNO.31) Errsb-q-f TTTCTGGAACCCATGGAGAG (SEQIDNO.32) Errsb-q-r AGCCAGCACCTCCTTCTACA (SEQIDNO.33) SalI4-q-f CTAAGGAGGAAGAGGAGAG (SEQIDNO.34) SalI4-q-r CAAGGCTATGGTCACAAG (SEQIDNO.35) Oct4-q-f CATTGAGAACCGTGTGAG (SEQIDNO.36) Oct4-q-r TGAGTGATCTGCTGTAGG (SEQIDNO.37)
(2) Inhibitory Effect of c-Jun on Somatic Cell Reprogramming
[0206] As shown in
[0207] Mouse somatic cell reprogramming was performed in the following manner:
I. Cells were Cultured Using the Following Culture Media:
[0208] The culture medium for feeder layer cells, mouse embryonic fibroblasts and PlatE cells consists of: high glucose basal medium DMEM, plus 10% fetal bovine serum (FBS).
[0209] The culture medium for mouse embryonic stem cells consists of: DMEM high glucose medium, 15% FBS, 1% NEAA (GIBCO), 1 mM L-glutamine, 0.1 mM -mercaptoethanol, and leukocyte inhibitory factor (LIF).
[0210] iCD1 culture medium: the components contained in the medium and the amounts thereof have been disclosed in Chinese Patent Application No. CN201010167062.3, which is incorporated herein by reference.
[0211] KSR (Knockout Serum Replace) serum-free culture medium is a commercialized serum replacing stem cell culture additive and is used as a complete KSR serum-free medium for culturing stem cells or iPSCs, the composition of which consists of: Knockout-DMEM, 15% kKSR, 1% NEAA (GIBCO), 1 mM L-glutamine, 0.1 mM 3-mercaptoethanol and leukocyte inhibitory factor (LIF).
II. Cells for Reprogramming
[0212] All the somatic cells for reprogramming are OG2 mouse embryonic fibroblasts (lab-made), the passage number of which does not exceed three. One property of the OG2 mouse is that there is connected a green fluorescence protein (GFP) behind the promoters of the gene Oct4 that is specifically expressed by the stem cells. In reprogramming, when the endogenous Oct4 of the OG2 mouse embryonic fibroblasts is activated, the green fluorescence protein is expressed concomitantly. As observed through a fluorescence microscope, the successfully reprogrammed cells or cloned cell aggregates are green, and it is easy to compare the reprogramming efficiency at different conditions by directly adding up the number of reprogrammed clones, i.e., the number of green fluorescence clones, or by analyzing the proportion of green fluorescence cells through a flow cytometer.
III. Method for Inducing Somatic Cell Reprogramming
[0213] The reprogrammed cells were prepared as follows. The cells were seeded in 12-well plates at a density of 20000 cells per well, and after 8 hours, were infected with viruses with the mouse reprogramming factor
[0214] i. Preparation of Viruses
[0215] The transcription factors for reprogramming include the retrovirus vector pMXs for cDNAs of mouse Oct4, Sox2, Klf4, and c-Myc; Oct4, NCBI accession number: NM_013633.2; Sox2, NCBI accession number: NM_011443.3; Klf4, NCBI accession number: NM_010637.2; and c-Myc, NCBI accession number: NM_010849.4. The reprogramming factor plasmids on the pMX vector were transfected into the viral packaging cells (PlatE) by using a transfection reagent commonly used in the art, and 48 hours after the transfection, the virus supernatant was collected with a syringe and filtered into an appropriate centrifuge tube with a 0.45 m filter membrane to be used as the viral solution for first infection; a fresh 10 ml 10% FBS culture medium was added to the plat-E culture plate (100 mm plate), and the plate was placed in a 5% CO.sub.2, 37 C. incubator to continue the culture. After 24 hours, the virus was recollected in the same way to be used for second infection.
[0216] ii. Infecting Mouse Embryonic Fibroblasts with Viruses
[0217] Infection was conducted in two rounds. Viral supernatant collected each time was mixed with MEF cell culture medium in a ratio of 1:1 (the ratio of Oct4:Sox2:Klf4:c-Myc:substrate culture medium was 1:1:1:1:1 for a four-factor infection, and the ratio of Oct4:Sox2:Klf4:substrate culture medium was 1:1:1:1 for a three-factor infection, and so on), a final concentration of 8 g/ml hexadimethrine bromide (polybrene) was added and the resultant mixture was evenly mixed. Then the first round of infection was carried out on the MEF cells, and after 24 hours the second round of infection was carried out on the re-collected virus in the same way. At different time points after infection, the cells with GFP fluorescence were observed with a fluorescence microscope.
