TREATMENT OF TUMORS EXPRESSING MUTANT P53
20170038384 ยท 2017-02-09
Inventors
- Eusebio Manchado (New York, NY, US)
- Susann Weissmueller (New York, NY, US)
- Scott W. Lowe (New York, NY)
- Michael Saborowski (New York, NY, US)
Cpc classification
C07K16/2863
CHEMISTRY; METALLURGY
A61K31/7088
HUMAN NECESSITIES
C12N15/1135
CHEMISTRY; METALLURGY
G01N2800/52
PHYSICS
C07K2317/76
CHEMISTRY; METALLURGY
C12Q2600/106
CHEMISTRY; METALLURGY
International classification
C07K16/28
CHEMISTRY; METALLURGY
Abstract
PDGFRb inhibitors and the use of such inhibitors to treat mutant p53-expressing tumors are described. The present disclosure encompasses the discovery that mutant p53-induced upregulation of the platelet-derived growth factor receptor b (PDGFRb) contributes to invasion and/or metastasis of tumors expressing mutant p53. Specifically, the present disclosure encompasses the discovery that mutant p53 can disrupt a p73/NF-Y complex (which can repress PDGFRB transcription), leading to transcription of PDGFRb. The present disclosure therefore provides, at least in part, PDGFRb modulators (e.g., activators or inhibitors) for use in medicine, and specifically in diagnosis, treatment and/or prevention (e.g., delay of onset) of certain disorders, e.g., cancer.
Claims
1. A method of treating or preventing tumor metastasis, comprising: detecting a mutant p53 polynucleotide or a mutant p53 polypeptide in a tumor; and contacting the tumor with a therapeutic agent that targets a platelet derived growth factor receptor (PDGFR).
2. The method of claim 1, wherein the tumor is a pancreatic cancer tumor, a colorectal cancer tumor, or an ovarian cancer tumor.
3. The method of claim 1, wherein contacting the tumor reduces tumor metastasis.
4. The method of claim 1, wherein the PDGFR is a PDGFRb.
5. The method of claim 1, wherein the therapeutic agent reduces expression or activity of the PDGFR.
6. The method of claim 1, wherein the therapeutic agent is an antibody, a nucleic acid, or a small molecule.
7. The method of claim 6, wherein the therapeutic agent is imatinib.
8. The method of claim 1, wherein the mutant p53 polynucleotide or mutant p53 polypeptide is detected in a sample of the tumor.
9. The method of claim 1, wherein the mutant p53 polynucleotide or mutant p53 polypeptide is detected in the tumor in a subject in vivo.
10. The method of claim 1, wherein the contacting step comprises administering the therapeutic agent to a subject having the tumor.
11. A method of treating a subject having a tumor comprising a mutant p53 polynucleotide or a mutant p53 polypeptide, the method comprising administering to the subject a therapeutic agent that reduces expression or activity of a PDGFRb.
12-15. (canceled)
16. The method of claim 11, further comprising detecting a mutant p53 polynucleotide or mutant p53 polypeptide in the tumor.
17-18. (canceled)
19. A method of identifying a subject for treatment with a therapeutic agent that targets a PDGFR, the method comprising: detecting in the subject a tumor comprising a mutant p53 polynucleotide or mutant p53 polypeptide; and selecting the subject for treatment with a therapeutic agent that targets a PDGFR.
20. (canceled)
21. The method of claim 19, wherein the mutant p53 polynucleotide or mutant p53 polypeptide is detected in a sample of the tumor.
22. The method of claim 19, wherein the mutant p53 polynucleotide or mutant p53 polypeptide is detected in the tumor in vivo.
23.-28. (canceled)
29. The method of claim 1, wherein the therapeutic agent is a nucleic acid that binds to SEQ ID NO:3 or a portion thereof.
30. The method of claim 1, wherein the therapeutic agent is an antibody that binds to SEQ ID NO:4 or a portion thereof.
31. A method comprising: detecting a level of PDGFRb expression and/or activity in a tumor; and comparing the detected level to a control, wherein a detected level that is higher relative to the control identifies the tumor for treatment with a therapeutic agent that targets the PDGFRb.
32. A method of treating or preventing tumor metastasis, comprising: detecting a level of PDGFRb expression and/or activity in a tumor; comparing the detected level to a control; and if the detected level is higher relative to the control, treating the tumor with a therapeutic agent that targets the PDGFRb.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0004] The following figures are presented for the purpose of illustration only, and are not intended to be limiting.
[0005]
[0006]
[0007]
[0008]
[0009]
[0010]
[0011]
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
[0058]
[0059]
[0060]
[0061]
[0062]
[0063]
[0064]
[0065]
[0066]
[0067]
[0068]
[0069]
[0070]
[0071]
[0072]
[0073]
DEFINITIONS
[0074] In order for the present invention to be more readily understood, certain terms are first defined below. Additional definitions for the following terms and other terms are set forth throughout the specification.
[0075] Characteristic portion: As used herein, the term a characteristic portion of a substance, in the broadest sense, is one that shares some degree of sequence or structural identity with respect to the whole substance. In certain embodiments, a characteristic portion shares at least one functional characteristic with the intact substance. For example, a characteristic portion of a polypeptide or protein is one that contains a continuous stretch of amino acids, or a collection of continuous stretches of amino acids, that together are characteristic of a polypeptide or protein. In some embodiments, each such continuous stretch generally contains at least 2, 5, 10, 15, 20, 50, or more amino acids. In general, a characteristic portion of a substance (e.g., of a polypeptide or protein) is one that, in addition to the sequence and/or structural identity specified above, shares at least one functional characteristic with the relevant intact substance. In some embodiments, a characteristic portion may be biologically active.
[0076] Characteristic sequence: A characteristic sequence is a sequence that is found in all members of a family of polypeptides or nucleic acids, and therefore can be used by those of ordinary skill in the art to define members of the family.
[0077] Combination therapy: The term combination therapy, as used herein, refers to those situations in which two or more different pharmaceutical agents are administered in overlapping regimens so that the subject is simultaneously exposed to both agents. When used in combination therapy, two or more different agents may be administered simultaneously or separately. This administration in combination can include simultaneous administration of the two or more agents in the same dosage form, simultaneous administration in separate dosage forms, and separate administration. That is, two or more agents can be formulated together in the same dosage form and administered simultaneously. Alternatively, two or more agents can be simultaneously administered, wherein the agents are present in separate formulations. In another alternative, a first agent can be administered just followed by one or more additional agents. In the separate administration protocol, two or more agents may be administered a few minutes apart, or a few hours apart, or a few days apart.
[0078] Homology: As used herein, the term homology refers to the overall relatedness between polymeric molecules, e.g., between nucleic acid molecules (e.g., DNA molecules and/or RNA molecules) and/or between polypeptide molecules. In some embodiments, polymeric molecules are considered to be homologous to one another if their sequences are at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical. In some embodiments, polymeric molecules are considered to be homologous to one another if their sequences are at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% similar.
[0079] Identity: As used herein, the term identity refers to the overall relatedness between polymeric molecules, e.g., between nucleic acid molecules (e.g., DNA molecules and/or RNA molecules) and/or between polypeptide molecules. Calculation of the percent identity of two nucleic acid sequences, for example, can be performed by aligning the two sequences for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second nucleic acid sequences for optimal alignment and non-identical sequences can be disregarded for comparison purposes). In certain embodiments, the length of a sequence aligned for comparison purposes is at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or substantially 100% of the length of the reference sequence. The nucleotides at corresponding nucleotide positions are then compared. When a position in the first sequence is occupied by the same nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position. The percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which needs to be introduced for optimal alignment of the two sequences. The comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm. For example, the percent identity between two nucleotide sequences can be determined using the algorithm of Meyers and Miller (CABIOS, 1989, 4: 11-17), which has been incorporated into the ALIGN program (version 2.0) using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4. The percent identity between two nucleotide sequences can, alternatively, be determined using the GAP program in the GCG software package using an NWSgapdna.CMP matrix.
[0080] Mutant p53: As used herein, the term mutant p53 gene or mutant p53 polypeptide refers to a gene or a polypeptide whose nucleotide or amino acid sequence includes at least one characteristic sequence of and/or shows at least 99%, 98%, 97%, 96%, 95%, 94%, 93%, 92%, 91%, 90%, 89%, 88%, 87%, 86%, 85%, 84%, 83%, 82%, 81%, 80%, 79%, 78%, 77%, 76%, 75%, 74%, 73%, 72%, 71%, or 70% identity with a wild-type p53 gene or polypeptide described herein, e.g., SEQ ID NO:1 or SEQ ID NO:2. In some embodiments, a mutant p53 polypeptide shares at least one characteristic sequence of and/or shows the specified degree of overall sequence identity with one of the p53 sequences set forth herein (each of which may be considered a reference p53). In some embodiments, a mutant p53 polypeptide as described herein shares at least one biological activity with a reference p53 polypeptide as set forth herein. In some embodiments, a mutant p53 polypeptide does not exhibit a detectable p53 tumor suppressive activity. In some embodiments, a mutant p53 gene or polypeptide differs from a wild-type p53 gene or polypeptide at one or more nucleotides or amino acid residues.
[0081] PDGFRb polypeptide: The term PDGFRb polypeptide or platelet derived growth factor receptor b polypeptide refers to a polypeptide whose amino acid sequence includes at least one characteristic sequence of and/or shows at least 100%, 99%, 98%, 97%, 96%, 95%, 94%, 93%, 92%, 91%, 90%, 89%, 88%, 87%, 86%, 85%, 84%, 83%, 82%, 81%, 80%, 79%, 78%, 77%, 76%, 75%, 74%, 73%, 72%, 71%, or 70% identity with a PDGFRb polypeptide described herein, e.g., SEQ ID NO:4. A wide variety of PDGFRb sequences from flies, vertebrates, and mammals are known in the art, such as those described herein; in some embodiments, a PDGFRb shares at least one characteristic sequence of and/or shows the specified degree of overall sequence identity with one of the PDGFRb sequences set forth herein (each of which may be considered a reference PDGFRb). In some embodiments, a PDGFRb as described herein shares at least one biological activity with a reference PDGFRb as set forth herein. In some such embodiments, the shared biological activity relates to PDGF signaling pathway activation or inhibition.
[0082] PDGFRb inhibitor: The term PDGFRb inhibitor, as used herein, refers to any substance that inhibits or reduces the expression and/or activity of a PDGFRb. In some embodiments, a PDGFRb inhibitor is a substance that inhibits the transcription, expression, binding, activity or stability of a PDGFRb and/or a nucleic acid encoding such PDGFRb.
[0083] PDGFRb modulator: The term PDGFRb modulator, as used herein, refers to any substance that modulates activity and/or expression of a PDGFRb. In some embodiments, a PDGFRb modulator modulates the transcription, binding, activity and/or stability of a PDGFRb and/or a nucleic acid encoding such PDGFRb. In some embodiments, a PDGFRb modulator is a PDGFRb activator. In some embodiments, a PDGFRb modulator is a PDGFRb inhibitor.
[0084] Polypeptide: As used herein, a polypeptide, generally speaking, is a string of at least two amino acids attached to one another by a peptide bond. In some embodiments, a polypeptide may include at least 3-5 amino acids, each of which is attached to others by way of at least one peptide bond. Those of ordinary skill in the art will appreciate that polypeptides sometimes include non-natural amino acids or other entities that nonetheless are capable of integrating into a polypeptide chain, optionally.
[0085] Protein: As used herein, the term protein refers to a polypeptide (i.e., a string of at least two amino acids linked to one another by peptide bonds). Proteins may include moieties other than amino acids (e.g., may be glycoproteins, proteoglycans, etc.) and/or may be otherwise processed or modified. Those of ordinary skill in the art will appreciate that a protein can be a complete polypeptide chain as produced by a cell (with or without a signal sequence), or can be a characteristic portion thereof. Those of ordinary skill will appreciate that a protein can sometimes include more than one polypeptide chain, for example linked by one or more disulfide bonds or associated by other means. Polypeptides may contain L-amino acids, D-amino acids, or both and may contain any of a variety of amino acid modifications or analogs known in the art. Useful modifications include, e.g., terminal acetylation, amidation, methylation, etc. In some embodiments, proteins may comprise natural amino acids, non-natural amino acids, synthetic amino acids, and combinations thereof. The term peptide is generally used to refer to a polypeptide having a length of less than about 100 amino acids, less than about 50 amino acids, less than 20 amino acids, or less than 10 amino acids.
[0086] Reference sample: As used herein, a reference sample may include, but is not limited to, any or all of the following: a cell or cells, a portion of tissue, blood, serum, ascites, urine, saliva, and other body fluids, secretions, or excretions. The term sample also includes any material derived by processing such a sample. Derived samples may include nucleotide molecules or polypeptides extracted from the sample or obtained by subjecting the sample to techniques such as amplification or reverse transcription of mRNA, etc.
[0087] Subject: As used herein, the term subject or patient refers to any organism upon which embodiments of the invention may be used or administered, e.g., for experimental, diagnostic, prophylactic, and/or therapeutic purposes. Typical subjects include animals (e.g., mammals such as mice, rats, rabbits, non-human primates, and humans; insects; worms; etc.).
[0088] Suffering from: An individual who is suffering from a disease, disorder, or condition (e.g., a cancer) has been diagnosed with and/or exhibits one or more symptoms of the disease, disorder, or condition. In some embodiments, an individual who is suffering from cancer has cancer, but does not display any symptoms of cancer and/or has not been diagnosed with a cancer.
[0089] Susceptible to: An individual who is susceptible to a disease, disorder, or condition (e.g., cancer) is at risk for developing the disease, disorder, or condition. In some embodiments, an individual who is susceptible to a disease, disorder, or condition does not display any symptoms of the disease, disorder, or condition. In some embodiments, an individual who is susceptible to a disease, disorder, or condition has not been diagnosed with the disease, disorder, and/or condition. In some embodiments, an individual who is susceptible to a disease, disorder, or condition is an individual who displays conditions associated with development of the disease, disorder, or condition. In some embodiments, a risk of developing a disease, disorder, and/or condition is a population-based risk.
[0090] Symptoms are reduced: According to the present invention, symptoms are reduced when one or more symptoms of a particular disease, disorder or condition is reduced in magnitude (e.g., intensity, severity, etc.) or frequency. For purposes of clarity, a delay in the onset of a particular symptom is considered one form of reducing the frequency of that symptom. It is not intended that the present invention be limited only to cases where the symptoms are eliminated. The present invention specifically contemplates treatment such that one or more symptoms is/are reduced (and the condition of the subject is thereby improved), albeit not completely eliminated.
[0091] Target cell or target tissue: As used herein, the terms target cell or target tissue refer to any cell, tissue, or organism that is affected by a condition described herein and to be treated, or any cell, tissue, or organism in which a protein involved in a condition described herein is expressed. In some embodiments, target cells, target tissues, or target organisms include those cells, tissues, or organisms in which there is a detectable or abnormally high amount of PDGFRb activity and/or expression (e.g., comparable to that observed in subjects suffering from or susceptible to cancer). In some embodiments, target cells, target tissues, or target organisms include those cells, tissues or organisms that display a disease-associated pathology, symptom, or feature.
[0092] Therapeutic regimen: As used herein, the term therapeutic regimen refers to any method used to partially or completely alleviate, ameliorate, relieve, inhibit, prevent, delay onset of, reduce severity of and/or reduce incidence of one or more symptoms or features of a particular disease, disorder, and/or condition. It may include a treatment or series of treatments designed to achieve a particular effect, e.g., reduction or elimination of a detrimental condition or disease such as cancer. The treatment may include administration of one or more compounds either simultaneously, sequentially or at different times, for the same or different amounts of time. Alternatively, or additionally, the treatment may include exposure to radiation, chemotherapeutic agents, hormone therapy, or surgery. In addition, a treatment regimen may include genetic methods such as gene therapy, gene ablation or other methods known to reduce expression of a particular gene or translation of a gene-derived mRNA.
[0093] Therapeutic agent: As used herein, the phrase therapeutic agent refers to any agent that, when administered to a subject, has a therapeutic effect and/or elicits a desired biological and/or pharmacological effect.
[0094] Therapeutically effective amount: As used herein, the term therapeutically effective amount refers to an amount of an agent (e.g., a PDGFRb modulator) that confers a therapeutic effect on the treated subject, at a reasonable benefit/risk ratio applicable to any medical treatment. The therapeutic effect may be objective (i.e., measurable by some test or marker) or subjective (i.e., subject gives an indication of or feels an effect). In particular, the therapeutically effective amount refers to an amount of a therapeutic agent or composition effective to treat, ameliorate, or prevent a desired disease or condition, or to exhibit a detectable therapeutic or preventative effect, such as by ameliorating symptoms associated with the disease, preventing or delaying the onset of the disease, and/or also lessening the severity or frequency of symptoms of the disease. A therapeutically effective amount is commonly administered in a dosing regimen that may comprise multiple unit doses. For any particular therapeutic agent, a therapeutically effective amount (and/or an appropriate unit dose within an effective dosing regimen) may vary, for example, depending on route of administration, on combination with other pharmaceutical agents. Also, the specific therapeutically effective amount (and/or unit dose) for any particular patient may depend upon a variety of factors including the disorder being treated and the severity of the disorder; the activity of the specific pharmaceutical agent employed; the specific composition employed; the age, body weight, general health, sex and diet of the subject; the time of administration, route of administration, and/or rate of excretion or metabolism of the specific fusion protein employed; the duration of the treatment; and like factors as is well known in the medical arts.
[0095] Treatment: As used herein, the term treatment (also treat or treating) refers to any administration of a substance (e.g., provided compositions) that partially or completely alleviates, ameliorates, relieves, inhibits, delays onset of, reduces severity of, and/or reduces incidence of one or more symptoms, features, and/or causes of a particular disease, disorder, and/or condition (e.g., cancer). Such treatment may be of a subject who does not exhibit signs of the relevant disease, disorder and/or condition and/or of a subject who exhibits only early signs of the disease, disorder, and/or condition. Alternatively or additionally, such treatment may be of a subject who exhibits one or more established signs of the relevant disease, disorder and/or condition. In some embodiments, treatment may be of a subject who has been diagnosed as suffering from the relevant disease, disorder, and/or condition. In some embodiments, treatment may be of a subject known to have one or more susceptibility factors that are statistically correlated with increased risk of development of the relevant disease, disorder, and/or condition.
[0096] Wild-type p53: As used herein, the term wild-type p53 refers to a p53 gene (wild-type p53 gene) or p53 polypeptide (wild-type p53 polypeptide) that exists in an organism and that has one or more known p53 functions, e.g., tumor repressive activity. A wide variety of p53 sequences from flies, vertebrates, and mammals are known in the art, such as those described herein. In some embodiments, a human wild-type p53 gene has or includes the nucleotide sequence of SEQ ID NO:1, and a human wild type p53 polypeptide has or includes the amino acid sequence of SEQ ID NO:2.
