Methods Of Selectively Treating Asthma Using IL-13 Antagonists
20170029894 ยท 2017-02-02
Inventors
Cpc classification
A61K2039/55
HUMAN NECESSITIES
C07K2317/51
CHEMISTRY; METALLURGY
A47L9/1683
HUMAN NECESSITIES
C07K2317/94
CHEMISTRY; METALLURGY
A47L9/325
HUMAN NECESSITIES
C07K2317/76
CHEMISTRY; METALLURGY
C12Q2600/106
CHEMISTRY; METALLURGY
C07K2317/34
CHEMISTRY; METALLURGY
A47L9/0444
HUMAN NECESSITIES
C07K2317/92
CHEMISTRY; METALLURGY
A47L5/30
HUMAN NECESSITIES
C12Q1/6883
CHEMISTRY; METALLURGY
A61K2039/545
HUMAN NECESSITIES
International classification
Abstract
The disclosure is directed to novel predictive methods and personalized therapies for treating asthma. Specifically, this disclosure relates to methods of treating a patient having asthma by selectively administering an IL-13 antagonist, on the basis of that patient being genetically predisposed to have a favorable response to treatment with the IL-13 antagonist. Also disclosed herein are transmittable forms of information, diagnostic methods, and kits useful in predicting the likelihood that a patient having asthma will respond to treatment with an IL-13 antagonist.
Claims
1. A method of selectively treating a patient having asthma, comprising i) identifying a patient having at least one AIR marker selected from the group consisting of AIR marker-1, 2, 3, 4, 5, 6, 7, 8, and 9, and ii) thereafter administering a therapeutically effective amount of an IL-13 antagonist to the patient.
2. The method according to claim 1, wherein said identification comprises assaying a biological sample from the patient for the presence of at least one AIR marker selected from said group.
3. (canceled)
4. The method of claim 1 further comprising determining whether said AIR marker is present in homozygous or heterozygous form wherein the presence of the at least one AIR marker in homozygous form is determinative that the patient is positive for said AIR marker.
5. The method of claim 1, wherein said AIR marker is selected from the group consisting of AIR marker 3 and AIR marker 7.
6. The method according to claim 1, further comprising the steps of: determining whether the patient is homozygous or heterozygous for said AIR marker, and selectively administering a therapeutically effective amount of an IL-13 antagonist to the patient that is homozygous for one of AIR marker 3 and AIR marker 7 and heterozygous at the other; homozygous for both AIR marker 3 and AIR marker 7; or homozygous for AIR marker 3.
7. A method of predicting the likelihood that a patient having asthma will respond to treatment with an IL-13 antagonist, comprising the step of assaying a biological sample from the patient for the presence or absence of at least one AIR marker selected from the group consisting of AIR marker-1, 2, 3, 4, 5, 6, 7, 8, and 9, wherein: a) the presence of the at least one AIR marker is indicative of an increased likelihood that the patient will respond to treatment with the IL-13 antagonist; and b) the absence of the at least one AIR marker is indicative of a decreased likelihood that the patient will respond to treatment with the IL-13 antagonist.
8. (canceled)
9. A method of predicting the likelihood that a patient having asthma will respond to treatment with an IL-13 antagonist, comprising the steps of: a) assaying a biological sample from the patient for the presence or absence of at least one AIR marker, and b) determining whether said AIR marker is present in homozygous or heterozygous form, wherein the presence of the at least one AIR marker in homozygous form is indicative of an increased likelihood that the patient will respond to treatment with the IL-13 antagonist, wherein said at least one AIR marker is selected from the group consisting of: i) AIR marker 3 and AIR marker 7 each present in homozygous form, ii) AIR marker 3 present in homozygous form and AIR marker 7 in heterozygous form, a. AIR marker 7 present in homozygous form and AIR marker 3 in heterozygous form, and b. AIR marker 3 in homozygous form.
10. The method according to claim 2, wherein the step of assaying comprises assaying the biological sample for a nucleic acid product of the at least one AIR marker, or a polypeptide product of the at least one AIR marker.
11. The method according to claim 2, wherein the step of assaying comprises assaying the biological sample for a genomic sequence of the at least one AIR marker.
12. The method according to claim 2, wherein the biological sample is selected from the group consisting of blood, serum, feces, plasma, urine, tear, saliva, and a tissue sample.