[0218] iii. The proportion of GFP fluorescence cells was analyzed using a flow cytometer or the infected cells were cultured until formation of induced pluripotent stem cell clones. Typical iPS clones were morphologically similar to embryonic stem cells and displayed green fluorescence (using reporter cells with GFP). The number of clones with GFP fluorescence was add up to compare the reprogramming efficiency.
[0219] According to the method for the formation of stem cell clones as described above, various factor combinations for promoting the formation of induced pluripotent stem cells within the scope of the present invention can be used to carry out the experiments.
[0220] In the context of the present invention, illustrative factor combinations that promote the formation of induced pluripotent stem cells formation were provided as follows: [0221] (1) Oct4, Klf4 and Sox2, abbreviated as OKS system, [0222] (2) Oct4, c-Myc, Klf4 and Sox2, abbreviated as OKSM system, [0223] (3) Klf4, Sox2 and c-Myc, abbreviated as KSM system, [0224] (4) Klf4 and Sox2, abbreviated as KS system, [0225] (5) c-JunDN/Jdp2 and Jhdm1b, as well as Id1/3, Glis1, Sall4, and Lrh1, abbreviated as 6F system.
[0226] The influences of c-Jun on the reprogramming efficiency of somatic cells in OKS system and OKSM system were examined by using the above-mentioned method.
[0227] By studying the different roles that c-Jun plays in somatic cells and stem cells and the influences of c-Jun on the reprogramming of somatic cells as described above, the inventors of the present invention reached a conclusion that c-Jun can significantly inhibit pluripotent relative genes, thereby inhibiting the reprogramming of somatic cells and leading to the differentiation of stem cells. Therefore, the inventors of the present invention predict that the inhibitory effect of c-Jun on somatic cell reprogramming can be eliminated by antagonizing c-Jun activity, so that a c-Jun antagonist can be used to promote the formation of induced pluripotent stem cells.
Example 2
Roles of a bZIP Domain in c-Jun
[0228] 1. Influences of Various Domains in c-Jun on the Reprogramming of Somatic Cells
[0229] With molecular cloning techniques, the JNK-Ser63/Ser73 site phosphorylation mutants of c-Jun and the truncated c-Jun (c-JunDN) located between 170-334 amino acids and having a bZIP domain but lacking a transactivation domain were constructed. The wild-type c-JunWT had an amino acid sequence of SEQ ID No. 1; and c-JunDN had an amino acid sequence of SEQ ID NO. 2.
TABLE-US-00002 Theaminoacidsequence(SEQIDNO.1)ofthewild-typec-JunWT (i.e.,thefulllengthc-Jun): mtakmettfyddalnasflqsaagaygysnpkilkqsmtlnladpvgalkphlraknsdl 60 ltspdvgllklsspelerliiqssnghitrtptptqflcgknvtdeqegfesgfvralae 120 lhsqntlpsvtsasqpvsgagmvapavasvagagggggysaslhseppvyanlsnfnpgs 180 lssgggapsygaaglafpsqpqqqqqppqpphhlpqqipvqhprlqalkeepqtvpempg 240 stpplspidmesqerikaerkrmrsriaaskcrkrkleriarleekvktlksqnselast 300 anmlreqvaqlkqkvmnhvasgcqlmlrqqlqtf 334 Theaminoacidsequence(SEQIDNO.2)ofc-JunDN: yanlsnfnpgalssgggapsygaeglafpsqpqqqqqppqpphhlpqqipvqhprlqalk 60 eepqtvpempgetpplspidmssqerikaerkrmrariaaskerkrkleriarleekvkr 120 lkaqnselastsnmlrsqveqlkqkvmnhvnsgcqlmltqqiqtf 165
[0230]
[0231] Then, according to the method for culturing cells and the method for detecting reprogramming efficiency as described in Example 1, the influences of adding c-JunWT, c-Jun S63A, c-Jun S73A, c-Jun S63A/S73A and c-JunDN to OKS and OKSM systems on the reprogramming efficiency were examined.
[0232] To further demonstrate the roles of various domains in c-Jun in the reprogramming of somatic cells, other truncated mutants of c-Jun except c-JunDN were constructed by the method as described in this example: the truncated c-Jun factors (c-Jun a.a 254-334) located between 254-334 amino acids, the truncated c-Jun factors (c-Jun a.a 274-334) located between 274-334 amino acids, the truncated c-Jun factors (c-Jun a.a 170-282) located between 170-282 amino acids, the c-Jun factors (c-Jun-bZIP, a.a 1-256) lacking a bZIP domain, and the c-Jun factors (c-Jun a.a 75-334) including a transactivation domain and a bZIP domain.