DETAILED DESCRIPTION
[0097] The present disclosure encompasses the surprising discovery that tumor metastasis, e.g., metastasis of a tumor expressing a mutant p53 polypeptide, can be modulated using PDGFRb modulators (e.g., PDGFRb activators or inhibitors). Accordingly, the disclosure provides, among other things, use of PDGFRb as a diagnostic, prognostic or therapeutic target for treating cancer, e.g., a tumor expressing a mutant p53 polypeptide.
Wild-Type and Mutant p53
[0098] Mutations in the p53 tumor suppressor gene represent the most common genetic lesions in cancer (Vogelstein et al., 2000). Functional studies indicate that wild-type p53 possesses a series of anti-proliferative activities that limit the proliferation and survival of pre-malignant cells. p53 exerts these activities, at least in part, through its ability to bind DNA in a sequence-specific manner to regulate gene expression, and the vast majority of mutations that occur in human tumors disable this property of p53 and, consequently, its anti-proliferative effects.
[0099] p53 mutations typically occur within the DNA-binding region and involve either DNA contact residues or residues important for conformational structure, both resulting in loss of DNA binding (Rolley et al., 1995). Because p53 functions as a tetrameric transcription factor (Wang et al., 1994), mono-allelic p53 mutations can exert dominant-negative effects on a coexpressed wild-type p53 protein. p53 activates E3 ubiquitin ligases that feed back to trigger p53 destruction and its rapid turn over; however, p53 missense mutants defective in regulating gene expression lead to the stable accumulation of the variant proteins (Oren et al., 2010). Interestingly, genetically engineered mice harboring common p53 point mutations develop more aggressive and metastatic tumors compared to those arising in their p53 heterozygous or null counterparts (Lui et al., 2000; Lang et al., 2004; Olive et al., 2004), suggesting that the mutant forms of p53 exert gain-of-function activities independent of their effects on wild-type p53. Thus, not only is inactivation of p53 activity closely related with development of cancerous states, but p53 mutations occurring in some cancers can lead to increased expression of mutant p53 proteins that actively promote cancer. This gain of function may be due to ability of p53 mutants to enhance cellular invasion and to promote metastasis. Human tumors with mutant p53 are associated with poor patient prognosis (Sorlie et al., 2001; Soussi and Beroud, 2001) and drug resistance (Masciarelli et al., 2013). In addition, mutant p53 proteins have been identified as involved in integrin recycling (Muller et al., 2009), the mevalonate pathway (Freed-Pastor et al., 2012) or miRNA biogenesis (Su et al., 2010).
[0100] Pancreatic ductal adenocarcinoma (PDAC) is one cancer type in which mutant p53 impacts disease progression. PDAC arises from indolent pancreatic intraductal adenomas (PanINs) that frequently go undetected and persist for many years. However, the conversion of PanINs to highly aggressive, frankly invasive and metastatic PDACs, in which p53 is mutated in 75% of cases, carries a dire prognosis due to late stage detection, the presence of metastases, and ineffective treatment options (Li et al., 2004). Even those patients with a surgically approachable pancreatic lesion develop recurrent and metastatic disease after local tumor resection (Hidalgo, 2010). Consistent with a role for mutant p53 in this process, mice harboring pancreatic cancers driven by oncogenic Kras and a mutant p53 allele show more metastases compared to identical mice harboring a p53 null allele. However, it was not previously known whether mutant p53 is needed to sustain the metastatic phenotype and how it is regulated. As metastasis is a major cause of cancer mortality, and p53 mutations are common, agents that prevent or reduce metastasis by interfering with mutant p53 effects have great potential. As described herein, the present disclosure includes the discovery of the platelet-derived growth factor receptor beta (PDGFRb) as necessary and sufficient to mediate the effects of mutant p53 on invasion and metastasis.
[0101] In some embodiments, methods of the present disclosure involve identification and/or treatment of tumors having and/or expressing one or more mutant p53 genes. Wild-type and mutant p53 genes and polypeptides are known. For example, a human wild-type nucleotide sequence is disclosed as Genbank Accession No. AB082923.1 (SEQ ID NO:1), and the corresponding amino acid sequence is disclosed as Genbank Accession No. BAC16799.1 (SEQ ID NO:2). In some embodiments, a wild-type p53 polypeptide includes a proline/arginine polymorphism at amino acid residue 72 and the corresponding nucleotide polymorphism.
[0102] Record number P04637 in the UniProt database lists mutations to the amino acid sequence of a wild-type human p53. In some embodiments, a mutant p53 polypeptide contains a mutation of at least one wild-type amino acid residue selected from V143, P151, R175, G245, R248, R249, R273, P274, R280 and R282 of a wild-type p53 polypeptide described herein, e.g., of SEQ ID NO:1 (or a corresponding wild-type amino acid residue of a wild-type p53 polypeptide from another species). In some embodiments, a mutant p53 polypeptide includes at least one amino acid mutation selected from V143A, P1515, R175H, P223L, M237I, G245C, G245H, G2455, R273H, P274L and R280K and/or any combination thereof. Additional p53 mutant polypeptides are disclosed in, e.g., Bai et al., J. Cancer Mol., 2(4):141-153 (2006).
[0103] In some embodiments, a mutant p53 polypeptide includes a mutation of one or more wild-type amino acid residue selected from amino acid residues 130-290 (see, e.g., Nigro et al, Nature 342, 705-708 (1989)). In some embodiments, a mutant p53 polypeptide a mutation of one or more wild-type amino acid residue selected from amino acid residues 132-143, 174-179, 236-248, and 272-281.
[0104] In some embodiments, a mutant p53 polypeptide has at least one mutation of a wild-type amino acid residue of a p53 N-terminal domain (e.g., of approximately amino acids 1-42). In some embodiments, a mutant p53 polypeptide has at least one mutation of a wild-type amino acid residue of a p53 activation domain (e.g., of approximately amino acids 43-63). In some embodiments, a mutant p53 polypeptide has at least one mutation of a wild-type amino acid residue of a p53 protein rich domain (e.g., of approximately amino acids 64-92). In some embodiments, a mutant p53 polypeptide has at least one mutation of a wild-type amino acid residue of a p53 DNA-binding domain (e.g., of approximately amino acids 100-300). In some embodiments, a mutant p53 polypeptide has at least one mutation of a wild-type amino acid residue of a p53 nuclear localization signaling domain (e.g., of approximately amino acids 316-325). In some embodiments, a mutant p53 polypeptide has at least one mutation of a wild-type amino acid residue of a p53 homo-oligomerization domain (e.g., of approximately amino acids 307-355). In some embodiments, a mutant p53 polypeptide has at least one mutation of a wild-type amino acid residue of a p53 C-terminal domain (e.g., of approximately amino acids 356-393). In some embodiments, a mutant p53 polypeptide has a mutation of one or more wild-type amino acid residues in one or more p53 domains described herein.
[0105] In some embodiments, methods of the present disclosure involve identification and/or treatment of tumors having one or more mutant p53 nucleotide sequences, e.g., a nucleotide sequence coding for one or more mutant p53 polypeptides described herein. Additional mutant p53 nucleotide sequences are described in, e.g., Levine et al., Nature 351:453-456 (1991).
Platelet Derived Growth Factor Receptor
[0106] Platelet-derived growth factor (PDGF) is produced by a number of cell types, including platelets (see, e.g., Bowen-Pope et al., Arterioscler Thromb Vasc Biol. 31:2397-401, doi: 10.1161/ATVBAHA.108.179556 (2011)). PDGF is a mitogen for mesenchymally-derived cells, such as blood, muscle, bone/cartilage, and connective tissue cells. At least three forms of PDGF are known. Each form consists of a 30 kDa homo- or heterodimeric combination of two genetically distinct, but structurally related, polypeptide chains which are designated A and B chains, respectively. Each chain is synthesized as a propeptide, splice variants exist for the A chain, and C-terminal proteolytic processing occurs for the B chain and perhaps the A chain.
[0107] A number of different cells express PDGF, including fibroblasts, endothelial cells, osteoblasts, platelets, vascular smooth muscle cells, macrophages and Langerhans cells, and fetal fibroblasts. PDGF is a member of a larger family of factors. In addition to PDGF, this family includes the homodimeric factors VEGF (vascular endothelial growth factor) and PIGF (placental growth factor), VEGF/PIGF heterodimers, and CTGF (connective tissue growth factor), a PDGF-like factor secreted by human vascular endothelial cells and fibroblasts.
[0108] At least two distinct human PDGF receptor transmembrane binding proteins are known, a 170 kDa, 1066 amino acid residue alpha-receptor (PDGFR alpha, or PDGFRa) and a 190 kDa, 1074 amino acid residue beta-receptor (PDGFR beta, or PDGFRb) (see, e.g., Yu et al., J. Biochem. Mol. Biol. 36:49-59 (2003)). The two receptor proteins are structurally related and consist of an extracellular portion containing five immunoglobulin-like domains, a single transmembrane region, and an intracellular portion with a protein-tyrosine kinase domain. A nucleotide sequence of a human PDGFRb is disclosed as Genbank Accession No. NM_002609.3 (SEQ ID NO:3), and translated amino acid sequence is set forth as Genbank Accession No. NP_002600.1 (SEQ ID NO:4).
[0109] A functional PDGF receptor is formed when two chains of a dimeric PDGF molecule each bind a receptor, resulting in their approximation, dimerization and activation. High-affinity binding of PDGF involves dimerization of the receptors, forming either homodimers or heterodimers with the alpha and beta receptors/chains. PDGFR alpha binds each of the three forms of PDGF dimers with high affinity. Although PDGFR beta binds both PDGF-BB and PDGF-AB with high affinity, it does not bind to PDGF-AA.
[0110] Cells known to express only alpha-receptors include oligodendroglial progenitors, liver endothelial cells and mesothelium, and platelets. Cells expressing only beta-receptors include CNS capillary endothelium, neurons and Ito (fat storing) cells of the liver, plus monocytes/macrophages. Cells showing coincident expression of alpha and beta receptors include smooth muscle cells, fibroblasts, and Schwann cells.
[0111] The PDGF receptors are receptor tyrosine kinases, and receptor binding by PDGF activates intracellular tyrosine kinase, leading to autophosphorylation of the cytoplasmic domain of the receptor as well as phosphorylation of other intracellular substrates. Specific substrates identified with the beta-receptor include Src, GTPase Activating Protein (GAP), phospholipase C gamma (PLC gamma) and phosphotidylinositol 3-phosphate. In addition, a non-tyrosine phosphorylation-associated signal transduction pathway can also be activated that involves the zinc finger protein erg-1 (early growth response gene 1).
Diagnostic Methods
[0112] Certain methods of the present disclosure utilize the presence and/or level of expression of a mutant p53 gene as a biomarker for use of a PDGFRb inhibitor described herein. In some embodiments, a method is provided for determining the likelihood that a tumor can be effectively treated with a PDGFRb inhibitor. Such methods can include determining presence and/or level of expression and/or activity of a mutant p53 gene in a tumor sample obtained from a subject; and based on the presence and/or level of expression and/or activity of a mutant p53 gene, determining that the tumor sample has an increased or decreased probability, relative to the reference, of being effectively treated with a PDGFRb inhibitor.
[0113] In some embodiments, the level of expression and/or activity of a PDGFR, e.g., a PDGFRb, is used as a biomarker for use of a PDFRb inhibitor described herein. In some embodiments, a level of expression and/or activity of a PDGFR, e.g., a PDGFRb, in a tumor, e.g., a tumor sample, that is higher than a control indicates that the tumor can be effectively treated with a PDGFRb inhibitor. In some embodiments, a control is level of PDGFRb activity and/or expression in a corresponding non-tumor cell, tissue, or biological sample. For example, a level of expression and/or activity of a PDGFRb in a pancreatic, colorectal, or ovarian cancer tumor can be compared to the level of expression and/or activity of a PDGFRb in non-tumor pancreatic, colorectal, or ovarian cell or tissue. In some embodiments, a level of expression and/or activity of a PDGFRb in a pancreatic, colorectal, or ovarian cancer tumor that is higher relative to the level of expression and/or activity of a PDGFRb in non-tumor pancreatic, colorectal, or ovarian cell or tissue, indicates the tumor can be effectively treated with a PDGFRb inhibitor described herein. In some embodiments, if a level of expression and/or activity of a PDGFRb in a pancreatic, colorectal, or ovarian cancer tumor is higher relative to the level of expression and/or activity of a PDGFRb in non-tumor pancreatic, colorectal, or ovarian cell or tissue, the tumor is treated with a PDGFRb inhibitor described herein.
[0114] In one aspect, the disclosure provides a method of determining mutant p53 mRNA expression, polypeptide levels or activity and correlating the results obtained therein with a likelihood of effective treatment with a PDGFRb inhibitor, and/or selecting a subject for treatment with a PDGFRb inhibitor. In another aspect, the disclosure includes a method of determining PDGFRb expression and/or activity in a tumor and correlating the results with likelihood of effective treatment with a PDGFRb inhibitor, and/or selecting a subject for treatment with a PDGFRb inhibitor. Generally, methods include a step of detecting the presence, expression and/or activity of a gene encoding a mutant p53 polypeptide, and/or detecting expression and/or activity of PDGFRb. Gene products can be detected in a tumor sample and can be polypeptides or polynucleotides, e.g., mRNA.
[0115] Nucleic Acid Analysis
[0116] Mutant p53 detection and/or PDGFRb detection at the nucleic acid level is encompassed by embodiments of the present disclosure. Nucleic acid analyses can be performed on genomic DNA, messenger RNAs, and/or cDNA. In many embodiments, nucleic acids are extracted from a biological sample, e.g. a tumor sample. In some embodiments, nucleic acids are analyzed without having been amplified. In some embodiments, nucleic acids are amplified using techniques known in the art (such as polymerase chain reaction (PCR)) and amplified nucleic acids are used in subsequent analyses. Multiplex PCR, in which several amplicons (e.g., from different genomic regions) are amplified at once using multiple sets of primer pairs, may be employed. (see generally, Bustin, S. A., 2000 J. Molecular Endocrinology 25:169-193.) Additional techniques include, but are not limited to, in situ hybridization, Northern blot, and various nucleic acid amplification techniques such as PCR, rtPCR, quantitative rtPCR, and the ligase chain reaction. PCR and considerations for primer design are well known in the art and are described, for example, in Newton, et al. (eds.) PCR: Essential data Series, John Wiley & Sons; PCR Primer: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1995; White, et al. (eds.) PCR Protocols: Current methods and Applications, Methods in Molecular Biology, The Humana Press, Totowa, N.J., 1993.
[0117] Polypeptide Analysis
[0118] Mutant p53 polypeptides and/or PDGFRb polypeptides can be detected using any of a variety of techniques and binding agents. In certain embodiments, a binding agent is an antibody that binds specifically to a mutant p53 polypeptide. The disclosure also encompasses the use of protein arrays, including antibody arrays, for detection of a mutant p53 polypeptide and/or a PDGFRb polypeptide. The use of antibody arrays is described, for example, in Haab et al., Genome Biol. 2(2):2001 (2001). Other types of protein arrays known in the art are useful in the disclosed methods. In general, antibodies that bind specifically to mutant p53 polypeptides and/or PDGFRb polypeptides can be generated by methods well known in the art and described, for example, in Harlow, E, Lane, E, and Harlow, E, (eds.) Using Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, 1998. Details and references for the production of antibodies may also be found in U.S. Pat. No. 6,008,337. Antibodies may include, but are not limited to, polyclonal, monoclonal, chimeric (e.g., humanized), single chain antibodies, Fab fragments, antibodies generated using phage display technology, etc. The invention encompasses the use of fully human antibodies produced using the XenoMouse technology (AbGenix Corp., Fremont, Calif.) according to the techniques described in U.S. Pat. No. 6,075,181. Antibody detection methods are well known in the art including, but are not limited to, enzyme-linked immunosorbent assays (ELISAs) and Western blots. Some such methods are amenable to being performed in an array format.
[0119] In addition, in certain embodiments of the disclosure, mutant p53 polypeptides and/or PDGFRb polypeptides are detected using other specific binding agents known in the art for the detection of polypeptides, such as aptamers (Aptamers, Molecular Diagnosis, Vol. 4, No. 4, 1999), reagents derived from combinatorial libraries for specific detection of proteins in complex mixtures, random peptide affinity reagents, etc. In general, any appropriate binding agent for detecting a polypeptide may be used in conjunction with the present invention, although antibodies may represent a particularly appropriate modality.
[0120] In certain embodiments of the disclosure, a single binding agent (e.g., antibody) is used whereas in other embodiments of the invention multiple binding agents, directed either against the same or against different p53 mutant polypeptides and/or PDGFRb polypeptides can be used to increase the sensitivity or specificity of the detection technique or to provide more detailed information than that provided by a single binding agent. Thus the disclosure encompasses the use of a battery of binding agents that bind to polypeptides encoded by the mutant p53 genes (and/or PDGFRb polypeptides) described herein. In general, polypeptides are detected within a tumor sample that has been obtained from a subject, e.g., a tissue sample, cell sample, cell extract, body fluid sample, etc.
[0121] In certain embodiments, binding can be detected by adding a detectable label to a binding agent. In other embodiments, binding can be detected by using a labeled secondary binding agent that associates specifically with a primary binding agent, e.g., as is well known in the art of antigen/antibody detection. A detectable label may be directly detectable or indirectly detectable, e.g., through combined action with one or more additional members of a signal producing system. Examples of directly detectable labels include radioactive, paramagnetic, fluorescent, light scattering, absorptive and colorimetric labels. Indirectly detectable labels include chemiluminescent labels, e.g., enzymes that are capable of converting a substrate to a chromogenic product such as alkaline phosphatase, horseradish peroxidase and the like.
[0122] Once a labeled binding agent has bound a mutant p53 polypeptide, the complex may be visualized or detected in a variety of ways, with the particular manner of detection being chosen based on the particular detectable label. Representative detection means include, e.g., scintillation counting, autoradiography, measurement of paramagnetism, fluorescence measurement, light absorption measurement, measurement of light scattering and the like. Depending upon the nature of the sample, appropriate detection techniques include, but are not limited to, immunohistochemistry (IHC), radioimmunoassay, ELISA, immunoblotting and fluorescence activated cell sorting (FACS). In the case where the polypeptide is to be detected in a tissue sample, e.g., a biopsy sample, IHC is a particularly appropriate detection technique.
[0123] In certain embodiments, detection techniques of the present disclosure include a negative control, which can involve applying assaying a control sample (e.g., from a normal non-cancerous tissue) so that a signal obtained thereby can be compared with a signal obtained from a tumor sample being tested. In tests in which a secondary binding agent is used to detect a primary binding agent that binds to the polypeptide of interest, an appropriate negative control can involve performing the test on a portion of the sample with the omission of the primary binding agent.