13. The method according to claim 2, wherein the step of assaying comprises a technique selected from the group consisting of Northern blot analysis, polymerase chain reaction (PCR), reverse transcription-polymerase chain reaction (RT-PCR), TaqMan-based assays, direct sequencing, dynamic allele-specific hybridization, high-density oligonucleotide SNP arrays, restriction fragment length polymorphism (RFLP) assays, primer extension assays, oligonucleotide ligase assays, analysis of single strand conformation polymorphism, temperature gradient gel electrophoresis (TGGE), denaturing high performance liquid chromatography, high-resolution melting analysis, DNA mismatch-binding protein assays, SNPLex, capillary electrophoresis, Southern Blot, immunoassays, immunohistochemistry, ELISA, flow cytometry, Western blot, HPLC, and mass spectrometry.
14. A method for producing a transmittable form of information for predicting the responsiveness of a patient having asthma to treatment with an IL-13 antagonist, comprising: a) determining an increased likelihood of the patient responding to treatment with the IL-13 antagonist according to claim 7. b) recording the result of the determining step on a tangible or intangible media form for use in transmission.
15. The method according to claim 1, wherein said IL-13 antagonist competes with antibody 01951/G12 (SEQ ID NO:14 and 16) for binding to IL-13 under conditions that promotes said competition.
16. The method according to claim 1, wherein said IL-13 antagonist is a polypeptide or a fragment thereof, an antibody or an antigen binding fragment thereof, a Fab, an ScFv.
17. The method according to claim 1, wherein said IL-13 antagonist is an antibody or a fragment thereof that binds to an epitope of IL-13 comprising residues FCPHKV (SEQ ID NO: 67) set forth as residues 103 to 107 of SEQ ID NO: 1.
18. The method according to claim 1, wherein said IL-13 antagonist is an antibody comprising a heavy chain as set forth in SEQ ID NO: 20 and a light chain as recited in SEQ ID NO: 18.
19. The method according to claim 1, wherein said IL-13 antagonist is an antibody administered at a dose of about 50-1000 mg i.v. administered every 4 weeks.
20. The method according to claim 1, wherein the IL-13 antagonist has a K.sub.D of about 100-200 pM,
21. The method according to claim 1, wherein the IL-13 antagonist has an in vivo half-life of about 21 days,
22. The method according to claim 1, wherein the IL-13 antagonist is an antibody selected from the group consisting of: i. an antibody comprising one or more of the CDRs selected from the list consisting of: (a) the V.sub.H CDR1s shown in SEQ ID NOs: 2 or 5 (b) the V.sub.H CDR2s shown in SEQ ID NOs: 3 or 6, (c) the V.sub.H CDR3s shown in SEQ ID NOs: 4 or 7 (d) the V.sub.L CDR1s shown in SEQ ID NOs: 8 or 11, (e) the V.sub.L CDR2s shown in SEQ ID NOs: 9 or 12, (f) the V.sub.L CDR3s shown in SEQ ID NOs: 10 or 13; ii. an antibody comprising a heavy chain variable region CDR1 of SEQ ID NO: 2; a heavy chain variable region CDR2 of SEQ ID NO: 3; a heavy chain variable region CDR3 of SEQ ID NO: 4; a light chain variable region CDR1 of SEQ ID NO: 8; a light chain variable region CDR2 of SEQ ID NO: 9; and a light chain variable region CDR3 of SEQ ID NO: 10; iii. an antibody comprising a heavy chain variable region CDR1 of SEQ ID NO: 5; a heavy chain variable region CDR2 of SEQ ID NO: 6; a heavy chain variable region CDR3 of SEQ ID NO: 7; a light chain variable region CDR1 of SEQ ID NO: 11; a light chain variable region CDR2 of SEQ ID NO: 12; and a light chain variable region CDR3 of SEQ ID NO: 13, iv. an antibody comprising a heavy chain variable region as recited in SEQ ID NO: 14 and a light chain variable region as recited in SEQ ID NO: 16, v. an antibody comprising a heavy chain as recited in SEQ ID NO: 20 and a light chain as recited in SEQ ID NO: 18.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0053]
[0054]
[0055]
[0056]
DETAILED DESCRIPTION OF THE DISCLOSURE
[0057] It is envisioned that testing subjects for the presence of at least one of the aforementioned response alleles (AIR markers) will be useful in a variety of pharmaceutical products and methods that involve identifying asthma patients, including severe to moderate asthma patients who are more likely to respond to IL-13 antagonsim and in helping physicians decide whether to prescribe IL-13 antagonists (e.g. antibody 01951/G12) to those patients or whether to prescribe an alternative pharmaceutical agent.