[0233] Then, according to the method for culturing cells and the method for detecting reprogramming efficiency as described in Example 1, the influences of adding c-JunWT, c-Jun-bZIP, c-Jun a.a 75-334, c-JunDN, c-Jun a.a 254-334, c-Jun a.a 274-334 and c-Jun a.a 170-282 to OKS system on the reprogramming efficiency were examined.
[0234] In order to further verify the influence of bZIP domain on the reprogramming, the effects of c-JunDN and c-Jun-bZIP on the reprogramming efficiency were compared.
[0235] At the same time, the Jun dimer protein 2 (Jdp2) was isolated from the proteins of AP-1 family and its amino acid sequence was as follows:
TABLE-US-00003 Theaminoacidsequence(SEQIDNO.3)ofJdp2: nmpgqipdpsvtagslpglgpltglpsealtteelkyadirnlgamiaplhflevklgkr 60 pqpvkseldeeeerrkrsreknkvaaercrnkkkerteflqreserlelmnaelktqiee 120 lklerqqlilmlnrhrptcivrtdsvrtpesegnplleqldkk 163
[0236] By sequence analysis, it was found that Jdp2 and c-JunDN had the same sequence structure.
[0237] The invention also constructed various different mutants of Jdp2, whose protein sequences were schematically shown in
Example 3
Identification of the Obtained Induced Pluripotent Stem Cells
[0238] Taking c-JunDN/Jdp2+KSM (Klf4, Sox2 and c-Myc) and c-JunDN/Jdp2+KS (Klf4 and Sox2) systems for instance, according to the method and culture medium as described in the above Example 1, mouse embryonic fibroblasts were used to culture induced pluripotent stem cells (iPSCs) and the obtained induced pluripotent stem cells were analyzed and identified as follows.
i. PCR Analysis-Exogenous Gene Integration Analysis
[0239] As shown in
ii. Analysis of Methylation Status of Promoter Region
[0240] Analysis of methylation status of promoter regions was carried out by sodium bisulfite sequencing well-known in the art.
[0241]
iii. Identification of Karyotypes of iPSCs
[0242] Next, the identification of karyotypes of iPSCs was conducted according to the method as described below.
[0243] The identification of karyotypes of iPSCs was carried out according to the following method:
[0244] Under feeder-free culture condition, iPS clones were cultured. The culture medium was replaced with a freshly prepared medium when cells grew to the cell density of 80%-90% and colchicine with a final concentration of 0.2 g/ml was added. The resulting mixture was placed in an incubator at 37 C. for 60 minutes. The culture medium was drawn off. The cells were washed with PBS, digested with 0.25% trypsin and collected. Under 250 g condition, the cells were centrifuged for 5 minutes and then 7 ml of a KCl solution (0.075 mol/L, preheated at 37 C.) was added. The cells were blown homogeneously and placed in a waterbath at 37 C. for 20 minutes.
[0245] The cells were pre-fixed with a freshly prepared Carnoy's fixative for 3 minutes. After pre-fixation, the resultant mixture was centrifuged at 1200 rpm/min for 5 minutes. The supernatant was discarded, about 7 ml of a freshly prepared fixative was added thereto and the resultant mixture was placed in a waterbath at 37 C. for 40 minutes for fixation. Centrifugal treatment was carried out at 1200 rpm/min for 5 minutes. A large part of fixative was discarded and the left part was used to re-suspend cells. The resulting cell suspension was dropped onto frozen clean slides which were then placed in a drying oven at 75 C. for 3 hours immediately.
[0246] 0.03 g trypsin powder was dissolved in 55 ml of saline water to produce a trypsin solution and the trypsin solution was adjusted to a pH of 7.2 with 3% Tris. Subsequently, the prepared slides were put into the trypsin solution for 8 seconds and then placed into saline water quickly to terminate digestion. The resulting slides were placed in Giemsa staining solution to stain the cells for 5 to 10 minutes and then taken out with a forceps and rinsed with tap water gently. After drying at room temperature or with a hair dryer, mitosis was observed under oil microscope.
[0247] Results of karyotype experiment were shown in
iv. Blastula Chimera Test
[0248] Subsequently, iPSCs were injected into the blastocoele of donor mice, and then the injected blastulas were transplanted into the uteruses of pseudo-pregnant female mice to produce chimeric mice. Whether the born mice produce chimera was determined based on their coat color.
Example 4
c-JunDN/Jdp2 can Replace Oct4 to Promote Somatic Cell Reprogramming
[0249] i. c-JunDN and Jdp2 Regulate the Same Gene Groups as Oct4
[0250] c-Jun, c-JunDN, and Jdp2 were overexpressed in mouse embryonic fibroblasts, and the gene groups regulated by them were detected by the following RNA-seq method.