[0124] In general, results of detection techniques can be presented in any of a variety of formats. The results can be presented in a qualitative fashion. For example, a test report may indicate only whether or not a particular p53 mutant polypeptide was detected, perhaps also with an indication of the limits of detection. Results may be presented in a semi-quantitative fashion. For example, various ranges may be defined, and the ranges may be assigned a score (e.g., 0 to 3 where 0 means no binding detected and 3 means strong binding detected) that provides a certain degree of quantitative information. Such a score may reflect various factors, e.g., the number of cells in which a polypeptide is detected, the intensity of the signal (which may indicate the level of expression of a polypeptide), etc. The results may be presented in a quantitative fashion, e.g., as a percentage of cells in which a polypeptide is detected, as a protein concentration, etc.
[0125] Detectable Moieties
[0126] In certain embodiments, certain molecules (e.g., nucleic acid probes, antibodies, etc.) used in accordance with and/or provided by the disclosure comprise one or more detectable entities or moieties, i.e., such molecules are labeled with such entities or moieties. Nonlimiting examples of detectable moieties include, without limitation, fluorescent compounds, various enzymes, prosthetic groups, luminescent materials, bioluminescent materials, fluorescent emitting metal atoms, (e.g., europium (Eu)), radioactive isotopes (described below), quantum dots, electron-dense reagents, and haptens. The detectable moieties can be detected using various means including, but are not limited to, spectroscopic, photochemical, radiochemical, biochemical, immunochemical, or chemical means.
[0127] Nonlimiting exemplary fluorescent detectable moieties include fluorescein, fluorescein isothiocyanate, rhodamine, 5-dimethylamine-1-napthalenesulfonyl chloride, phycoerythrin, and the like. A detectable moiety can also be a detectable enzyme, such as alkaline phosphatase, horseradish peroxidase, beta-galactosidase, acetylcholinesterase, glucose oxidase and the like. When a nanopolymer is derivatized with a detectable enzyme, it can be detected by adding additional reagents that the enzyme uses to produce a detectable reaction product. For example, when the detectable moiety is horseradish peroxidase, the addition of hydrogen peroxide and diaminobenzidine leads to a detectable colored reaction product. A polypeptide can also be derivatized with a prosthetic group (e.g., streptavidin/biotin and avidin/biotin). For example, a polypeptide can be derivatized with biotin and detected through indirect measurement of avidin or streptavidin binding. Nonlimiting examples of fluorescent compounds that can be used as detectable moieties include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride, and phycoerythrin. Luminescent materials include, e.g., luminol, and bioluminescent materials include, e.g., luciferase, luciferin, and aequorin.
[0128] A detectable moiety can also be a radioactive isotope, such as, but not limited to, alpha-, beta-, or gamma-emitters; or beta- and gamma-emitters. Radioactive isotopes can be used in diagnostic or therapeutic applications. Such radioactive isotopes include, but are not limited to, iodine (.sup.131I or .sup.125I), yttrium (.sup.90Y), lutetium (.sup.177Lu), actinium (.sup.225Ac), praseodymium (.sup.142Pr or .sup.143Pr), astatine (.sup.211At), rhenium (.sup.186Re or .sup.187Re), bismuth (.sup.212Bi or .sup.213Bi), indium (.sup.111In), technetium (.sup.99mTc), phosphorus (.sup.32P), rhodium (.sup.188Rh), sulfur (.sup.35S), carbon (.sup.14C), tritium (.sup.3H), chromium (.sup.51Cr), chlorine (.sup.36Cl), cobalt (.sup.57Co or .sup.58Co), iron (.sup.59Fe), selenium (.sup.75Se), and gallium (.sup.67Ga).
[0129] Detection of p53 Mutations
[0130] The disclosure also encompasses the detection of mutations of a p53 gene. Mutations may include, but are not limited to, deletions, additions, substitutions, and amplification of regions of genomic DNA that include all or part of a gene. Methods for detecting such mutations are well known in the art and include direct sequencing, denaturing HPLC and combinations thereof (see, e.g., Segal, N. H. et al., 2003, Am J Pathol, 163: 691-700; Visel, A. et al., 2009, Nature, 457: 854-858). Mutations may result in overexpression or inappropriate expression of p53 (i.e., aberrant expression). Additionally or alternatively mutations may result in an overly activated gene product (e.g., polypeptide). p53 mutations may be analyzed by the exemplary methods below.
[0131] i. Allele-Specific Amplification
[0132] In some embodiments, gene mutations are detected using an allele-specific amplification assay. This approach is variously referred to as PCR amplification of specific allele (PASA) (Sarkar, et al., 1990 Anal. Biochem. 186:64-68), allele-specific amplification (ASA) (Okayama, et al., 1989 J. Lab. Clin. Med. 114:105-113), allele-specific PCR (ASPCR) (Wu, et al. 1989 Proc. Natl. Acad. Sci. USA. 86:2757-2760), and amplification-refractory mutation system (ARMS) (Newton, et al., 1989 Nucleic Acids Res. 17:2503-2516). This method can be used to detect single base substitutions as well as micro deletions/insertions.
[0133] For example, for PCR-based amplification methods, amplification primers may be designed such that they can distinguish between different alleles (e.g., between a wild-type allele and a mutant allele). Thus, the presence or absence of amplification product can be used to determine whether a gene mutation is present in a given nucleic acid sample. In some embodiments, allele specific primers can be designed such that the presence of amplification product is indicative of a gene mutation. In some embodiments, allele specific primers can be designed such that the absence of amplification product is indicative of a gene mutation.
[0134] In some embodiments, two complementary reactions are used. One reaction employs a primer specific for the wild type allele (wild-type-specific reaction) and the other reaction employs a primer for the mutant allele (mutant-specific reaction). The two reactions may employ a common second primer. PCR primers specific for a particular allele (e.g., the wild-type allele or mutant allele) generally perfectly match one allelic variant of the target, but are mismatched to other allelic variant (e.g., the mutant allele or wild-type allele). The mismatch may be located at/near the 3 end of the primer, leading to preferential amplification of the perfectly matched allele. Whether an amplification product can be detected from one or in both reactions indicates the absence or presence of the mutant allele. Detection of an amplification product only from the wild-type-specific reaction indicates presence of the wild-type allele only (e.g., homozygosity of the wild-type allele). Detection of an amplification product in the mutant-specific reaction only indicates presence of the mutant allele only (e.g., homozygosity of the mutant allele). Detection of amplification products from both reactions indicate (e.g., a heterozygote). As used herein, this approach will be referred to as allele specific amplification (ASA).
[0135] Allele-specific amplification can also be used to detect duplications, insertions, or inversions by using a primer that hybridizes partially across the junction. The extent of junction overlap can be varied to allow specific amplification.
[0136] Amplification products can be examined by methods known in the art, including by visualizing (e.g., with one or more dyes) bands of nucleic acids that have been migrated (e.g., by electrophoresis) through a gel to separate nucleic acids by size.
[0137] ii. Allele-Specific Primer Extension
[0138] In some embodiments, an allele-specific primer extension (ASPE) approach is used to detect gene mutations. ASPE employs allele-specific primers that can distinguish between alleles (e.g., between a mutant allele and a wild-type allele) in an extension reaction such that an extension product is obtained only in the presence of a particular allele (e.g., mutant allele or wild-type allele). Extension products may be detectable or made detectable, e.g., by employing a labeled deoxynucleotide in the extension reaction. Any of a variety of labels are compatible for use in these methods, including, but not limited to, radioactive labels, fluorescent labels, chemiluminescent labels, enzymatic labels, etc. In some embodiments, a nucleotide is labeled with an entity that can then be bound (directly or indirectly) by a detectable label, e.g., a biotin molecule that can be bound by streptavidin-conjugated fluorescent dyes. In some embodiments, reactions are done in multiplex, e.g., using many allele-specific primers in the same extension reaction.
[0139] In some embodiments, extension products are hybridized to a solid or semi-solid support, such as beads, matrix, gel, among others. For example, the extension products may be tagged with a particular nucleic acid sequence (e.g., included as part of the allele-specific primer) and the solid support may be attached to an anti-tag (e.g., a nucleic acid sequence complementary to the tag in the extension product). Extension products can be captured and detected on the solid support. For example, beads may be sorted and detected. One such system that can be employed in this manner is the LUMINEX MAP system, which can be adapted for cystic fibrosis mutation detection by TM Bioscience and is sold commercially as a universal bead array (TAG-IT). Additional methods and reagents are described in, e.g., U.S. Patent Publication No. 2008/0138803 A1.
[0140] iii. Single Nucleotide Primer Extension
[0141] In some embodiments, a single nucleotide primer extension (SNuPE) assay is used, in which the primer is designed to be extended by only one nucleotide. In some such methods, the identity of the nucleotide just downstream (e.g., 3) of the 3 end of the primer is known and differs in the mutant allele as compared to the wild-type allele. SNuPE can be performed using an extension reaction in which the only one particular kind of deoxynucleotide is labeled (e.g., labeled dATP, labeled dCTP, labeled dGTP, or labeled dTTP). Thus, the presence of a detectable extension product can be used as an indication of the identity of the nucleotide at the position of interest (e.g., the position just downstream of the 3 end of the primer), and thus as an indication of the presence or absence of a mutation at that position. SNuPE can be performed as described in U.S. Pat. No. 5,888,819; U.S. Pat. No. 5,846,710; U.S. Pat. No. 6,280,947; U.S. Pat. No. 6,482,595; U.S. Pat. No. 6,503,718; U.S. Pat. No. 6,919,174; Piggee et al., Journal of Chromatography A 781 (1997), p. 367-375; Hoogendoom et al., Human Genetics (1999) 104:89-93).
[0142] In some embodiments, primer extension can be combined with mass spectrometry for accurate and fast detection of the presence or absence of a mutation. See, U.S. Pat. No. 5,885,775; U.S. Pat. No. 7,501,251. Suitable mass spectrometric format includes, but is not limited to, Matrix-Assisted Laser Desorption/Ionization, Time-of-Flight (MALDI-TOF), Electrospray (ES), IR-MALDI, Ion Cyclotron Resonance (ICR), Fourier Transform, and combinations thereof.
[0143] iv. Oligonucleotide Ligation Assay
[0144] In some embodiments, an oligonucleotide ligation assay (OLA or OL) is used. OLA employs two oligonucleotides that are designed to be capable of hybridizing to abutting sequences of a single strand of a target molecules. Typically, one of the oligonucleotides is biotinylated, and the other is detectably labeled, e.g., with a streptavidin-conjugated fluorescent moiety. If the precise complementary sequence is found in a target molecule, the oligonucleotides will hybridize such that their termini abut, and create a ligation substrate that can be captured and detected. See e.g., Nickerson et al. (1990) Proc. Natl. Acad. Sci. U.S.A. 87:8923-8927; Landegren et al. (1988) Science 241:1077-1080; and U.S. Pat. No. 4,998,617.
[0145] v. Hybridization Approach
[0146] In some embodiments, nucleic acids are analyzed by hybridization using one or more oligonucleotide probes specific for a region in the gene corresponding to one or more p53 mutations, and under conditions sufficiently stringent to disallow a single nucleotide mismatch. In certain embodiments, suitable nucleic acid probes can distinguish between a normal gene and a mutant gene containing one or more mutations. For example, suitable nucleic acid probes specifically bind to a normal gene but not to a mutant gene. Alternatively, nucleic acid probes specifically bind to a p53 mutant gene containing one or more mutations but not to a normal gene. Probes of the present invention include those that are capable of specifically hybridizing a mutant p53 allele containing one or more mutations. Probes of the present invention also include those that are capable of specifically hybridizing a normal allele in a particular region of the p53 gene and therefore capable of distinguishing a normal allele from a mutant p53 allele. Thus, for example, one of ordinary skill in the art could use probes of the invention to determine whether an individual is homozygous or heterozygous for a particular allele.
[0147] Nucleic acid hybridization techniques are well known in the art. See, e.g., Sambrook, et al., 1989, Molecular Cloning: A Laboratory Manual, Second Edition, Cold Spring Harbor Press, Plainview, N.Y. Those skilled in the art understand how to estimate and adjust the stringency of hybridization conditions such that sequences having at least a desired level of complementary will stably hybridize, while those having lower complementary will not. For examples of hybridization conditions and parameters, see, e.g., Sambrook, et al., 1989, Molecular Cloning: A Laboratory Manual, Second Edition, Cold Spring Harbor Press, Plainview, N.Y.; Ausubel, F. M. et al. 1994, Current Protocols in Molecular Biology. John Wiley & Sons, Secaucus, N.J.
[0148] Nucleic acid probes may comprise ribonucleic acids and/or deoxyribonucleic acids. In some embodiments, nucleic acid probes are oligonucleotides (i.e., oligonucleotide probes). Generally, oligonucleotide probes are long enough to bind specifically to a homologous region of the gene, but short enough such that a difference of one nucleotide between the probe and the nucleic acid sample being tested disrupts hybridization. Typically, the sizes of oligonucleotide probes vary from approximately 10 to 100 nucleotides. In some embodiments, oligonucleotide probes vary from 15 to 90, 15 to 80, 15 to 70, 15 to 60, 15 to 50, 15 to 40, 15 to 35, 15 to 30, 18 to 30, or 18 to 26 nucleotides in length. As appreciated by those of ordinary skill in the art, the optimal length of an oligonucleotide probe may depend on the particular methods and/or conditions in which the oligonucleotide probe may be employed.
[0149] In some embodiments, nucleic acid probes are useful as primers, e.g., for nucleic acid amplification and/or extension reactions. In some embodiments, nucleic acid probes are labeled with a detectable moiety as described herein.
Therapeutic Methods
[0150] Another aspect of the disclosure makes use of therapeutic agents, e.g., PDGFRb inhibitors, to inhibit or reduce PDGFRb activity and/or levels. For example, by preventing transcription, repressing mRNA transcript levels, inhibiting translation, or otherwise directly or indirectly interfering with the activity of PDGFRb, it is possible to treat and/or inhibit tumor cells, e.g., tumor cells having and/or expressing a mutant p53 gene and/or having an increased level of activity and/or expression of PDGFRb relative to control. PDGFRb expression or activity may be modulated either directly through interaction with a PDGFRb gene, mRNA or protein itself, or indirectly through one or more upstream regulator or downstream targets of PDGFRb. Any inhibitor of a PDGFRb can be used in the methods of the disclosure, including nucleic acid, polypeptide, and small molecule inhibitors. Various PDGFR inhibitors are known and/or commercially available. For example, PDGFR inhibitors useful in connection with methods described herein include, but are not limited to, imatinib, sunitinib, axitinib, BIBF1120 (Vargatef), pazopanib, ponatinib, MK-2461, dovitinib, crenolanib, PP-121, telatinib, CP 673451, TSU-68, Ki8751, tivozanib, masitinib, motesanib, regorafenib, and MEDI-575. Additional therapeutic agents, e.g., PDGFRb inhibitors, are described below.
[0151] Antibodies
[0152] The present disclosure encompass the use of antibodies in the treatment of mutant p53-mediated cancers, e.g., pancreatic cancer. Such antibodies include, but are not limited to, polyclonal antibodies; monoclonal antibodies or antigen binding fragments thereof; modified antibodies such as chimeric antibodies, reshaped antibodies, humanized antibodies, or fragments thereof (e.g., Fv, Fab, Fab, F(ab).sub.2); or biosynthetic antibodies, e.g., single chain antibodies, single domain antibodies (DAB), Fvs, or single chain Fvs (scFv). Methods of making and using polyclonal and monoclonal antibodies are well known in the art, e.g., in Harlow et al., Using Antibodies: A Laboratory Manual: Portable Protocol I. Cold Spring Harbor Laboratory (Dec. 1, 1998). Methods for making modified antibodies and antibody fragments (e.g., chimeric antibodies, reshaped antibodies, humanized antibodies, or fragments thereof, e.g., Fab, Fab, F(ab).sub.2 fragments); or biosynthetic antibodies (e.g., single chain antibodies, single domain antibodies (DABs), Fv, single chain Fv (scFv), and the like), are known in the art and can be found, e.g., in Zola, Monoclonal Antibodies: Preparation and Use of Monoclonal Antibodies and Engineered Antibody Derivatives, Springer Verlag (Dec. 15, 2000; 1st edition).
[0153] Aptamers
[0154] Aptamers are macromolecules composed of nucleic acid (e.g., RNA, DNA) that bind tightly to a specific molecular target (e.g., PDGFRb polypeptide or an epitope thereof). A particular aptamer may be described by a linear nucleotide sequence and is typically about 15-60 nucleotides in length. In some embodiments, aptamers are modified to dramatically reduce their sensitivity to degradation by enzymes in the blood for use in in vivo applications. In addition, aptamers can be modified to alter their biodistribution or plasma residence time.
[0155] Selection of aptamers that can bind PDGFRb or a fragment thereof can be achieved through methods known in the art. For example, aptamers can be selected using the SELEX (Systematic Evolution of Ligands by Exponential Enrichment) method (Tuerk, C., and Gold, L., Science 249:505-510 (1990); Jayasena, S. D. Clin. Chem. 45:1628-1650 (1999)).
[0156] Antisense and Ribozymes
[0157] Other agents that are useful in the methods described herein are nucleic acids, including antisense molecules or catalytic nucleic acid molecules (e.g., ribozymes) that specifically hybridize mRNA encoding a target polypeptide. An antisense construct includes the reverse complement of at least part of the cDNA coding sequence or mRNA of a target polypeptide, the target polypeptide cDNA, or gene sequence or flanking regions thereof, and thus it can hybridize to the mRNA.
[0158] The introduced sequence need not be the full-length cDNA or gene or reverse complement thereof, and need not be exactly homologous to the equivalent sequence found in the cell type to be transformed. Antisense molecules can be made using known techniques in the art (see, e.g., Agrawal, Methods in Molecular Biology, Humana Press Inc., 1993, Vol. 20 (Protocols for Oligonucleotides and Analogs)).
[0159] The antisense molecule may be conjugated to another molecule, e.g., a peptide, hybridization triggered cross-linking agent, transport agent, aptamer, or hybridization-triggered cleavage agent. A targeting moiety can also be included that enhances uptake of the molecule by cells. The targeting moiety can be a specific binding molecule, such as an antibody or fragment thereof that recognizes a molecule present on the surface of the cell.
[0160] Alternatively, the agent is a catalytic nucleic acid, such as a ribozyme (a synthetic RNA molecule that possesses highly specific endoribonuclease activity). The production and use of ribozymes are disclosed in, e.g., U.S. Pat. No. 4,987,071 and U.S. Pat. No. 5,543,508. Ribozymes can be synthesized and administered to a cell or a subject, or can be encoded on an expression vector, from which the ribozyme is synthesized in the targeted cell (see, e.g., WO 9523225, and Beigelman et al., Nucl. Acids Res. 23:4434-42, 1995). Examples of oligonucleotides with catalytic activity are described in, e.g., WO 9506764 and WO 9011364, and Sarver et al., Science 247:1222-1225, 1990. The inclusion of ribozyme sequences within antisense RNAs can be used to confer RNA cleaving activity on the antisense RNA, such that endogenous mRNA molecules that bind to the antisense RNA are cleaved, which, in turn, leads to an enhanced antisense inhibition of endogenous gene expression.