[0058] Accordingly, in one aspect the invention provides methods of treating a patient having asthma by administering to the patient a therapeutically effective amount of an IL-13 antagonist, e.g., an IL-13 antibody, such as antibody 01951/G12, based on certain aspects of the patient's genotypic profile. In a related aspect, the invention further provides methods of identifying a patient having asthma who is more likely to respond to treatment of with an IL-13 antagonist, e.g., an IL-13 antibody, such as antibody 01951/G12, based on certain aspects of the patient's genotypic profile. In a further related aspect, the invention provides methods of determining the likelihood that a patient having asthma will respond to treatment with an IL-13 antagonist, e.g., an IL-13 antibody, such as antibody 01951/G12, based on certain aspects of the patient's genotypic profile. In another related aspect, the invention provides various methods of selectively treating a patient having asthma.
[0059] The inventive methods described herein encompass utilizing at least one AIR marker selected from a group consisting of nine specified AIR markers set forth herein. The term at least one AIR marker contemplates that one, two, three, four, 5, six, seven, eight, or nine AiR markers can be combined and utilized in the methods of the invention. Furthermore, each AIR marker member of such combinations can be in heterozygous or homozygous form. Particular embodiments of the invention set forth specific combinations of nine AIR markers (AIR markers-1 to 9) and further specify desired zygosities with respect to a particular AIR marker.
[0060] The term comprising encompasses including as well as consisting, e.g. a composition comprising X may consist exclusively of X or may include something additional, e.g., X+Y.
[0061] The term about in relation to a numerical value x means+/10% unless the cotext dictates otherwise.
[0062] The term assaying is used to refer to the act of identifying, screening, probing, testing measuring or determining, which act may be performed by any conventional means. For example, a sample may be assayed for the presence of a particular genetic or protein marker by using an ELISA assay, a Northern blot, imaging, serotyping, cellular typing, gene sequencing, phenotyping, haplotyping, immunohistochemistry, western blot, mass spectrometry, etc. The term detecting (and the like) means the act of extracting particular information from a given source, which may be direct or indirect. In some embodiments of the predictive methods disclosed herein, the presence of a given thing (e.g., allele, level of protein, etc.) is detected in a biological sample indirectly, e.g., by querying a database. The terms assaying and determining contemplate a transformation of matter, e.g., a transformation of a biological sample, e.g., a blood sample or other tissue sample, from one state to another by means of subjecting that sample to physical testing.
[0063] The term obtaining means to procure, e.g., to acquire possession of in any way, e.g., by physical intervention (e.g., biopsy, blood draw) or non-physical intervention (e.g, transmittal of information via a server), etc.
[0064] The phrase assaying a biological sample . . . and the like, is used to mean that a sample may be tested (either directly or indirectly) for either the presence of a given AIR marker. It will be understood that, in a situation where the presence of a substance denotes one probability and the absence of a substance denotes a different probability, then either the presence or the absence of such substance may be used to guide a therapeutic decision. For example, one may determine if a patient has AIR marker by determining the actual existence of particular response allele in the patient or by determining the absence of the particular response allele in the patient. In both such cases, one has determined whether the patient has the presence of the AIR marker. The disclosed methods involve, inter alia, determining whether a particular individual has an AIR marker. This determination is undertaken by identifying whether the patient has one or more of the AIR markers disclosed in Table 1 set forth above. Each of these determinations (i.e., presence or absence), on its own, provides the allelic status of the patient and thus each of these determinations equally provide an indication of whether a particular individual would or would not respond more favorably to IL-13 antagonism. To provide an indication of increased responsiveness for an asthma patient, a biological sample need only be assayed for one or more AIR marker set forth in Table 1.