[0251] RNA-seq method: firstly, total RNAs were prepared using TRIzol. Then, TruSeq RNA Sample Prep Kit (RS-122-2001, Illumina) was used for library constructions and sequencing done with Miseq Reagent Kit V2 (MS-102-2001) for RNA-seq.
[0252] As shown in
[0253] Next, gene regulation during mouse embryonic fibroblast reprogramming commonly induced by c-JunDN, Jdp2 or Oct4 in combination with KSM (Klf4, Sox2 and c-Myc) was studied. Mouse embryonic fibroblasts were cultured in c-JunDN+KSM, Jdp2+KSM and Oct4+KSM systems respectively, according to the method and the condition for culturing somatic cells as described in Example 1. During transforming mouse embryonic fibroblasts into induced pluripotent cells, gene groups regulated by c-JunDN, Jdp2 and Oct4 were detected by the above-mentioned RNA-seq method. As shown in
ii. c-JunDN or Jpd2 can Replace Oct4 to Promote Somatic Cell Reprogramming
[0254] According to the culture method and the culture conditions as described in Example 1, cells were cultured in KSM+c-JunDN and OKM (i.e., Oct4, Klf4 and c-Myc)+c-JunDN systems and clone number of GFP iPS were detected, to determine the influences of the two systems on the efficiency of reprogramming.
[0255] Furthermore, GFP.sup.+ iPS clones obtained in KSM+c-JunDN system were observed by fluorescence microscopy imaging, as shown in
[0256] Similarly, according to the culture method and the culture conditions as described in Example 1, cells were cultured in KSM+Jdp2 and KS+Jdp2 systems and clone number of GFP iPS were detected, to determine the influences of the two systems on the efficiency of reprogramming.
[0257] Similarly, GFP.sup.+ iPS clones obtained in KSM+Jdp2 system and KS+Jdp2 system were observed by fluorescence microscopy imaging, as shown in
Example 5
Six-Factor System that can Promote the Reprogramming of Somatic Cells
[0258] Previous research had identified the factor Jhdm1b that can promote Oct4 single factor reprogramming [Wang et al., 2011], the BMP downstream factor Id1/3 [Chen et al., 2011b] and the three factors Glis1, Sall4 and Lrh1 that can enhance the efficiency of reprogramming [Buganim et al., 2012; Heng et al., 2010; Maekawa et al., 2011].
[0259] The inventors of the present invention combined c-JunDN/Jdp2 with Jhdm1b, Id1/3, Glis1, Sall4, and Lrh1 to form a six-factor (6F) system based on the above experimental results: c-JunDN/Jdp2 can replace Oct4 to promote the reprogramming in KSM or KS system, thereby promoting the formation of induced pluripotent stem cells, and cultured mouse embryonic fibroblasts under the six-factor condition according to the culture method and the culture conditions as described in Example 1, to detect clone number of GFP.sup.+ iPS of the obtained cells. As shown in
[0266] Similarly, according to the culture method and the culture conditions as described in Example 1, mouse embryonic fibroblasts were cultured under the above five-factor conditions respectively and clone number of GFP.sup.+ iPS of the obtained cells were detected. As shown in FIG. 11, in a five-factor system absent of any one of Glis1, Sall4 and Lrh1, clone number of GFP.sup.+ iPS were also relatively large; while in a five-factor system absent of any one of c-JunDN/Jdp2, Jhdm1b and Id1/3, clone number of GFP.sup.+ iPS were almost zero. It was demonstrated that c-JunDN/Jdp2, Jhdm1b or Id1/3 were necessary for somatic cell reprogramming, and a five-factor system absent of any one of Glis1, Sall4 and Lrh1 could also promote somatic cell reprogramming, thereby promoting the formation of induced pluripotent stem cells.
[0267] The influence of the 6F system on the formation of induced pluripotent stem cells was observed by cell fluorescence microscopy imaging. As shown in the cell fluorescence micrographs of
[0268] Induced pluripotent stem cells obtained in the 6F system were analyzed and identified according to the PCR method, the method for identifying karyotypes and the method for testing blastula chimera as described in Example 3 and the results were shown in
[0269] Although the preferred embodiments of the present invention have been described and illustrated herein, it is obvious to those skilled in the art that these embodiments are only illustrative. It will be apparent to those skilled in the art that numerous variations, modifications and substitutions can be made to these embodiments without departing from the scope and spirit of the present invention. The scope of the present invention is defined by the appended claims and the methods and structures as fall within the claims together with the equivalents thereof are intended to be embraced by the appended claims.