[0161] RNA Interference
[0162] Double-stranded nucleic acid molecules that can silence a gene encoding a target polypeptide can also be used as agents in the methods described herein. RNA interference (RNAi) is a mechanism of post-transcriptional gene silencing in which double-stranded RNA (dsRNA) corresponding to a gene (or coding region) of interest is introduced into a cell or an organism, resulting in degradation of the corresponding mRNA. The RNAi effect persists for multiple cell divisions before gene expression is regained. RNAi is therefore an effective method for making targeted knockouts or knockdowns at the RNA level. RNAi has proven successful in human cells, including human embryonic kidney and HeLa cells (see, e.g., Elbashir et al., Nature 411:494-498, 2001). For example, gene silencing can be induced in mammalian cells by the endogenous expression of RNA hairpins (see Paddison et al., PNAS (USA) 99:1443-1448, 2002). In another instances, transfection of small (21-23 nt) dsRNA specifically inhibits gene expression (reviewed in Caplen, Trends Biotechnol. 20:49-51, 2002).
[0163] Briefly, RNAi is thought to work as follows. miRNA, pre-miRNA, pri-miRNA, or dsRNA corresponding to a portion of a gene to be silenced is introduced into a cell. The dsRNA is digested into 21-23 nucleotide siRNAs, or short interfering RNAs. The siRNA duplexes bind to a nuclease complex to form what is known as the RNA-induced silencing complex, or RISC. The RISC targets the homologous transcript by base pairing interactions between one of the siRNA strands and the endogenous mRNA. It then cleaves the mRNA approximately 12 nucleotides from the 3 terminus of the siRNA (reviewed in Sharp et al., Genes Dev. 15: 485-490, 2001; and Hammond et al., Nature Rev. Gen. 2: 110-119, 2001).
[0164] RNAi technology in gene silencing utilizes standard molecular biology methods. dsRNA corresponding to the sequence from a target gene to be inactivated can be produced by standard methods, e.g., by simultaneous transcription of both strands of a template DNA (corresponding to the target sequence) with T7 RNA polymerase. Kits for production of dsRNA for use in RNAi are available commercially, e.g., from New England Biolabs, Inc. Methods of transfection of dsRNA or plasmids engineered to make dsRNA are routine in the art.
[0165] Gene silencing effects similar to those of RNAi have been reported in mammalian cells with transfection of a mRNA-cDNA hybrid construct (Lin et al., Biochem. Biophys. Res. Commun. 281:639-644, 2001), and can be used as another method for gene silencing. Therapeutic applications of RNAi are described, e.g., in Shuey, Drug Discov. Today 7:1040-1046, 2002.
[0166] In addition, siRNA may also be delivered by a gene therapy approach, e.g., using a DNA vector from which siRNA compounds in, e.g., small hairpin form (shRNA), can be transcribed directly. Numerous studies have demonstrated that while double-stranded siRNAs are very effective at mediating RNAi, short, single-stranded, hairpin-shaped RNAs can also mediate RNAi, presumably because they fold into intramolecular duplexes that are processed into double-stranded siRNAs by cellular enzymes (see, e.g., Sui et al., Proc Natl Acad Sci USA, 99:5515-5520 (2002); Yu et al., Proc Natl Acad Sci USA, 99:6047-6052 (2002); Paul et al., Nature Biotech., 20:505-508 (2002); Hannon, Nature. 418:244-251 (2002); Shi, Trends Genet, 19:9-12 (2003); see also Xia et al., Nature Biotech., 20:1006-1010 (2002)).
[0167] Small Molecules
[0168] Small molecule modulators (e.g., inhibitors or activators) of gene expression are also within the scope of the invention and may be detected by screening libraries of compounds using, for example, cell lines that express a PDGFRb polypeptide or a version of a PDGFRb polypeptide that has been modified to include a readily detectable moiety. Methods for identifying compounds capable of modulating gene expression are described, for example, in U.S. Pat. No. 5,976,793.
[0169] Therapeutic Administration
[0170] The route and/or mode of administration of a therapeutic agent described herein can vary depending upon the desired results. Dosage regimens can be adjusted to provide the desired response, e.g., a therapeutic response.
[0171] Methods of administration include, but are not limited to, intradermal, intramuscular, intraperitoneal, intravenous, subcutaneous, intranasal, epidural, oral, sublingual, intracerebral, intravaginal, transdermal, rectal, by inhalation, or topical, particularly to the ears, nose, eyes, or skin. The mode of administration is left to the discretion of the practitioner.
[0172] In some instances, a therapeutic agent described herein is administered locally. This is achieved, for example, by local infusion during surgery, topical application (e.g., in a cream or lotion), by injection, by means of a catheter, by means of a suppository or enema, or by means of an implant, said implant being of a porous, non-porous, or gelatinous material, including membranes, such as sialastic membranes, or fibers. In some situations, a therapeutic agent described herein is introduced into the central nervous system, circulatory system or gastrointestinal tract by any suitable route, including intraventricular, intrathecal injection, paraspinal injection, epidural injection, enema, and by injection adjacent to the peripheral nerve. Intraventricular injection can be facilitated by an intraventricular catheter, for example, attached to a reservoir, such as an Ommaya reservoir.
[0173] This disclosure also features a device for administering a therapeutic agent described herein. The device can include, e.g., one or more housings for storing pharmaceutical compositions, and can be configured to deliver unit doses of a therapeutic agent described herein.
[0174] Pulmonary administration can also be employed, e.g., by use of an inhaler or nebulizer, and formulation with an aerosolizing agent, or via perfusion in a fluorocarbon or synthetic pulmonary surfactant.
[0175] In some instances, a therapeutic agent described herein can be delivered in a vesicle, in particular, a liposome (see Langer, Science 249:1527-1533 (1990) and Treat et al., Liposomes in the Therapy of Infectious Disease and Cancer, pp. 317-327 and pp. 353-365 (1989)).
[0176] In yet other situations, a therapeutic agent described herein can be delivered in a controlled-release system or sustained-release system (see, e.g., Goodson, in Medical Applications of Controlled Release, 2:115-138 (1984)). Other controlled or sustained-release systems discussed in the review by Langer, Science 249:1527-1533 (1990) can be used. In one case, a pump can be used (Langer, Science 249:1527-1533 (1990); Sefton, CRC Crit. Ref Biomed. Eng. 14:201 (1987); Buchwald et al., Surgery 88:507 (1980); and Saudek et al., N. Engl. J. Med. 321:574 (1989)). In yet other situations, a controlled- or sustained-release system can be placed in proximity of a target of a therapeutic agent described herein, reducing the dose to a fraction of the systemic dose.
[0177] A therapeutic agent described herein can be formulated as a pharmaceutical composition that includes a suitable amount of a physiologically acceptable excipient (see, e.g., Remington's Pharmaceutical Sciences pp. 1447-1676 (Alfonso R. Gennaro, ed., 19th ed. 1995)). Such physiologically acceptable excipients can be, e.g., liquids, such as water and oils, including those of petroleum, animal, vegetable, or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. The physiologically acceptable excipients can be saline, gum acacia, gelatin, starch paste, talc, keratin, colloidal silica, urea and the like. In addition, auxiliary, stabilizing, thickening, lubricating, and coloring agents can be used. In one situation, the physiologically acceptable excipients are sterile when administered to an animal. The physiologically acceptable excipient should be stable under the conditions of manufacture and storage and should be preserved against the contaminating action of microorganisms. Water is a particularly useful excipient when a nanoparticle described herein is administered intravenously. Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid excipients, particularly for injectable solutions. Suitable physiologically acceptable excipients also include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol and the like. Other examples of suitable physiologically acceptable excipients are described in Remington's Pharmaceutical Sciences pp. 1447-1676 (Alfonso R. Gennaro, ed., 19th ed. 1995). The pharmaceutical compositions, if desired, can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents.
[0178] Liquid carriers can be used in preparing solutions, suspensions, emulsions, syrups, and elixirs. A therapeutic agent described herein can be suspended in a pharmaceutically acceptable liquid carrier such as water, an organic solvent, a mixture of both, or pharmaceutically acceptable oils or fat. The liquid carrier can contain other suitable pharmaceutical additives including solubilizers, emulsifiers, buffers, preservatives, sweeteners, flavoring agents, suspending agents, thickening agents, colors, viscosity regulators, stabilizers, or osmo-regulators. Suitable examples of liquid carriers for oral and parenteral administration include water (particular containing additives described herein, e.g., cellulose derivatives, including sodium carboxymethyl cellulose solution), alcohols (including monohydric alcohols and polyhydric alcohols, e.g., glycols) and their derivatives, and oils (e.g., fractionated coconut oil and arachis oil). For parenteral administration the carrier can also be an oily ester such as ethyl oleate and isopropyl myristate. The liquid carriers can be in sterile liquid form for administration. The liquid carrier for pressurized compositions can be halogenated hydrocarbon or other pharmaceutically acceptable propellant.
[0179] In other instances, a therapeutic agent described herein is formulated for intravenous administration. Compositions for intravenous administration can comprise a sterile isotonic aqueous buffer. The compositions can also include a solubilizing agent. Compositions for intravenous administration can optionally include a local anesthetic such as lignocaine to lessen pain at the site of the injection. The ingredients can be supplied either separately or mixed together in unit dosage form, for example, as a dry lyophilized powder or water-free concentrate in a hermetically sealed container such as an ampule or sachette indicating the quantity of active agent. Where a therapeutic agent described herein is administered by infusion, it can be dispensed, for example, with an infusion bottle containing sterile pharmaceutical grade water or saline. Where a therapeutic agent described herein is administered by injection, an ampule of sterile water for injection or saline can be provided so that the ingredients can be mixed prior to administration.
[0180] In other circumstances, a therapeutic agent described herein can be administered across the surface of the body and the inner linings of the bodily passages, including epithelial and mucosal tissues. Such administrations can be carried out using a therapeutic agent described herein in lotions, creams, foams, patches, suspensions, solutions, and suppositories (e.g., rectal or vaginal). In some instances, a transdermal patch can be used that contains a therapeutic agent described herein and a carrier that is inert to the therapeutic agent described herein, is non-toxic to the skin, and that allows delivery of the agent for systemic absorption into the blood stream via the skin. The carrier can take any number of forms such as creams or ointments, pastes, gels, or occlusive devices. The creams or ointments can be viscous liquid or semisolid emulsions of either the oil-in-water or water-in-oil type. Pastes of absorptive powders dispersed in petroleum or hydrophilic petroleum containing a therapeutic agent described herein can also be used. A variety of occlusive devices can be used to release a therapeutic agent described herein into the blood stream, such as a semi-permeable membrane covering a reservoir containing the therapeutic agent described herein with or without a carrier, or a matrix containing the therapeutic agent described herein.
[0181] A therapeutic agent described herein can be administered rectally or vaginally in the form of a conventional suppository. Suppository formulations can be made using methods known to those in the art from traditional materials, including cocoa butter, with or without the addition of waxes to alter the suppository's melting point, and glycerin. Water-soluble suppository bases, such as polyethylene glycols of various molecular weights, can also be used.
[0182] The amount of a therapeutic agent described herein that is effective for treating disorder or disease is determined using standard clinical techniques known to those with skill in the art. In addition, in vitro or in vivo assays can optionally be employed to help identify optimal dosage ranges. The precise dose to be employed can also depend on the route of administration, the condition, the seriousness of the condition being treated, as well as various physical factors related to the individual being treated, and can be decided according to the judgment of a health-care practitioner. For example, the dose of a therapeutic agent described herein can each range from about 0.001 mg/kg to about 250 mg/kg of body weight per day, from about 1 mg/kg to about 250 mg/kg body weight per day, from about 1 mg/kg to about 50 mg/kg body weight per day, or from about 1 mg/kg to about 20 mg/kg of body weight per day. Equivalent dosages can be administered over various time periods including, but not limited to, about every 2 hr, about every 6 hr, about every 8 hr, about every 12 hr, about every 24 hr, about every 36 hr, about every 48 hr, about every 72 hr, about every week, about every 2 weeks, about every 3 weeks, about every month, and about every 2 months. The number and frequency of dosages corresponding to a completed course of therapy can be determined according to the judgment of a health-care practitioner.
[0183] In some instances, a pharmaceutical composition described herein is in unit dosage form, e.g., as a tablet, capsule, powder, solution, suspension, emulsion, granule, or suppository. In such form, the pharmaceutical composition can be sub-divided into unit doses containing appropriate quantities of a therapeutic agent described herein. The unit dosage form can be a packaged pharmaceutical composition, for example, packeted powders, vials, ampoules, pre-filled syringes or sachets containing liquids. The unit dosage form can be, for example, a capsule or tablet itself, or it can be the appropriate number of any such compositions in package form. Such unit dosage form can contain from about 1 mg/kg to about 250 mg/kg, and can be given in a single dose or in two or more divided doses.
Kits
[0184] Another aspect of the disclosure provides a kit to test for the presence of a mutant p53, e.g., in a tumor sample. The kit can comprise, for example, an antibody for detection of a polypeptide or a probe for detection of a polynucleotide. In addition, the kit can include a reference or control sample, instructions for processing samples, performing the test and interpreting the results, buffers and other reagents necessary for performing the test. In one embodiment the kit comprises one or more PDGFRb inhibitors described herein. In certain embodiments, the kit includes instructions for administering one or more PDGFRb inhibitors if a mutant p53 is detected in the tumor sample.
Cancers
[0185] The disclosure includes treatment methods for various cancers, including, but not limited to, solid tumors and blood born tumors. In some embodiments, the cancer is a cancer of skin tissues, organs, bone, cartilage, blood and vessels. In some embodiments, the cancer is a cancer of the head, neck, eye, mouth, throat, esophagus, chest, bone, lung, colon, rectum, stomach, prostate, breast, ovaries, kidney, liver, pancreas and brain. In some embodiments, a cancer encompasses primary and/or metastatic cancers.
[0186] In some embodiments, methods described herein are used to treat and/or prevent pancreatic cancer, e.g., treat and/or prevent metastasis of a pancreatic tumor, e.g., a pancreatic tumor having or expressing a mutant p53 gene. In some embodiments, the pancreatic cancer is exocrine pancreatic cancer or endocrine pancreatic cancer. Exocrine pancreatic cancer includes, but not limited to, adenocarcinomas, acinar cell carcinomas, adenosquamous carcinomas, colloid carcinomas, undifferentiated carcinomas with osteoclast-like giant cells, hepatoid carcinomas, intraductal papillary-mucinous neoplasms, mucinous cystic neoplasms, pancreatoblastomas, serous cystadenomas, signet ring cell carcinomas, solid and pseuodpapillary tumors, pancreatic ductal carcinomas, and undifferentiated carcinomas. In some embodiments, the exocrine pancreatic cancer is pancreatic ductal carcinoma. Endocrine pancreatic cancer includes, but is not limited to, insulinomas and glucagonomas.
[0187] In some embodiments, the pancreatic cancer is early stage pancreatic cancer, non-metastatic pancreatic cancer, primary pancreatic cancer, advanced pancreatic cancer, locally advanced pancreatic cancer, metastatic pancreatic cancer, unresectable pancreatic cancer, pancreatic cancer in remission, or recurrent pancreatic cancer. In some embodiments, the pancreatic cancer is resistant to one or more known therapies. In some embodiments, the pancreatic cancer is resectable (i.e., tumors that are confined to a portion of the pancreas or has spread just beyond it that allows for complete surgical removal), or locally advanced (unresectable) (i.e., the localized tumors may be unresectable because of local vessel impingement or invasion by tumor). In some embodiments, the pancreatic cancer is, according to American Joint Committee on Cancer (AJCC) TNM classifications, a stage 0 tumor (the tumor is confined to the top layers of pancreatic duct cells and has not invaded deeper tissues, and it has not spread outside of the pancreas (e.g., pancreatic carcinoma in situ or pancreatic intraepithelial neoplasia III), a stage IA tumor (the tumor is confined to the pancreas and is less than 2 cm in size, and it has not spread to nearby lymph nodes or distinct sites), a stage IB tumor (the tumor is confined to the pancreas and is larger than 2 cm in size, and it has not spread to nearby lymph nodes or distant sites), a stage IIA tumor (the tumor is growing outside the pancreas but not into large blood vessels, and it has not spread to nearby lymph nodes or distant sites), stage IIB (the tumor is either confined to the pancreas or growing outside the pancreas but not into nearby large blood vessels or major nerves, and it has spread to nearby lymph nodes but not distant sites), stage III (the tumor is growing outside the pancreas into nearby large blood vessels or major nerves, and it may or may not have spread to nearby lymph nodes) or stage IV tumor (the cancer has spread to distant sites).
[0188] The methods provided herein can be used to treat a subject who has been diagnosed with pancreatic cancer and has been treated with a prior therapy (e.g., gemcitabine-based, erlotinib-based, or 5-fluorouracil-based therapy). In some embodiments, a subject is a human. In some embodiments, a human subject is at least about 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, or 85 years old. In some embodiments, a subject has a family history of pancreatic cancer (e.g., at least 2 first-degree relatives affected with pancreatic cancer without accumulation of other cancers or familial diseases). In some embodiments, a subject has one or more hereditary pancreatic cancer syndromes, including, but not limited to, BRCA2 mutation, familial atypical multiple mole melanoma (FAMMM), peutz-jeghers syndrome, and hereditary pancreatitis. In some embodiments, a subject is a long-time smoker (e.g., more than 10, 15, or 20 years). In some embodiments, a subject has ECOG/WHO/Zubrod score of 0 (asymptomatic), 1 (symptomatic but completely ambulatory), 2 (symptomatic, <50% in bed during the day), 3 (symptomatic, >50% in bed, but not bedbound), or 4 (bedbound). In some embodiments, a subject has a single lesion at presentation. In some embodiments, a subject has multiple lesions at presentation. In some embodiments, a subject is a human who exhibits one or more symptoms associated with pancreatic cancer.
[0189] The methods described herein are useful for various aspects of pancreatic cancer treatment. In some embodiments, the disclosure provides methods of inhibiting pancreatic cancer cell proliferation (such as pancreatic cancer tumor growth) in a subject, comprising administering to the subject an effective amount of a PDGFRb inhibitor described herein. In some embodiments, at least about 10%, 20%, 30%, 40%, 60%, 70%, 80%, 90%, or 100% cell proliferation is inhibited.
[0190] In some embodiments, the disclosure provides methods of inhibiting tumor metastasis, e.g., pancreatic cancer tumor metastasis, in a subject, comprising administering to the subject an effective amount of a PDGFRb inhibitor described herein. In some embodiments, at least about 10%, 20%, 30%, 40%, 60%, 70%, 80%, 90%, or 100% metastasis is inhibited. In some embodiments, a method of inhibiting metastasis to one or more lymph nodes is provided.
[0191] In some embodiments, the disclosure provides methods of reducing (such as eradiating) pre-existing tumor metastasis, e.g., pancreatic cancer tumor metastasis (such as metastasis to the lymph node) in a subject, comprising administering to the subject an effective amount of a PDGFRb inhibitor described herein. In some embodiments, metastasis is reduced by at least about 10%, 20%, 30%, 40%, 60%, 70%, 80%, 90%, or 100%.