[0065] IL-13 antagonist as used herein refers to a molecule that antagonizes (e.g., reduces, inhibits, decreases, delays, eliminates) IL-13 function, expression and/or signalling by blocking the binding of IL-13 to the IL-13 receptor complex. In a particular embodiment of the invention, the IL-13 antagonist prevents IL-13 binding to IL-13 R1. In another, the IL-13 antagonist prevents binding to IL-13 R1, but allows binding to IL1-13 R2 (also known as the decoy receptor). See Ingram and Kraft (2012) J Allergy Clin Immunol 130(4): 829-842.
[0066] The binding reaction may be shown by standard methods (qualitative or quantitative assays) including, for example, a binding assay, competition assay or a bioassay for determining the inhibition of IL-13 binding to its receptor or any kind of binding assays, with reference to a negative control test in which an antibody of unrelated specificity, but ideally of the same isotype, e.g., an anti-CD25 antibody, is used. Such methods include those set forth below in the EXAMPLES.
[0067] The term antibody as referred to herein includes whole antibodies and any antigen-binding portion or single chains thereof. A naturally occurring antibody is a glycoprotein comprising at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds. Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as V.sub.H) and a heavy chain constant region. The heavy chain constant region is comprised of three domains, CH1, CH2 and CH3. Each light chain is comprised of a light chain variable region (abbreviated herein as VL) and a light chain constant region. The light chain constant region is comprised of one domain, CL. The V.sub.H and V.sub.L regions can be further subdivided into regions of hypervariability, termed hypervariable regions or complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR). Each V.sub.H and V.sub.L is composed of three CDRs and four FRs arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. The variable regions of the heavy and light chains contain a binding domain that interacts with an antigen. The constant regions of the antibodies may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (C1q) of the classical complement system.
[0068] The term antigen-binding portion of an antibody as used herein, refers to fragments of an antibody that retain the ability to specifically bind to an antigen (e.g., IL-13). It has been shown that the antigen-binding function of an antibody can be performed by fragments of a full-length antibody. Examples of binding fragments encompassed within the term antigen-binding portion of an antibody include a Fab fragment, a monovalent fragment consisting of the V.sub.L, V.sub.H, CL and CH1 domains; a F(ab)2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; a Fd fragment consisting of the V.sub.H and CH1 domains; a Fv fragment consisting of the V.sub.L and V.sub.H domains of a single arm of an antibody; a dAb fragment (Ward et al., 1989 Nature 341:544-546), which consists of a V.sub.H domain; and an isolated CDR. Exemplary antigen binding sites include the CDRs set forth in SEQ ID NOs:1-6 and 11-13 (Table 2), preferably the heavy chain CDR3. Furthermore, although the two domains of the Fv fragment, V.sub.L and V.sub.H, are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the V.sub.L and V.sub.H regions pair to form monovalent molecules (known as single chain Fv (scFv); see, e.g., Bird et al., 1988 Science 242:423-426; and Huston et al., 1988 Proc. Natl. Acad. Sci. 85:5879-5883). Such single chain antibodies are also intended to be encompassed within the term antibody. Single chain antibodies and antigen-binding portions are obtained using conventional techniques known to those of skill in the art.
[0069] An isolated antibody, as used herein, refers to an antibody that is substantially free of other antibodies having different antigenic specificities (e.g., an isolated antibody that specifically binds IL-13 is substantially free of antibodies that specifically bind antigens other than IL-13). The term monoclonal antibody or monoclonal antibody composition as used herein refer to a preparation of antibody molecules of single molecular composition. The term human antibody, as used herein, is intended to include antibodies having variable regions in which both the framework and CDR regions are derived from sequences of human origin. A human antibody need not be produced by a human, human tissue or human cell. The human antibodies of the disclosure may include amino acid residues not encoded by human sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro, by N-nucleotide addition at junctions in vivo during recombination of antibody genes, or by somatic mutation in vivo). In some embodiments of the disclosed methods, the IL-13 antagonist is a human antibody, an isolated antibody, and/or a monoclonal antibody.
[0070] The term K.sub.D is intended to refer to the dissociation rate of a particular antibody-antigen interaction. The term K.sub.D, as used herein, is intended to refer to the dissociation constant, which is obtained from the ratio of K.sub.d to K.sub.a (i.e. K.sub.d/K.sub.a) and is expressed as a molar concentration (M). K.sub.D values for antibodies can be determined using methods well established in the art. A method for determining the K.sub.D of an antibody is by using surface plasmon resonance, or using a biosensor system such as a Biacore system.