[0192] In some embodiments, the disclosure provides methods of reducing tumor size, e.g., pancreatic cancer tumor size, in a subject, comprising administering to the individual an effective amount of a PDGFRb inhibitor described herein. In some embodiments, tumor size is reduced at least about 10%, 20%, 30%, 40%, 60%, 70%, 80%, 90%, or 100%. In some embodiments, the subject has non-metastatic pancreatic cancer. In some embodiments, the subject has primary pancreatic cancer.
[0193] In some embodiments, the disclosure provides methods of prolonging time to disease progression of cancer, e.g., pancreatic cancer (e.g., progression-free survival) in a subject, comprising administering to the subject an effective amount of a PDGFRb inhibitor described herein. In some embodiments, administration of a PDGFRb inhibitor prolongs the time to disease progression by at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 weeks. In some embodiments, administration of a PDGFRb inhibitor prolongs the time to disease progression by at least 1.0, 1.2, 1.4, 1.6, 1.8, 2.0, 2.2, 2.4, 2.6, 2.8, 3.0, 3.2, 3.4, 3.6, 3.8, 4.0, 4.2, 4.4, 4.6, 4.8, 5.0, 5.2, 5.4, 5.6, 5.8, 6.0, 6.2, 6.4, 6.6, 6.8, 7.0, 7.2, 7.4, 7.6, 7.8, 8.0, 8.2, 8.4, 8.6, 8.8, 9.0, 9.2, 9.4, 9.6, 9.8, 10.0, 10.2, 10.4, 10.6, 10.8, 11.0, 11.2, 11.4, 11.6, 11.8, 12.0, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 30, 36, 42, 48, 54, 60, 66, or 72 months.
[0194] In some embodiments, the disclosure provides methods of prolonging overall survival of a subject having cancer, e.g., pancreatic cancer, comprising administering to the subject an effective amount of a PDGFRb inhibitor described herein. In some embodiments, administration of a PDGFRb inhibitor prolongs the survival of the subject by at least 1.0, 1.2, 1.4, 1.6, 1.8, 2.0, 2.2, 2.4, 2.6, 2.8, 3.0, 3.2, 3.4, 3.6, 3.8, 4.0, 4.2, 4.4, 4.6, 4.8, 5.0, 5.2, 5.4, 5.6, 5.8, 6.0, 6.2, 6.4, 6.6, 6.8, 7.0, 7.2, 7.4, 7.6, 7.8, 8.0, 8.2, 8.4, 8.6, 8.8, 9.0, 9.2, 9.4, 9.6, 9.8, 10.0, 10.2, 10.4, 10.6, 10.8, 11.0, 11.2, 11.4, 11.6, 11.8, 12.0, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 30, 36, 42, 48, 54, 60, 66, or 72 months.
[0195] In some embodiments, the disclosure provides methods of disrupting (such as destroying) pancreatic cancer stroma of a subject having pancreatic cancer, comprising administering to the subject an effective amount of a PDGFRb inhibitor described herein. In some embodiments, the pancreatic cancer stroma is disrupted or destroyed by at least about 10%, 20%, 30%, 40%, 60%, 70%, 80%, 90%, or 100%. In some embodiments, the subject has non-metastatic pancreatic cancer. In some embodiments, the subject has primary pancreatic cancer.
[0196] In some embodiments, the disclosure provides methods of improving one or more clinical benefits of a subject having cancer, e.g., pancreatic cancer, comprising administering to the subject an effective amount of a PDGFRb inhibitor described herein. Clinical benefits include, but are not limited to, improved/better quality of life, improved/better symptom control of cancer, e.g., pancreatic cancer, and increased weight gain.
Combination Therapy
[0197] In some embodiments, a PDGFRb inhibitor described herein is administered to a subject in combination with one or more additional therapies, e.g., to treat a tumor and/or one or more symptoms of a tumor. For example, a PDGFRb inhibitor can be administered in combination with one or more additional anticancer ingredients or drugs. Such anticancer ingredients include known anticancer therapies including, but are not limited to, an antifolate, a 5-fluoropyrimidine (including 5-fluorouracil), a cytidine analogue such as -L-1,3-dioxolanyl cytidine or -L-1,3-dioxolanyl 5-fluorocytidine, an antimetabolite (including purine antimetabolites, cytarabine, fudarabine, floxuridine, 6-mercaptopurine, methotrexate, and 6-thioguanine), hydroxyurea, a mitotic inhibitor (including CPT-11, Etoposide (VP-21), taxol, and vinca alkaloids such as vincristine and vinblastine), an alkylating agent (including but not limited to busulfan, chlorambucil, cyclophosphamide, ifofamide, mechlorethamine, melphalan, and thiotepa), a nonclassical akylating agent, a platinum containing compound, bleomycin, an anti-tumor antibiotic, an anthracycline such as doxorubicin and dannomycin, an anthracenedione, a topoisomerase II inhibitor, a hormonal agent (including but not limited to a corticosteriod (dexamethasone, prednisone, and methylprednisone), an androgen such as fluoxymesterone and methyltestosterone), an estrogen such as diethylstilbesterol, an antiestrogen such as tamoxifen, an LHRH analogue such as leuprolide, an antiandrogen such as flutamdie, aminogluetethimide, megestrol acetate, and medroxyprogesterone, asparaginase, carmustine, lomustine, hexamethyl-melamine, dacarbazine, mitotane, streptozocin, cisplatin, carboplatin, levamasole, and leucovorin. The compounds of the present invention can also be used in combination with an enzyme therapy agent and/or immune system modulator such as an interferon, interleukin, tumor necrosis factor, macrophage colony-stimulating factor and colony stimulating factor. In some embodiments, a PDGFRb inhibitor is administered in combination with one or more of gemcitabine (e.g., GEMZAR), erlotinib (e.g., TARCEVA), gefitinib, a taxane (e.g., paclitaxel, docetaxel), capecitabine, mitomycin and/or irinotecan.
[0198] In some embodiments, combined administration of a PDGFRb inhibitor and a second agent results in an improvement in a disease or disorder described herein or a symptom thereof to an extent that is greater than one produced by either the PDGFRb inhibitor or the second agent alone. The difference between the combined effect and the effect of each agent alone can be a statistically significant difference.
[0199] In some embodiments, combined administration of a PDGFRb inhibitor and a second agent allows administration of the second agent at a reduced dose, at a reduced number of doses, and/or at a reduced frequency of dosage compared to a standard dosing regimen approved for the second agent.
Identifying Modulators of PDGFRb Expression or Activity
[0200] PDGFRb described herein are useful for identifying agents that can be potentially used to treat a disorder described herein, e.g., a cancer. For example, an agent that decreases expression or activity of a PDGFRb can be identified as an agent that can be used to treat cancer. Numerous methods exist for evaluating whether an agent alters a PDGFRb polypeptide expression activity or level. In one embodiment, the ability of a test agent to modulate (e.g., increase or decrease) (e.g., permanently or temporarily) expression from a PDGFRb polynucleotide promoter is evaluated by e.g., routine reporter (e.g., LacZ, luciferase, or GFP) transcription assay. For example, a cell or transgenic animal whose genome comprises a reporter gene operably linked to a PDGFRb polynucleotide promoter, can be contacted with a test agent, and the ability of the test agent to increase or decrease reporter activity is indicative of the ability of the agent to modulate a PDGFRb polypeptide.
[0201] In some embodiments, effects of a test agent on a PDGFRb polypeptide expression activity or level can be evaluated in a cell, cell lysate, or subject, preferably a non-human experimental mammal, and more preferably a rodent (e.g., a rat, mouse, rabbit), or explant thereof. Methods of assessing a PDGFRb polypeptide expression are well known in the art, e.g., Northern analysis, ribonuclease protection assay, reverse transcription-polymerase chain reaction (RT-PCR) or RNA in situ hybridization (see, e.g., Sambrook et al. Molecular Cloning: A Laboratory Manual (3rd ed. 2001)). The level of a PDGFRb polypeptide can be monitored by, e.g., Western analysis, immunoassay, or in situ hybridization. In some embodiments, a DNA construct encoding a PDGFRb polypeptide/GFP fusion protein is transfected into cells, and level of GFP fluorescence in the presence or absence of a test agent is determined. A decrease in fluorescence in the presence of the test agent is indicative of the ability of the test agent to decrease a PDGFRb polypeptide level.
[0202] Agents and test agents to be used in the methods described herein include crude or partially or substantially purified extracts of organic sources, e.g., botanical (e.g., herbal) and algal extracts, inorganic elements or compounds, as well as partially or substantially purified or synthetic agents, e.g., small molecules, polypeptides, antibodies, and polynucleotides, and libraries of these.
[0203] In one example, combinatorial chemical libraries can be produced or obtained that sample chemical compounds that are structurally or chemically related or unrelated. Preparation and screening of combinatorial chemical libraries is well known to those of skill in the art. Such combinatorial chemical libraries include, but are not limited to, peptide libraries (see, e.g., U.S. Pat. No. 5,010,175; Furka, Int. J. Pept. Prot. Res. 37:487-493 (1991); and Houghton et al., Nature 354:84-88 (1991)). Other chemistries for generating chemical diversity libraries can also be used. Such chemistries include, but are not limited to: peptoids (e.g., PCT Publication No. WO 91/19735), encoded peptides (e.g., PCT Publication No. WO 93/20242), random bio-oligomers (e.g., PCT Publication No. WO 92/00091), benzodiazepines (e.g., U.S. Pat. No. 5,288,514), diversomers such as hydantoins, benzodiazepines and dipeptides (Hobbs et al., Proc. Nat. Acad. Sci. USA 90:6909-6913 (1993)), vinylogous polypeptides (Hagihara et al., J. Amer. Chem. Soc. 114:6568 (1992)), nonpeptidal peptidomimetics with glucose scaffolding (Hirschmann et al., J. Amer. Chem. Soc. 114:9217-9218 (1992)), analogous organic syntheses of small compound libraries (Chen et al., J. Amer. Chem. Soc. 116:2661 (1994)), oligocarbamates (Cho et al., Science 261:1303 (1993)), and/or peptidyl phosphonates (Campbell et al., J. Org. Chem. 59:658 (1994)), nucleic acid libraries, peptide nucleic acid libraries (see, e.g., U.S. Pat. No. 5,539,083), antibody libraries (see, e.g., Vaughn et al., Nature Biotechnology, 14(3):309-314 (1996) and PCT/US96/10287), carbohydrate libraries (see, e.g., Liang et al., Science, 274:1520-1522 (1996) and U.S. Pat. No. 5,593,853), and small organic molecule libraries (see, e.g., benzodiazepines, Baum C&EN, January 18, page 33 (1993); isoprenoids, U.S. Pat. No. 5,569,588; thiazolidinones and metathiazanones, U.S. Pat. No. 5,549,974; pyrrolidines, U.S. Pat. Nos. 5,525,735 and 5,519,134; morpholino compounds, U.S. Pat. No. 5,506,337; benzodiazepines, U.S. Pat. No. 5,288,514, and the like).
[0204] All publications, patent applications, patents, and other references mentioned herein are incorporated by reference in their entirety. In addition, the materials, methods, and examples are illustrative only and not intended to be limiting. Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, suitable methods and materials are described herein.
[0205] The disclosure is further illustrated by the following examples. The examples are provided for illustrative purposes only. They are not to be construed as limiting the scope or content of the disclosure in any way.
Examples
[0206] In the Examples described herein, several orthogonal approaches and models were combined to systematically explore the molecular basis whereby mutant p53 promotes invasion and metastasis in PDAC and the clinical implications of its effects. These studies identified the platelet-derived growth factor receptor beta (PDGFRb) as necessary and sufficient to mediate the effects of mutant p53 on invasion and metastasis in both a murine model and human PDAC cells. Further, elevated PDGFRb expression was identified as an indicator of poor metastasis-free survival in human PDAC patients. Taken together, these data identify a key mediator of mutant p53 activity and indicate that PDGFRb inhibitors can act as anti-metastatic agents in patients with tumors expressing mutant p53.
Methods and Materials
Retroviral Constructs, Antibodies and Reagents
[0207] All vectors were derived from the Murine Stem Cell Virus (MSCV, Clontech) retroviral vector backbone. PDGFRb cDNA (Addgene, #23893) was subcloned into MSCV-PGK-Puro-IRES-GFP (MSCV-PIG) (Hemann et al. 2003). miR30-based shRNAs were designed and cloned as previously described (Zuber et al. 2011), and the sequences are provided below:
TABLE-US-00001 target gene name organism sequence p53 1224 mouse TGCTGTTGACAGTGAGCGCCCACT ACAAGTACATGTGTAATAGTGAAG CCACAGATGTATTACACATGTACT TGTAGTGGATGCCTACTGCCTCGG p53 703 mouse TGCTGTTGACAGTGAGCGCCCGGG TGGAAGGAAATTTGTATAGTGAAG CCACAGATGTATACAAATTTCCTT CCACCCGGATGCCTACTGCCTCGG p53 393 mouse TGCTGTTGACAGTGAGCGACCCTG TCATCTTTTGTCCCTTTAGTGAAG CCACAGATGTAAAGGGACAAAAGA TGACAGGGGTGCCTACTGCCTCGG p53 996 human Tgctgttgacagtgagcgcctgga agactccagtggtaattagtgaag ccacagatgtaattaccactggag tcttccagttgcctactgcctcgg a p53 2057 human tgctgttgacagtgagcgcggagg atttcatctcttgtattagtgaag ccacagatgtaatacaagagatga aatcctccatgcctactgcctcgg a Pdgfrb 544 mouse TGCTGTTGACAGTGAGCGATGGGC CAGAGTTTGTTCTCAATAGTGAAG CCACAGATGTATTGAGAACAAACT CTGGCCCAGTGCCTACTGCCTCGG Pdgfrb 5241 mouse TGCTGTTGACAGTGAGCGCCACAA TGGTACCAAAGATAGATAGTGAAG CCACAGATGTATCTATCTTTGGTA CCATTGTGATGCCTACTGCCTCGG Pdgfrb 4778 human TGCTGTTGACAGTGAGCGACAGCA CTAACATTCTAGAGTATAGTGAAG CCACAGATGTATACTCTAGAATGT TAGTGCTGGTGCCTACTGCCTCGG Pdgfrb 3204 human TGCTGTTGACAGTGAGCGACAGTT CTACAATGCCATCAAATAGTGAAG CCACAGATGTATTTGATGGCATTG TAGAACTGCTGCCTACTGCCTCGG p73 254 mouse TGCTGTTGACAGTGAGCGACCCAC TCTTGAAGAAGTTGTATAGTGAAG CCACAGATGTATACAACTTCTTCA AGAGTGGGGTGCCTACTGCCTCGG p73 3827 mouse TGCTGTTGACAGTGAGCGACAGCT TTGTGCATCCAATTAATAGTGAAG CCACAGATGTATTAATTGGATGCA CAAAGCTGGTGCCTACTGCCTCGG NF-YB 1 mouse TGCTGTTGACAGTGAGCGACTAGG GATTTCTGCAGACTAATAGTGAAG CCACAGATGTATTAGTCTGCAGAA ATCCCTAGCTGCCTACTGCCTCGG NF-YB 2 mouse TGCTGTTGACAGTGAGCGCCAGGA GAAGCGGAAGACAATATAGTGAAG CCACAGATGTATATTGTCTTCCGC TTCTCCTGATGCCTACTGCCTCGG Ctrl 1 TGCTGTTGACAGTGAGCGCAGGAA TTATAATGCTTATCTATAGTGAAG CCACAGATGTATAGATAAGCATTA TAATTCCTATGCCTACTGCCTCGG Ctrl 2 tgctgttgacagtgagcgcccgcc tgaagtctctgattaatagtgaag ccacagatgtattaatcagagact tcaggcggttgcctactgcctcgg a
[0208] shRNAs were cloned into the MLP vector (MSCV-mir30-PGK-Puro-IRES-GFP) for constitutive expression, and inducible shRNAs were cloned into the TRMPV-Neo vector (pSIN-TRE-dsRed-miR30-PGK-Venus-IRES-NeoR) as previously described (Zuber et al. 2011). All constructs were verified by sequencing.
[0209] p53 was detected using mAb NCL-P53-505 (Novocastra) and hAB OP43 (Calbiochem). Anti-Actin (A3854) was purchased from Sigma. Anti-PDGFRa (3164) and -PDGFRb (3169) antibodies were purchased from Cell Signaling. Alexa Fluor 568-Phalloidin (A12380) was purchased from Invitrogen. Crenolanib (CP-868596) and imatinib (1-5508) were purchased from Selleckchem and LC Laboratories, respectively.
Cell Culture and Drug Treatments
[0210] All cell lines were maintained in DMEM+10% FBS, at 37 C. in 5% CO.sub.2. Stable cell lines expressing shRNAs were generated by retroviral mediated gene transfer. Briefly, Phoenix or Ampho packaging cells (for murine or human cell lines, respectively) were transfected by the calcium phosphate method with vectors expressing NF-YA, NF-YB, p53, p73, PDGFRa, PDGFRb or Renilla-control shRNAs, and the generated viruses were harvested to infect KPC, KP.sub.flC, or a series of human pancreatic, breast, lung and colon cancer cell lines. Infected cells were selected with puromycin and experiments were carried out on derived cell populations. To generate cells stably expressing mutant p53, p73 or PDGFRb, KP.sub.flC cells were infected with MSCV-p53-R175H, -R273H, PDGFRb or pcDNA3-HA-p73 and selected in puromycin and G418 respectively to yield stable pools. Cultured cells were treated with 300 nm crenolanib and 3 M imatinib. These concentrations were selected after determining the concentration required to fully inhibit the phosphorylation of PDGFRb without any effects on cell proliferation.
Wound Healing and Invasion Assays
[0211] Wound healing assays were conducted as previously described (Goulimari et al., 2005). Briefly, cells were seeded in 6-well plates, grown until confluent, and wounding was performed with a 10-l microtiter tip that was cut longitudinally. Three-dimensional invasion assays were carried out as previously described (Kitzing et al., 2007). In brief, 24-well transwell inserts (Greiner bio-one) were lined with collagen type 1 (BD Biosciences), and cells were seeded on the inverted inserts. The lower chambers were filled with medium containing 0.5% FBS and upper chambers containing the collagen matrix were filled with medium containing 20% FBS and the chemoattractant HGF.
Immunostaining and Microscopy
[0212] Live cell recordings were performed immediately after wounding for 18 h at 37 C. using a Zeiss observer Microscope. Pictures were acquired every 10 min with a motor-controlled Leica DC 350 FX camera, which enables simultaneous recordings from multiple wells. For statistical analysis, the wound distance from each well was measured in duplicate at three randomly defined wound gap locations per frame recorded per experiment. Invasion assay inserts were fixed using 4% formaldehyde and stained using DAPI and Alexa568 phalloidin (Invitrogen) before confocal microscopy (Perkin Elmer Spinning Disk) was conducted. Images were analyzed using Imaris software.
RT-qPCR
[0213] Total RNA was isolated using TRIZOL (Invitrogen), and cDNA was obtained using the TaqMan reverse transcription reagents (Applied Biosystems). Real-time PCR was carried out in triplicate using SYBR Green PCR Master Mix (Applied Biosystems) on the ViiA 7 Real-Time PCR System (Invitrogen). GAPDH or -actin served as endogenous normalization controls. Primer sequences are listed below:
TABLE-US-00002 PrimersequencesforRT-qPCR genesymbol FWDprimer RVSprimer mPDGFRB.1 TTCCAGGAGTG AGGGGGCGTGA ATACCAGCTT TGACTAGG mPDGFRB.2 CGCCAGGGCGA CGCCCACTCTT GAGCATCAC CATGCGGGG mPDGFRA.1 TCCATGCTAGA TCCCGGTGGAC CTCAGAAGTCA ACAATTTTTC mPDGFRA.2 ATGAGAGTGAG CGGCAAGGTAT ATCGAAGGCA GATGGCAGAG hPDGFRB.1 AGACACGGGAG AGTTCCTCGGC AATACTTTTGC ATCATTAGGG hPDGFRB.2 GCAAAACCACC GGGTGATGTTC ATTGGGGAC TCACCCTGG Trp73.1 CCACCTGCAGA TCATGGCTCTG ACCTTACCA CTTCAGGTC Trp73.2 AAAATGGAGCT TGGCGTCTCTT GCCAGCAAAC CTTCACGTTG Actin Gapdh
RNA Sequencing and Data Analysis
[0214] Nucleotide sequencing of RNAs of >200 nt length was carried out us previously described (Djebali et al., 2012). Directional (stranded) libraries for Paired End (PE) sequencing on the Illumina platform were generated as described previously (Parkhomchuck et al., 2009). Primary data processing and library mapping was completed using the Spliced Transcripts Alignment to a Reference (STAR) software (Dobin et al., 2013). Differential expression analysis for sequence count data (FPKM values) was conducted using DESeq as described previously (Anders and Huber, 2010).
PDGFRb Luciferase Reporter Assay
[0215] The promoter assay was performed as previously described (Hackzell et al., 2002). In brief, cells were seeded in 24-well plates and transiently transfected with 0.5 ug of expression plasmid, 2.0 ug of reporter plasmid, and 20 ng of renilla-luciferase vector (PGL4.74, Promega). After 36 h, cells were lysed (Dual-Luciferase Reporter Assay System, Promega), and firefly luciferase and renilla activities were measured (Varioskan Flash Multimode Reader, Thermo Scientific). Results shown were normalized to renilla activity and are representative of at least three independent replicates.
Immunoprecipitation
[0216] To detect p53/p73 and p73/NF-Y binding, sub-confluent KP.sub.flC cells were infected with mutant p53 or an empty control construct and transiently transfected with HA.p73 (Addgene) using Lipofectamine 2000 (Invitrogen). Thirty-six hours post-transfection, cells were lysed in RIPA Buffer (20 mM Tris pH 7.4, 1% TritonX-100, 37 mM NaCl, 2 mM EDTA, 1% SDS, 0.5% NP-40, 10% Glycerol, phosphatase inhibitors [2.5 mM Sodium pyrophosphate, 1 mM -Glycerophosphate, 1 mM Na.sub.3VO.sub.4], and protease inhibitors [Roche]). Whole cell lysates (0.5 mg protein) were pre-cleared with A/G Sepharose beads (Invitrogen), incubated at 4 C. with either anti-HA (Covance, 16B12) or anti-p53 antibody (Calbiochem, OP43) overnight and subsequently with protein A/G beads for 2 hr. The bead pellet was extensively washed in lysis buffer three times and then electrophoresed on 10% SDS-PAGE gels followed by immunoblotting using anti-p53, anti-HA, anti-GFP (Cell Signaling, 2555) and anti-NF-YB (Santa Cruz, FL-207) antibodies.
[0217] To measure levels of endogenously phosphorylated PDGFRb, KPC cells were treated with the drug as described and harvested in phospho-lysis buffer (50 mM Tris pH 7.5, 1% Tween-20, 200 mM NaCl, 0.2% NP-40, phosphatase inhibitors [2.5 mM Sodium pyrophosphate, 1 mM -Glycerophosphate, 1 mM Na.sub.3VO.sub.4], and protease inhibitors [Roche]). Anti-PDGFRb (Santa Cruz, 958) was used to immunoprecipitate PDGFRb from whole cell lysate samples containing 0.5 mg protein. Washed immunoprecipitates were subjected to SDS-Page and immunoblotted with anti-PTyr-100 antibody (Cell Signaling, 9411).
Immunohistochemistry and Immunofluorescence
[0218] Tissues were fixed overnight in formalin, embedded in paraffin, and cut into 5-m thick sections. Sections were subjected to hematoxylin and eosin staining, and immunohistochemical and immunofluorescent staining following standard protocols. The following primary antibodies were used: mouse anti-GFP (Cell Signaling), rabbit anti-p-PDGFR- (Tyr 1021) (Santa Cruz Biotechnology) and rat anti-CK8 (DSHB). For immunofluorescence Alexa Fluor 488 goat anti-rabbit and Alexa Fluor 568 goat anti-rat were used as secondary antibodies, and DAPI was used as a chromogen. Images were acquired using a Zeiss Axio Imager D1 scope.
Mouse Studies
[0219] All animal experiments were performed in accordance with a protocol approved by the Memorial Sloan-Kettering Institutional Animal Care and Use Committee. For colonization studies, KPC cells (110.sup.5) were resuspended in 200 l PBS and injected intravenously into the tail vein of 8 week-old female athymic nude mice. Lungs were harvested 7 days post injection and analyzed for colonization by GFP positivity (Nikon SMZ1500) and histology.
[0220] Pdx1-Cre (Hingorani et al., 2003), LSL-Kras.sup.G12D (Jackson et al., 2001) and LSL-p53.sup.R172H (Olive et al, 2004) mouse strains were previously described: Male Pdx1-Cre.sup.+/+, LSL-p53.sup.R172H/R172H mice were bred with female LSL-Kras.sup.G12D/+ mice to generate KPC mice. Strains were maintained on mixed background. Mice were genotyped by polymerase chain reaction analysis as described previously (Hingorani et al., 2006). Mice were dosed twice daily by oral gavage with 50 mg/kg Imatinib in ddH.sub.2O or with ddH.sub.2O only. Organs and tumors were removed and fixed in 10% buffered formalin and tumor and metastatic burden was assessed by gross pathology and histology.
Human Data Sets
[0221] The gene expression data and survival analyses of PDAC patients is from The International Cancer Genome Consortium (ICGC) pancreatic cancer project, which is stored at Gene Expression Omnibus (GEO) with accession number GSE50827. It includes gene expression data from 103 primary tumor samples, 89 of which contain disease-free survival and clinicopathological annotations, and used in the survival analysis according to previously described methods (Biankin et al., 2012).
[0222] Gene expression data of ovarian, colorectal, and pancreatic cancer patients with annotated clinical outcomes were downloaded from the Gene Expression Omnibus database (GSE9899 (Tothill et al., 2008), GSE17537 (Smith et al., 2010), and GSE28735 (Zhang et al., 2012)). Preprocessed data were downloaded as provided in the data matrix files (GCRMA/RMA normalized Affymetrix expression microarray data) and gene set enrichment analysis (GSEA) was performed on each set after mean-centering across samples. Median of probes per gene was used to account for differential representation on the chip. The GSEA scores were then clustered into two groups (High, Low) using kmeans, and a Kaplan-Meier analysis was performed to obtain survival outcome plots. Significance for these plots was determined using the logrank test.
Results
Sustained Expression of Mutant p53 is Required for the Invasive Phenotype of Pancreatic Cancer Cells
[0223] Genetically engineered mouse models of pancreas cancer harboring a latent oncogenic Kras allele (lox-stop-lox Kras.sup.G12D), a latent mutant p53.sup.R172H, and a tissue specific Cre recombinase (Pdx1-Cre), also known as KPC mice, develop highly metastatic pancreatic cancer that faithfully mimics the human disease (Hingorani et al., 2005). To understand the impact of p53 mutations on cell invasion and metastasis in this well-defined genetic system, a murine KPC pancreatic cancer cell line was employed that lost the remaining p53 wild type allele during disease progression (Morton et al., 2010). The behavior of KPC cell lines stably expressing shRNAs targeting (mutant) p53, or control shRNAs targeting Renilla (KPC+sh.Ctrl), were compared to one another and to a p53-null KPflC cell line (from a Pdx-Cre, LSL-Kras.sup.G12D/+, LSL-p53.sup.loxP/+) expressing the control shRNA (KP.sub.flC+sh.Ctrl).
[0224] KPC+sh.Ctrl cells expressing mutant p53 efficiently migrated to close the wound using a scratch-wound assay. This motility depended on the mutant p53, as mutant p53 knockdown in KPC+sh.p53 cells reduced motility similarly to p53.sup./ KP.sub.flC+sh.Ctrl cells (FIG. 1A). Next, the invasive capacity of KPC cells into collagen gels in an inverted invasion assay was examined. The presence of mutant p53 in KPC+sh.Ctrl cells enhanced invasiveness, which was significantly abrogated upon p53 knockdown (
[0225] To test whether mutant p53 expression was required to sustain the metastatic potential of KPC cells, KPC+sh.Ctrl and KPC+sh.p53 cells were orthotopically injected into the pancreata of athymic mice, and the number of metastases formed in both lung and liver, the most common sites of pancreatic cancer spread in patients, were scored. Although the primary tumor burden was independent of the p53 status, tumors originating from KPC+sh.Ctrl cells expressing mutant p53 were significantly more metastatic than those in which mutant p53 was silenced, and metastases in the lung and liver were detected to a greater extent in mice that had been injected with cells expressing mutant p53 (
Transcriptional Profiling and Functional Screening Identifies PDGFRb as a Downstream Mediator of Mutant p53 in Murine Pancreatic Cancer
[0226] To gain insight into how mutant p53 mediates the invasive phenotype of PDAC, genome-wide transcriptome profiling of KPC cells was performed by RNA sequencing (RNAseq). Four days following knockdown of mutant p53 in three clonal populations resulted in a complex pattern of gene expression changes compared to those observed in three independent KPC+sh.Ctrl cell lines. 441 genes were identified as either significantly up- or down regulated upon shRNA-mediated depletion of endogenous mutant p53 (
TABLE-US-00003 Gene list of top 40 deregulated genes upon mutant p53 knock down UP DOWN Slc1a3 Prl2c3 Calml4 Nckap1l Fgf13 Vmn1r44 4933439K11Rik Gm14547 Lmo1 Armcx2 Gm13318 1600029D21Rik Gpc4 4930452806Rik Pde9a Trim54 Ptn Prl2c2 Angpt1 Selp Pde8a Serpinb9g Psmb8 Prrg1 Fam5c Slc25a48 Ppp1r3c Prokr2 5330417C22Rik Rims2 Robo2 Fat2 Armox6 Siglec15 Smarca1 Ctf1 Tmigd1 Spsb4 Sned1 Cd300lb Oprd1 Gm15854 Psmb9 KlkB Sgk3 Igfbp3 Fam193a Il18rap Fsd1 Fam110c Nfkbid Acsbg1 C4bp 9030425E11Rik Nlgn1 Nefl Cyp4b1 Tnnt2 Gatm Atg9b 1110032A04Rik Sck39 BC028528 Aqp8 Cul9 Tmem117 2610305D13Rik Klra4 C1s Wnt10a Unc5c Hck Slc40a1 Kcnf1 Pdgfrb Ripply1 Cacna1b Fam78b Bicc1 Slc25a43
Ingenuity pathway analysis revealed that 20% of the affected genes were involved in the cellular movement program, confirming experimental observations that mutant p53 can govern the invasive phenotype of pancreatic cancer cells (
[0227] To facilitate the identification of mediators of mutant p53 activity, genes whose expression was positively regulated by mutant p53 were analyzed, as such molecules might both mediate effects of mutant p53 and be targets for pharmacological inhibition. Therefore, pools of 3-6 shRNAs targeting individual upregulated genes were generated and screened one-by-one to identify those that phenocopied the decreased invasion seen upon downregulation of mutant p53. Three genes were identified whose knock down abrogated invasion driven by mutant p53 (
[0228] Oncogenic properties of mutated or amplified PDGFRa have been studied in several tumor types, whereas PDGFRb has been linked to tumor angiogenesis via paracrine effects (Pietras et al., 2003; Cao et al., 2004). The result of the screening described herein led to the hypothesis for a cell-autonomous role of PDGFRb on cell invasion in pancreatic cancer. First, a reduction in PDGFRb mRNA and protein upon knockdown of mutant p53 was verified by RT-qPCR and western blotting (
[0229] Next, the effects of depleting each PDGFR isoform on the invasive potential of KPC cells were examined in vitro (
PDGFRb Mediates Mutant p53 Action in Human Cancer Cells
[0230] To determine if the mutant p53-PDGFRb signaling axis acts in human cancer cells, PDGFRb expression levels were analyzed in a panel of human pancreatic cancer cell lines. As in our model, PDGFRb mRNA levels were significantly higher in cells expressing mutant p53 compared to those in cell lines that maintained or lost the wild type p53 allele (
[0231] The functional connection between mutant p53 and PDGFRb in promoting the invasiveness of human PDAC lines was further analyzed. Consistent with the studies in mice, knockdown of either mutant p53 or PDGFRb reduced invasiveness of the A2.1 pancreatic cancer cell line (
Mutant p53 Disrupts the p73/NF-Y Complex to Mediate PDGFRb Expression and Tumor Cell Invasion
[0232] Several pro-oncogenic properties of mutant p53 depend on its ability to physically interact with and inhibit the p53 family members, p63 and p73 (Li and Prives, 2007). Despite its similarity to p63, the role of p73 in invasion and metastasis has not been directly examined. Since previous reports indicated that p73 can repress the transcription of PDGFRB (Hackzell et al., 2002), and because our KPC cells expressed p73 but not p63 as determined by RNA-seq (data not shown), whether the physical interaction of mutant p53 with p73 impairs the ability of p73 to negatively regulate the expression of PDGFRb was examined.
[0233] First, the interaction between p73 and mutant p53 proteins was verified by reciprocal co-immunoprecipitation (
[0234] To better understand how p73 represses PDGFRB transcription, chromatin immunoprecipitation (ChIP) analysis in KP.sub.flC cells was performed, but no direct binding of p73 to the PDGFRB promoter was detected (data not shown), a result consistent with previous reports (Matys et al., 2006). Nevertheless, promoter analysis of PDGFRB (Transfec, Biobase) identified a conserved CCAAT binding motif for NF-Y, a well-characterized transcriptional activator of PDGFRB that physically interacts with p73 (Ballagi et al., 1995; Ishisaki et al., 1997). NF-Y binding to the PDGFRB promoter was demonstrated using ChIP analysis (
[0235] Next, whether the repressive action of p73 on PDGFRB transcription was mediated by NF-Y and modulated by mutant p53, and the implications of this regulatory circuit for invasion, was tested. Interestingly, the ability of p73 overexpression to inhibit the PDGFRB-luc reporter was abolished by depletion of NF-Y subunits A and B (
Modulation of PDGFRb Expression Levels Mediates the Phenotypic Effects of Mutant p53 Depletion In Vivo
[0236] Following the observation that p53 mutants induce the expression of PDGFRb to promote cell invasion in PDAC cultures, whether PDGFRb levels regulate metastatic behavior of PDAC cells in mice was investigated. To this end, a lung colonization assay was performed by injecting KPC+sh.p53, KPC+sh.PDGFRB, KPC+sh.PDGFRA or KPC+sh. Ctrl-cells intravenously via the tail vein into athymic mice and scoring the number of colonies formed in the lungs. Whereas KPC+sh.Ctrl and KPC+sh.PDGFRa cells expressing mutant p53 formed tumor nodules in the lungs at high frequency, PDGFRb depletion significantly reduced the number of lung colonies, phenocopying the anti-metastatic effect observed upon knocking down mutant p53 (
[0237] Whether pharmacologic inhibition of the PDGFRb pathway recapitulates the effects of PDGFRb or mutant p53 depletion was examined (
[0238] To test whether crenolanib can suppress metastasis, KPC cells were pretreated with the drug overnight and injected intravenously into recipient mice that were subsequently assessed for colony formation in the lung. Although drug treatment had no effect on the viability of the injected cell population, mice injected with drug-treated KPC cells showed significantly fewer lung nodules compared to controls pre-treated with DMSO (
Imatinib Inhibits the Development of Metastases in a PDAC Mouse Model by Targeting PDGFRb
[0239] The results described above imply that pharmacologic inhibition of PDGFRb could have anti-metastatic effects. Therefore, whether PDGFRb inhibition prevented metastasis in KPC mice that develop metastatic disease with a variable latency of 3 to 10 months in 50-80% of animals (Hingorani et al., 2005) was determined. FDA-approved imatinib, a potent inhibitor of PDGFRb, c-KIT and BCR-ABL activity, was used. Notably, the c-KIT and BCR-ABL kinases have not been linked to PDAC development (Jones et al., 2008).
[0240] Inhibition of PDGFRb by imatinib in KPC cells strongly reduced PDGFRb tyrosine phosphorylation at 3 uM (
[0241] Next, KPC mice were treated with imatinib to assess its effects on metastases. To this end, mice were treated with a dose of 50 mg/kg imatinib by oral gavage twice daily, a regimen that produces therapeutic concentrations of imatinib in mice (Wolff et al., 2003; Beppu et al., 2004). Treatment was initiated in mice of 8 weeks of age, a time at which KPC mice have developed preneoplastic lesions (Hingorani et al., 2005), and mice were monitored until they became symptomatic. Imatinib had no impact on tumor volume in the pancreas or overall survival, suggesting that the high disease burden in the pancreas was the primary cause of cell death (
[0242] However, imatinib induced a striking reduction in the occurrence of metastasis. The incidence of metastasis was 92% in vehicle-treated animals compared to 15% in mice treated with imatinib, as assessed by GFP fluorescence and confirmed by histopathological analyses (.sup.2 test, p<0.0001) (
PDGFRb Expression Correlates with Disease Free-Survival in Human Pancreatic, Colorectal and Ovarian Cancer Patients
[0243] To investigate the clinical significance of PDGFRb expression, whether upregulation of this gene was correlated with prognosis or with the clinicopathological characteristics of PDACs in patients was examined. To avoid confounding signals from the tumor stroma, which can be substantial (data not shown), PDGFRb mRNA levels were assessed in microdissected tumor samples by RT-qPCR. Strikingly, pancreatic cancer patients with tumors expressing high levels of PDGFRb showed a poor disease-free survival and, hence, shorter time to relapse including metastases in distant organs (p=0.019) (
[0244] The clinical significance of PDGFRb in colorectal and ovarian cancer was also analyzed, and levels of PDGFRb significantly stratified colorectal and ovarian tumor patients into two distinct cohorts. Patients with tumors expressing low PDGFRb levels exhibited a lower probability to form metastases compared to patients with PDGFRb high-expressing tumors (p=0.003 and p<0.0001) (
DISCUSSION
[0245] Mutations that occur in the p53 tumor suppressor can inactivate wild-type p53 functions but can also produce gain-of-function oncogenic properties that can contribute to cell proliferation, survival and metastasis. Described herein are results of analysis of the phenotypic effects of mutant p53 in pancreatic cancer. As demonstrated herein, the sustained expression of the mutant p53 allele is necessary to maintain the invasive phenotype of PDAC cells by increasing the expression of PDGFRb. These results have several ramifications for understanding of mutant p53 action as well as the behavior and potential treatment of pancreatic cancer.
[0246] Signaling through PDGFRb can contribute to multiple tumor-associated processes including cell invasion and metastasis. Given the generally restricted expression of PDGFRb to mesenchymal cell types, most of its oncogenic properties are thought to reflect paracrine effects of tumor cell-secreted PDGF. Indeed, previous work on the role of PDGFRb in carcinoma progression and metastasis suggest that it mainly elicits responses in the tumor stroma by promoting tumor angiogenesis (Pietras et al., 2003; Cao et al., 2004). In contrast, the results described herein provide new evidence for tumor cell-specific expression of PDGFRb in promoting metastasis. As demonstrated herein, genetic or pharmacological inhibition of PDGFRb in the pancreas cancer cells themselves dramatically reduced their invasive and metastatic potential, and that treatment of mice harboring genetic and histologically relevant tumors prevented metastatic spread in vivo. Together, these data suggest that pancreatic tumor cells expressing mutant p53 not only synthesize PDGF but also up-regulate PDGFRb, leading to a tumor cell-autonomous effect.
[0247] Though increases in PDGFRb expression were necessary and sufficient to mediate mutant p53 effects in the model described herein, at least two additional genes (SNED1 and SLC40A1) were identified that also contribute to the invasive phenotype through as yet unknown mechanisms. Studies in other systems, primarily breast cancer, have suggested that CXCR4, cyclin-G2, and the mevalonate pathway are mediators of the pro-metastatic activities of mutant p53 (Mehta et al., 2007; Adorno et al., 2009; Freed-Pastor et al., 2012). In addition, mutant p53 has also been reported to drive invasion by regulating several miRNAs such as miR155 and miR130b (Neilsen et al., 2013; Dong et al., 2013). In agreement, miR155 was found to be positively regulated by mutant p53 in KPC cells and promoted metastasis in the model described herein (data not shown); however, in contrast to a previous report (Su et al., 2010), no effects on DICER expression were observed, arguing that in pancreas cancer the mutant p53-associated changes in microRNA expression and metastasis are DICER independent. Regardless, as for wild type p53, mutant p53 exerts effects through the regulation of multiple genes rather than by modulating a single signaling pathway.
[0248] Most of the prior understanding of how mutant p53 mediates its oncogenic activity involved exploring the consequences of the physical interaction between the mutant protein and the p53 family members, p63 and p73. Whereas the mutant p53-p63 interaction can modulate the expression of p63 targets genes to enhance invasion and metastasis (Adorno et al., 2009; Muller et al., 2009; Girardini et al., 2011), the role of p73 in these oncogenic properties was unknown. Previous studies have shown that (1) loss of p73 in a p53-null background might be functionally equivalent to the expression of mutant p53 (Flores et al., 2005; Lang et al., 2004); (2) aberrant transcriptional regulation by mutant p53 is mediated through the transcriptional activator NF-Y (Di Agostino et al., 2006); and (3) mutant p53 promotes recycling of receptor tyrosine kinases to initiate invasion (Muller et al., 2009). Demonstrated herein, among other things, is a mechanism where mutant p53 enhances the metastatic potential of pancreatic cancer cells by modulating p73 and its interaction with the transcriptional activator NF-Y.
[0249] Mutations in KRAS, p53, CDKN2A, BRCA2 and SMAD4 define the genetic landscape of PDAC. Provided herein is evidence for a crucial role of mutant p53 in metastasis formation, which supports the attractive concept of targeting its gain-of-function activities to limit cancer cell dissemination and metastasis. However, mutant p53 has been neither a targetable cell surface protein nor a druggable enzyme (Levine and Oren, 2009), and therapeutic modalities such as RNAi or restoring wild type p53 conformations have failed to show efficacy in clinical studies (Lehmann and Pietenpol, 2012). Hence, targeting downstream pathways or genes that mediate the activity of mutant p53, such as PDGFRb as disclosed herein, pose an alternative treatment strategy. For example, methods of the disclosure include treating and/or inhibiting early metastatic spread of pancreas cancer by targeting PDGFRb following early detection, such as a preventative approach in patients with familial predisposition to cancer development. In some embodiments, targeting PDGFRb is used in combination with one or more additional therapies, such as after surgical resection of localized disease.
[0250] In addition, the data disclosed herein demonstrated correlations between elevated PDGFRb levels, more advanced tumor stage, and poorer disease-free survival in pancreatic as well as colorectal and ovarian cancer patients. Thus, in some embodiments, the disclosure includes the use of PDGFRb levels as a prognostic biomarker for pancreatic cancer progression. For example, PDGFRb levels can be used in conjunction with p53 to identify patient cohorts likely to respond to therapies targeting this axis.
EQUIVALENTS
[0251] It is to be understood that while the invention has been described in conjunction with the detailed description thereof, the foregoing description is intended to illustrate and not limit the scope of the invention, which is defined by the scope of the appended claims. Other aspects, advantages, and modifications are within the scope of the following claims.
REFERENCES
[0252] Adorno, M., Cordenonsi, M., Montagner, M., Dupont, S., Wong, C., Hann, B., Solari, A., Bobisse, S., Rondina, M. B., Guzzardo, V., et al. (2009). A Mutant p53/Smad complex opposes p63 to empower TGFbeta-induced metastasis. Cell 137, 87-98. [0253] Ballagi, A E., Ishizaki, A., Nehlin J O., and Funa, K. (1995). Isolation and characterization of the mouse PDGF beta-receptor promoter. Biochem Biophys Res Commun. 210, 165-173. [0254] Beppu, K., Jaboine, J., Merchant, M S., Mackall, C L., and Thiele, C J. (2004). Effect of imatinib mesylate on neuroblastoma tumorigenesis and vascular endothelial growth factor expression. J Natl Cancer Inst. 96, 46-55. [0255] Biankin, A. V., Waddell, N., Kassahn, K. S., Gingras, M. C., Muthuswamy, L. B., Johns, A. L., Miller, D. K., Wilson, P. J., Patch, A. M., Wu, J., et al. (2012). Pancreatic cancer genomes reveal aberrations in axon guidance pathway genes. Nature 491, 399-405. [0256] Brosh, R., and Rotter, V. (2009). When mutants gain new powers: news from the mutant p53 field. Nat Rev Cancer 9, 701-713. [0257] Cao, R., Bjrndahl, M A., Religa, P., Clasper, S., Garvin, S., Galter, D., Meister, B., Ikomi, F., Tritsaris, K., Dissing, S., et al. (2004). PDGF-BB induces intratumoral lymphangiogenesis and promotes lymphatic metastasis. Cancer Cell 6, 333-345. [0258] Dai, C., Celestino, J. C., Okada, Y., Louis, D. N., Fuller, G. N., and Holland, E. C. (2001). PDGF autocrine stimulation dedifferentiates cultured astrocytes and induces oligodendrogliomas and oligoastrocytomas from neural progenitors and astrocytes in vivo. Genes Dev 15, 1913-1925 [0259] Dai, Y. (2010). Platelet-derived growth factor receptor tyrosine kinase inhibitors: a review of the recent patent literature. Expert Opin Ther Pat 20, 885-897. [0260] Di Agostino, S., Strano, S., Emiliozzi, V., Zerbini, V., Mottolese, M., Sacchi, A., Blandino, G., and Piaggio, G. (2006). Gain of function of mutant p53: the mutant p53/NF-Y protein complex reveals an aberrant transcriptional mechanism of cell cycle regulation. Cancer Cell 10, 191-202. [0261] Djebali, S., Davis, C., Merkel, A., Dobin, A., Lassmann, T., Mortazavi, A., Tanzer, A., Lagarde, J., Lin, W., Schlesinger, F., Xue, C., et al. (2012). Landscape of transcription in human cells. Nature 489, 101-108. [0262] Dobin, A., Davis. C., Schlesinger, F., Drenkow, J., Zaleski, C., Jha, S., Batut, P., Chaisson, M., Gingeras, T R. (2013). STAR: ultrafast universal RNA-seq aligner. Bioinformatics 29, 15-21. [0263] Dong, P., Karaayvaz, M., Jia, N., Kaneuchi, M., Hamada, J., Watari, H., Sudo, S., Ju, J., and Sakuragi, N. (2013). Mutant p53 gain-of-function induces epithelial-mesenchymal transition through modulation of the miR-130b-ZEB1 axis. Oncogene 32, 3286-3295. [0264] Freed-Pastor, W A., Mizuno, H., Zhao, X., Langerod, A., Moon, S H., Rodriguez-Barrueco, R., Barsotti, A., Chicas, A., Li, W., Polotskaia, A., et al. (2012). Mutant p53 Disrupts Mammary Tissue Architecture via the Mevalonate Pathway. Cell 148, 244-258. [0265] Gaiddon, C., Lokshin, M., Ahn, J., Zhang, T., and Prives, C. (2001). A subset of tumor-derived mutant forms of p53 down-regulate p63 and p73 through a direct interaction with the p53 core domain. Mol Cell Biol. 21, 1874-1887. [0266] Girardini, J E., Napoli, M., Piazza, S., Rustighi, A., Marotta, C., Radaelli, E., Capaci, V., Jordan, L., Quinlan, P., Thompson, A., et al. (2011). A Pin1/mutant p53 axis promotes aggressiveness in breast cancer. Cancer Cell 12, 79-91. [0267] Goulimari, P., Kitzing, T., Knieling, H., Brandt, D T., Offermanns, S., and Grosse, R. (2005). Galpha12/13 is essential for directed cell migration and localized Rho-Dial function. J Biol Chem. 280, 42242-42251. [0268] Gril, B., Palmirie, D., Qian, Y., Anwar, T., Liewehr, D J., Steinberg, S M., Andreu, Z., Masana, D., Fernndez, P., Steeg, P S., et al. (2013). Pazopanib inhibits the activation of PDGFR-expressing astrocytes in the brain metastatic microenvironment of breast cancer cells. Am J Pathol. 182, 2368-2379 [0269] Hackzell, A., Uramoto, H., Izumi, H., Kohno, K., and Funa, K. (2002). p73 independent of c-Myc represses transcription of platelet-derived growth factor beta-receptor through interaction with NF-Y. J Biol Chem. 277, 39769-39776. [0270] Hemann, M T., Fridman, J., Zilfou, J T., Hernando, E., Paddison, P J., Cordon-Cardo, C., Hannon, G J., and Lowe, S W. (2003). An epi-allelic series of p53 hypomorphs created by stable RNAi produces distinct tumor phenotypes in vivo. Nat Genet. 33, 396-400. [0271] Hidalgo, M. (2010). Pancreatic cancer. N Engl J Med 362: 1605-1617. [0272] Hingorani, S R., Petricoin, E., Maitra, A., Rajapakse, V., King, C., Jacobetz, M A., Ross, S., Conrads, T P., Veenstra, T D., Hitt, B A., et al. (2003). Preinvasive and invasive ductal pancreatic cancer and its early detection in the mouse. Cancer Cell 4, 437-450. [0273] Hingorani, S R., Wang, L., Multani, A S., Combs, C., Deramaudt, T B., Hruban, R H., Rustgi, A K., Chang, S., and Tuveson, D A. (2005). Trp53R172H and KrasG12D cooperate to promote chromosomal instability and widely metastatic pancreatic ductal adenocarcinoma in mice. Cancer Cell 7, 469-483. [0274] Hoehler, T., von Wichert, G., Schimanski, C., Kanzler, S., Moehler, M H., Hinke, A., Seufferlein, T., Siebler, J., Hochhaus, A., Arnold, D., et al. (2013). Phase I/II trial of capecitabine and oxaliplatin in combination with bevacizumab and imatinib in patients with metastatic colorectal cancer: AIO KRK 0205. Br J Cancer. September 17, 1408-1413. [0275] Ishisaki, A., Muramaya, T., Ballagi, A E., and Funa, K. (1997). Nuclear factor Y controls the basal transcription activity of the mouse platelet-derived-growth-factor beta-receptor gene. Eur J Biochem 246, 142-146. [0276] Jackson, E L., Willis, N., Mercer, K., Bronson, R T., Crowley, D., Montoya, R., Jacks, T., and Tuveson, D A. (2001). Analysis of lung tumor initiation and progression using conditional expression of oncogenic K-ras. Genes Dev. 15, 3243-3248. [0277] Joerger, A C., Ang, H., and Fersht, A R. (2006). Structural basis for understanding oncogenic p53 mutations and designing rescue drugs. PNAS 103, 15056-15061. [0278] Jones, S., Zhang, X., Parsons, D W., Lin, J C., Leary, R J., Angenendt, P., Mankoo, P., Carter, H., Kamiyama, H., and Jimeno, A., (2008). Core signaling pathways in human pancreatic cancers revealed by global genomic analyses. Science 321, 1801-1806. [0279] Kim, Y., Kim, E., Wu, Q., Guryanova, O., Hitomi, M., Lathia, J D., Serwanski, D., Sloan, A E., Weil, R J., Lee, J., et al. (2012). Platelet-derived growth factor receptors differentially inform intertumoral and intratumoral heterogeneity. Genes Dev. 26, 1247-1262. [0280] Lehmann, B D., and Pietenpol, J A. (2012). Targeting Mutant p53 in Human Tumors. J Clin Oncol. 30, 3648-3650. [0281] Levesque, M A., Katsaros, D., Yu, H., Zola, P., Sismondi, P., Giardina, G., Diamandis, E P. (1995). Mutant p53 protein overexpression is associated with poor outcome in patients with well or moderately differentiated ovarian carcinoma. Cancer. 15, 1327-38. [0282] Levin, A R., and Oren, M. (2009). The first 30 years of p53: growing ever more complex. Nature Reviews Cancer 9, 749-758. [0283] Lewis, N L., Lewis L D., Eder, J P., Reddy, N J., Guo, F., Pierce, K J., Olszanski, A J., and Cohen, R B. (2009). Phase I study of the safety, tolerability, and pharmacokinetics of oral CP-868,596, a highly specific platelet-derived growth factor receptor tyrosine kinase inhibitor in patients with advanced cancers. J Clin Oncol. 27, 5262-5269. [0284] Li, D., Xie, K., Wolff, R., and Abbruzzese, J L. (2004). Pancreatic Cancer. Lancet 363, 1049-1057. [0285] Li, Y., and Prives, C. (2007). Are interactions with p63 and p73 involved in mutant p53 gain of oncogenic function? Oncogene 26, 2220-2225. [0286] Liu, K., Ling, S., and Lin, W C. (2011). TopBP1 mediates mutant p53 gain of function through NF-Y and p63/p73. Mol Cell Biol. 31, 4464-4481. [0287] Longati, P., Jia, X., Eimer, J., Wagman, A., Witt, M R., Rehnmark, S., Verbeke, C., Toftgrd, R., Lhr, M., and Heuchel, R L. (2013). 3D pancreatic carcinoma spheroids induce a matrix-rich, chemoresistant phenotype offering a better model for drug testing. BMC Cancer 13, 95. [0288] Maitra, A., and Hruban, R H. (2008). Pancreatic cancer. Annu Rev Pathol. 3, 157-188. [0289] Masciarelli, S., Fontemaggi, G., Di Agostino, S., Donzelli, S., Carcarino, E., Strano, S., and Blandino, G. (2013). Gain-of-function mutant p53 downregulates miR-223 contributing to chemoresistance of cultured tumor cells. Oncogene, 15 Apr. 2013; doi:10.1038/onc.2013.106. [0290] Mathey, S., Graeser, M., Zu Eulenburg, C., Woelber, L., Trillsch, F., Jaenicke, F., Muller, V., Milde-Langosch, K., and Mahner, S. (2013). Platelet-Derived Growth Factor Receptor Beta Serum Concentrations during First-Line Therapy in Ovarian Cancer. Oncology 85, 69-77. [0291] Matys, V., Kel-Margoulis, O V., Fricke, E., Liebich, I., Land, S., Barre-Dirrie, A., Reuter, I., Chekmenev, D., Krull, M., Hornischer, K., et al. (2006). TRANSFAC and its module TRANSCompel: transcriptional gene regulation in eukaryotes. Nucleic Acids Res. 34, D108-110. [0292] Mehta, S A., Christopherson, K W., Bhat-Nakshatri, P., Goulet, R J Jr., Broxmeyer, H E., Kopelovich, L., and Nakshatri, H. (2007). Negative regulation of chemokine receptor CXCR4 by tumor suppressor p53 in breast cancer cells: implications of p53 mutation or isoform expression on breast cancer cell invasion. Oncogene. 17, 3329-3337. [0293] Montalbetti, N., Simonin, A., Kovacs, G., and Hediger, M A. (2013) Mammalian iron transporters: families SLC11 and SLC40. Mol Aspects 34, 270-287. [0294] Morton, J P., Timpson, P., Karim, S A., Ridgway, R A., Athineos, D., Doyle, B., Jamieson, N B., Oien, K A., Lowy, A M., Brunton, V G., et al. (2010). Mutant p53 drives metastasis and overcomes growth arrest/senescence in pancreatic cancer. PNAS 107, 246-251. [0295] Muller, P A., Caswell, P T., Doyle, B., Iwanicki, M P., Tan, E H., Karim, S., Lukashchuk, N., Gillespie, D A., Ludwig, R L., Gosselin, P., et al. (2009). Mutant p53 Drives Invasion by Promoting Integrin Recycling. Cell 139, 1327-1341. [0296] Neilsen, P M., Noll, J E., Mattiske, S., Bracken, C P., Gregory, P A., Schulz, R B., Lim, S P., Kumar, R., Suetani, R J., Goodall, G J., et al. (2013). Mutant p53 drives invasion in breast tumors through up-regulation of miR-155. Oncogene 13, 2992-3000. [0297] Olive, K P., Tuveson, D., Ruhe, Z C., Yin, B., Willis, N A., Bronson, R T., Crowley, D., and Jacks, T. (2004). Mutant p53 gain of function in two mouse models of Li-Fraumeni syndrome. Cell 119, 847-860. [0298] Oren, M., and Rotter, V. (2010). Mutant p53 gain-of-function in cancer. Cold Spring Harb Perspect Biol. 2:a001107. [0299] Parkhomchuk, D., Borodina, T., Amstislayskiy, V., Banaru, M., Hallen, L., Krobitsch, S., Lehrach, H., and Soldatov, A. (2009). Transcriptome analysis by strand-specific sequencing of complementary DNA. Nucleic Acids Res. 37, e123. [0300] Pietras, K., Sjoblom, T., Rubin, K., Heldin, C. H., and Ostman, A. (2003). PDGF receptors as cancer drug targets. Cancer Cell 3, 439-443. [0301] Rolley, N., Butcher, S., and Milner, J. (1995). Specific DNA binding by different classes of human p53 mutants. Oncogene. 11, 763-770. [0302] Su, X., Chakravarti, D., Cho, M S., Liu, L., Gi, Y J., Lin, Y L., Leung, M L., El-Naggar, A., Creighton, C J., Suraokar, M B., et al. (2010). TAp63 suppresses metastasis through coordinate regulation of Dicer and miRNAs. Nature 467, 986-990. [0303] Uramoto, H., Wetterskog, D., Hackzell, A., Matsumoto, and Y., Funa, K. (2004). p73 competes with co-activators and recruits histone deacetylase to NF-Y in the repression of PDGF beta-receptor. J Cell Sci. 117, 5323-5331. [0304] Vogelstein, B., Lane, D., and Levine, A. J. (2000). Surfing the p53 network. Nature 408, 307-310. [0305] Wang, P., Reed, M., Wang, Y., Mayr, G., Stenger, J. E., Anderson, M. E., Schwedes, J. F., Tegtmeyer, P. (1994). p53 domains: structure, oligomerization, and transformation. Mol Cell Biol. 8:5182-5191. [0306] Weisz, L., Oren, M., and Rotter, V. (2007). Transcription regulation by mutant p53. Oncogene 26, 2202-2211. [0307] Wolff, N C., Richardson, J A., Egorin, M., and Ilaria, R L Jr (2003). The CNS is a sanctuary for leukemic cells in mice receiving imatinib mesylate for Bcr/Abl-induced leukemia. Blood 101, 5010-5013. [0308] Yachida, S., Jones, S., Bozic, I., Antal, T., Leary, R., Fu, B., Kamiyama, M., Hruban, R H., Eshleman, J R., Nowak, M A., et al. (2010). Distant metastasis occurs late during the genetic evolution of pancreatic cancer. Nature 467, 1114-1117. [0309] Zuber, J., McJunkin, K., Fellmann, C., Dow, L E., Taylor, M J., Hannon, G J., and Lowe, S W. (2011). Toolkit for evaluating genes required for proliferation and survival using tetracycline-regulated RNAi. Nat Biotechnol. 29, 79-83.
TABLE-US-00004 Sequences (Humanp53nucleotidesequence) SEQIDNO:1 1 cgtgctttccacgacggtgacacgcttccctggattggccagactgccttccgggtcact 61 gccatggaggagccgcagtcagatcctagcgtcgagccccctctgagtcaggaaacattt 121 tcagacctatggaaactacttcctgaaaacaacgttctgtcccccttgccgtcccaagca 181 atggatgatttgatgctgtccccggacgatattgaacaatggttcactgaagacccaggt 241 ccagatgaagctcccagaatgccagaggctgctccccgcgtggcccctgcaccagcagct 301 cctacaccggcggcccctgcaccagccccctcctggcccctgtcatcttctgtcccttcc 361 cagaaaacctaccagggcagctacggtttccgtctgggcttcttgcattctgggacagcc 421 aagtctgtgacttgcacgtactcccctgccctcaacaagatgttttgccaactggccaag 481 acctgccctgtgcagctgtgggttgattccacacccccgcccggcacccgcgtccgcgcc 541 atggccatctacaagcagtcacagcacatgacggaggttgtgaggcgctgcccccaccat 601 gagcgctgctcagatagcgatggtctggcccctcctcagcatcttatccgagtggaagga 661 aatttgcgtgtggagtatttggatgacagaaacacttttcgacatagtgtggtggtgccc 721 tatgagccgcctgaggttggctctgactgtaccaccatccactacaactacatgtgtaac 781 agttcctgcatgggcggcatgaaccggaggcccatcctcaccatcatcacactggaagac 841 tccagtggtaatctactgggacggaacagctttgaggtgcatgtttgtgcctgtcctggg 901 agagaccggcgcacagaggaagagaatctccgcaagaaaggggagcctcaccacgagctg 961 cccccagggagcactaagcgagcactgtccaacaacaccagctcctctccccagccaaag 1021 aagaaaccactggatggagaatatttcacccttcagatccgtgggcgtgagcgcttcgag 1081 atgttccgagagctgaatgaggccttggaactcaaggatgcccaggctgggaaggagcca 1141 ggggggagcagggctcactccagccacctgaagtccaaaaagggtcagtctacctcccgc 1201 cataaaaaactcatgttcaagacagaagggcctgactcagactgacattctccacttctt 1261 gttccccactgacagcctcccacccccatctctccctcccctgccattttgggttttggg 1321 tctttgaacccttgcttgcaataggtgtgcgtcagaagcacccaggacttccatttgctt 1381 tgtcccggggctccactgaacaagttggcctgcactggtgttttgttgtggggaggagga 1441 tggggagtaggacataccagcttagattttaaggtttttactgtgagggatgtttgggag 1501 atgtaagaaatgttcttgcagttaagggttagtttacaatcagccacattctaggtaggg 1561 gcccacttcaccgtactaaccagggaagctgtccctcactgttgaattttctctaacttc 1621 aaggcccatatctgtgaaatgctggcatttgcacctacctcacagagtgcattgtgaggg 1681 ttaatgaaataatgtacatctggccttgaaaccaccttttattacatggggtctagaact 1741 tgacccccttgagggtgcttgttccctctccctgttggtcggtgggttggtagtttctac 1801 agttgggcagctggttaggtagagggagttgtcaagtctctgctggcccagccaaaccct 1861 gtctgacaacctcttggtgaaccttagtacctaaaaggaaatctcaccccatcccacacc 1921 ctggaggatttcatctcttgtatatgatgatctggatccaccaagacttgttttatgctc 1981 agggtcaatttcttttttctttttttttttttttttctttttctttgagactgggtctcg 2041 ctttgttgcccaggctggagtggagtggcgtgatcttggcttactgcagcctttgcctcc 2101 ccggctcgagcagtcctgcctcagcctccggagtagctgggaccacaggttcatgccacc 2161 atggccagccaacttttgcatgttttgtagagatggggtctcacagtgttgcccaggctg 2221 gtctcaaactcctgggctcaggcgatccacctgtctcagcctcccagagtgctgggatta 2281 caattgtgagccaccacgtccagctggaagggtcaacatcttttacattctgcaagcaca 2341 tctgcattttcaccccacccttcccctccttctccctttttatatcccatttttatatcg 2401 atctcttattttacaataaaactttgctgccaaaaaaaaaaaaaaaaaaaa (Humanp53aminoacidsequence) SEQIDNO:2 102030405060 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 708090100110120 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 130140150160170180 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 190200210220230240 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 250260270280290300 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 310320330340350360 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 370380390 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD (humanPDGFRbnucleotidesequence) SEQIDNO:3 1 ctcctgaggctgccagcagccagcagtgactgcccgccctatctgggacccaggatcgct 61 ctgtgagcaacttggagccagagaggagatcaacaaggaggaggagagagccggcccctc 121 agccctgctgcccagcagcagcctgtgctcgccctgcccaacgcagacagccagacccag 181 ggcggcccctctggcggctctgctcctcccgaaggatgcttggggagtgaggcgaagctg 241 ggccgctcctctcccctacagcagcccccttcctccatccctctgttctcctgagccttc 301 aggagcctgcaccagtcctgcctgtccttctactcagctgttacccactctgggaccagc 361 agtctttctgataactgggagagggcagtaaggaggacttcctggagggggtgactgtcc 421 agagcctggaactgtgcccacaccagaagccatcagcagcaaggacaccatgcggcttcc 481 gggtgcgatgccagctctggccctcaaaggcgagctgctgttgctgtctctcctgttact 541 tctggaaccacagatctctcagggcctggtcgtcacacccccggggccagagcttgtcct 601 caatgtctccagcaccttcgttctgacctgctcgggttcagctccggtggtgtgggaacg 661 gatgtcccaggagcccccacaggaaatggccaaggcccaggatggcaccttctccagcgt 721 gctcacactgaccaacctcactgggctagacacgggagaatacttttgcacccacaatga 781 ctcccgtggactggagaccgatgagcggaaacggctctacatctttgtgccagatcccac 841 cgtgggcttcctccctaatgatgccgaggaactattcatctttctcacggaaataactga 901 gatcaccattccatgccgagtaacagacccacagctggtggtgacactgcacgagaagaa 961 aggggacgttgcactgcctgtcccctatgatcaccaacgtggcttttctggtatctttga 1021 ggacagaagctacatctgcaaaaccaccattggggacagggaggtggattctgatgccta 1081 ctatgtctacagactccaggtgtcatccatcaacgtctctgtgaacgcagtgcagactgt 1141 ggtccgccagggtgagaacatcaccctcatgtgcattgtgatcgggaatgaggtggtcaa 1201 cttcgagtggacatacccccgcaaagaaagtgggcggctggtggagccggtgactgactt 1261 cctcttggatatgccttaccacatccgctccatcctgcacatccccagtgccgagttaga 1321 agactcggggacctacacctgcaatgtgacggagagtgtgaatgaccatcaggatgaaaa 1381 ggccatcaacatcaccgtggttgagagcggctacgtgcggctcctgggagaggtgggcac 1441 actacaatttgctgagctgcatcggagccggacactgcaggtagtgttcgaggcctaccc 1501 accgcccactgtcctgtggttcaaagacaaccgcaccctgggcgactccagcgctggcga 1561 aatcgccctgtccacgcgcaacgtgtcggagacccggtatgtgtcagagctgacactggt 1621 tcgcgtgaaggtggcagaggctggccactacaccatgcgggccttccatgaggatgctga 1681 ggtccagctctccttccagctacagatcaatgtccctgtccgagtgctggagctaagtga 1741 gagccaccctgacagtggggaacagacagtccgctgtcgtggccggggcatgccccagcc 1801 gaacatcatctggtctgcctgcagagacctcaaaaggtgtccacgtgagctgccgcccac 1861 gctgctggggaacagttccgaagaggagagccagctggagactaacgtgacgtactggga 1921 ggaggagcaggagtttgaggtggtgagcacactgcgtctgcagcacgtggatcggccact 1981 gtcggtgcgctgcacgctgcgcaacgctgtgggccaggacacgcaggaggtcatcgtggt 2041 gccacactccttgccctttaaggtggtggtgatctcagccatcctggccctggtggtgct 2101 caccatcatctcccttatcatcctcatcatgctttggcagaagaagccacgttacgagat 2161 ccgatggaaggtgattgagtctgtgagctctgacggccatgagtacatctacgtggaccc 2221 catgcagctgccctatgactccacgtgggagctgccgcgggaccagcttgtgctgggacg 2281 caccctcggctctggggcctttgggcaggtggtggaggccacggctcatggcctgagcca 2341 ttctcaggccacgatgaaagtggccgtcaagatgcttaaatccacagcccgcagcagtga 2401 gaagcaagcccttatgtcggagctgaagatcatgagtcaccttgggccccacctgaacgt 2461 ggtcaacctgttgggggcctgcaccaaaggaggacccatctatatcatcactgagtactg 2521 ccgctacggagacctggtggactacctgcaccgcaacaaacacaccttcctgcagcacca 2581 ctccgacaagcgccgcccgcccagcgcggagctctacagcaatgctctgcccgttgggct 2641 ccccctgcccagccatgtgtccttgaccggggagagcgacggtggctacatggacatgag 2701 caaggacgagtcggtggactatgtgcccatgctggacatgaaaggagacgtcaaatatgc 2761 agacatcgagtcctccaactacatggccccttacgataactacgttccctctgcccctga 2821 gaggacctgccgagcaactttgatcaacgagtctccagtgctaagctacatggacctcgt 2881 gggcttcagctaccaggtggccaatggcatggagtttctggcctccaagaactgcgtcca 2941 cagagacctggcggctaggaacgtgctcatctgtgaaggcaagctggtcaagatctgtga 3001 ctttggcctggctcgagacatcatgcgggactcgaattacatctccaaaggcagcacctt 3061 tttgcctttaaagtggatggctccggagagcatcttcaacagcctctacaccaccctgag 3121 cgacgtgtggtccttcgggatcctgctctgggagatcttcaccttgggtggcacccctta 3181 cccagagctgcccatgaacgagcagttctacaatgccatcaaacggggttaccgcatggc 3241 ccagcctgcccatgcctccgacgagatctatgagatcatgcagaagtgctgggaagagaa 3301 gtttgagattcggccccccttctcccagctggtgctgcttctcgagagactgttgggcga 3361 aggttacaaaaagaagtaccagcaggtggatgaggagtttctgaggagtgaccacccagc 3421 catccttcggtcccaggcccgcttgcctgggttccatggcctccgatctcccctggacac 3481 cagctccgtcctctatactgccgtgcagcccaatgagggtgacaacgactatatcatccc 3541 cctgcctgaccccaaacccgaggttgctgacgagggcccactggagggttcccccagcct 3601 agccagctccaccctgaatgaagtcaacacctcctcaaccatctcctgtgacagccccct 3661 ggagccccaggacgaaccagagccagagccccagcttgagctccaggtggagccggagcc 3721 agagctggaacagttgccggattcggggtgccctgcgcctcgggcggaagcagaggatag 3781 cttcctgtagggggctggcccctaccctgccctgcctgaagctccccccctgccagcacc 3841 cagcatctcctggcctggcctgaccgggcttcctgtcagccaggctgcccttatcagctg 3901 tccccttctggaagctttctgctcctgacgtgttgtgccccaaaccctggggctggctta 3961 ggaggcaagaaaactgcaggggccgtgaccagccctctgcctccagggaggccaactgac 4021 tctgagccagggttcccccagggaactcagttttcccatatgtaagatgggaaagttagg 4081 cttgatgacccagaatctaggattctctccctggctgacaggtggggagaccgaatccct 4141 ccctgggaagattcttggagttactgaggtggtaaattaacttttttctgttcagccagc 4201 tacccctcaaggaatcatagctctctcctcgcacttttatccacccaggagctagggaag 4261 agaccctagcctccctggctgctggctgagctagggcctagccttgagcagtgttgcctc 4321 atccagaagaaagccagtctcctccctatgatgccagtccctgcgttccctggcccgagc 4381 tggtctggggccattaggcagcctaattaatgctggaggctgagccaagtacaggacacc 4441 cccagcctgcagcccttgcccagggcacttggagcacacgcagccatagcaagtgcctgt 4501 gtccctgtccttcaggcccatcagtcctggggctttttctttatcaccctcagtcttaat 4561 ccatccaccagagtctagaaggccagacgggccccgcatctgtgatgagaatgtaaatgt 4621 gccagtgtggagtggccacgtgtgtgtgccagtatatggccctggctctgcattggacct 4681 gctatgaggctttggaggaatccctcaccctctctgggcctcagtttccccttcaaaaaa 4741 tgaataagtcggacttattaactctgagtgccttgccagcactaacattctagagtattc 4801 caggtggttgcacatttgtccagatgaagcaaggccatataccctaaacttccatcctgg 4861 gggtcagctgggctcctgggagattccagatcacacatcacactctggggactcaggaac 4921 catgccccttccccaggcccccagcaagtctcaagaacacagctgcacaggccttgactt 4981 agagtgacagccggtgtcctggaaagcccccagcagctgccccagggacatgggaagacc 5041 acgggacctctttcactacccacgatgacctccgggggtatcctgggcaaaagggacaaa 5101 gagggcaaatgagatcacctcctgcagcccaccactccagcacctgtgccgaggtctgcg 5161 tcgaagacagaatggacagtgaggacagttatgtcttgtaaaagacaagaagcttcagat 5221 gggtaccccaagaaggatgtgagaggtgggcgctttggaggtttgcccctcacccaccag 5281 ctgccccatccctgaggcagcgctccatgggggtatggttttgtcactgcccagacctag 5341 cagtgacatctcattgtccccagcccagtgggcattggaggtgccaggggagtcagggtt 5401 gtagccaagacgcccccgcacggggagggttgggaagggggtgcaggaagctcaacccct 5461 ctgggcaccaaccctgcattgcaggttggcaccttacttccctgggatccccagagttgg 5521 tccaaggagggagagtgggttctcaatacggtaccaaagatataatcacctaggtttaca 5581 aatatttttaggactcacgttaactcacatttatacagcagaaatgctattttgtatgct 5641 gttaagtttttctatctgtgtacttttttttaagggaaagattttaatattaaacctggt 5701 gcttctcactcacaaaaa (humanPDGFRbaminoacidsequence) SEQIDNO:4 MRLPGAMPALALKGELLLLSLLLLLEPQISQGLVVTPPGPELVL NVSSTFVLTCSGSAPVVWERMSQEPPQEMAKAQDGTESSVLTLTNLTGLDTGEYECTH NDSRGLETDERKRLYIFVPDPTVGFLPNDAEELFIFLTEITEITIPCRVTDPQLVVTL HEKKGDVALPVPYDHQRGFSGIFEDRSYICKTTIGDREVDSDAYYVYRLQVSSINVSV NAVQTVVRQGENITLMCIVIGNEVVNFEWTYPRKESGRLVEPVTDFLLDMPYHIRSIL HIPSAELEDSGTYTCNVTESVNDHQDEKAINITVVESGYVRLLGEVGTLQFAELHRSR TLQVVFEAYPPPTVLWFKDNRTLGDSSAGEIALSTRNVSETRYVSELTLVRVKVAEAG HYTMRAFHEDAEVQLSFQLQINVPVRVLELSESHPDSGEQTVRCRGRGMPQPNIIWSA CRDLKRCPRELPPTLLGNSSEEESQLETNVTYWEEEQEFEVVSTLRLQHVDRPLSVRC TLRNAVGQDTQEVIVVPHSLPFKVVVISAILALVVLTIISLIILIMLWQKKPRYEIRW KVIESVSSDGHEYIYVDPMQLPYDSTWELPRDQLVLGRTLGSGAFGQVVEATAHGLSH SQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGPHLNVVNLLGACTKGGPIYIITE YCRYGDLVDYLHRNKHTFLQHHSDKRRPPSAELYSNALPVGLPLPSHVSLTGESDGGY MDMSKDESVDYVPMLDMKGDVKYADIESSNYMAPYDNYVPSAPERTCRATLINESPVL SYMDLVGFSYQVANGMEFLASKNCVHRDLAARNVLICEGKLVKICDFGLARDIMRDSN YlSKGSTFLPLKWMAPESIENSLYTTLSDVWSEGILLWEIFTLGGTPYPELPMNEQFY NAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEIRPPFSQLVLLLERLLGEGYKKKYQQ VDEEFLRSDHPAILRSQARLPGFHGLRSPLDTSSVLYTAVQPNEGDNDYIIPLPDPKP EVADEGPLEGSPSLASSTLNEVNTSSTISCDSPLEPQDEPEPEPQLELQVEPEPELEQ LPDSGCPAPRAEAEDSFL