[0071] The term affinity refers to the strength of interaction between antibody and antigen at single antigenic sites. Within each antigenic site, the variable region of the antibody arm interacts through weak non-covalent forces with antigen at numerous sites; the more interactions, the stronger the affinity. Standard assays to evaluate the binding affinity of the antibodies toward IL-13 of various species are known in the art, including for example, ELISAs, western blots and RIAs. The binding kinetics (e.g., binding affinity) of the antibodies also can be assessed by standard assays known in the art, such as by Biacore analysis.
[0072] An antibody that inhibits one or more of these IL-13 functional properties (e.g., biochemical, immunochemical, cellular, physiological or other biological activities, or the like) as determined according to methodologies known to the art and described herein, will be understood to relate to a statistically significant decrease in the particular activity relative to that seen in the absence of the antibody (or when a control antibody of irrelevant specificity is present). An antibody that inhibits IL-13 activity affects a statistically significant decrease, e.g., by at least about 10% of the measured parameter, by at least 50%, 80% or 90%, and in certain embodiments of the disclosed methods, the IL-13 antibody used may inhibit greater than 95%, 98% or 99% of IL-13 functional activity.
[0073] The term derivative, unless otherwise indicated, is used to define amino acid sequence variants, and covalent modifications (e.g., pegylation, deamidation, hydroxylation, phosphorylation, methylation, etc.) of an IL-13 antagonist (e.g., IL-13 antibody or antigen-binding portion thereof), e.g., of a specified sequence (e.g., a variable domain). A functional derivative includes a molecule having a qualitative biological activity in common with the disclosed IL-13 antagonists. A functional derivative includes fragments and peptide analogs of an IL-13 antagonist as disclosed herein. Fragments comprise regions within the sequence of a polypeptide according to the present disclosure, e.g., of a specified sequence. Functional derivatives of the IL-13 antagonists disclosed herein preferably comprise V.sub.H and/or V.sub.L domains that have at least about 65%, 75%, 85%, 95%, 96%, 97%, 98%, or even 99% overall sequence identity with the V.sub.H and/or V.sub.L sequences of the IL-13 binding molecules disclosed herein (e.g., the V.sub.H and/or V.sub.L sequences of Table 2), and substantially retain the ability to bind human IL-13.
[0074] The phrase substantially identical means that the relevant amino acid or nucleotide sequence (e.g., V.sub.H or V.sub.L domain) will be identical to or have insubstantial differences (e.g., through conserved amino acid substitutions) in comparison to a particular reference sequence. Insubstantial differences include minor amino acid changes, such as 1 or 2 substitutions (e.g., conservative substitutions, such as swapping a serine for a threonine, or substitutions at positions not involved in antibody activity, structural integrity, complement fixation, etc.) in a 5 amino acid sequence of a specified region (e.g., V.sub.H or V.sub.L domain). In the case of antibodies, the second antibody has the same specificity and has at least 50% of the affinity of the same. Sequences substantially identical (e.g., at least about 85% sequence identity) to the sequences disclosed herein are also part of this disclosure. In some embodiments, the sequence identity of a derivative anti-IL-13 antibody (can be about 90% or greater, e.g., 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or higher relative to the disclosed sequences.
[0075] Identity with respect to a native polypeptide and its functional derivative is defined herein as the percentage of amino acid residues in the candidate sequence that are identical with the residues of a corresponding native polypeptide, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent identity, and not considering any conservative substitutions as part of the sequence identity. Neither N- or C-terminal extensions nor insertions shall be construed as reducing identity. Methods and computer programs for the alignment are well known. The percent identity can be determined by standard alignment algorithms, for example, the Basic Local Alignment Search Tool (BLAST) described by Altshul et al. ((1990) J. Mol. Biol., 215: 403 410); the algorithm of Needleman et al. ((1970) J. Mol. Biol., 48: 444 453); or the algorithm of Meyers et al. ((1988) Comput. Appl. Biosci., 4: 1117). A set of parameters may be the Blosum 62 scoring matrix with a gap penalty of 12, a gap extend penalty of 4, and a frameshift gap penalty of 5. The percent identity between two amino acid or nucleotide sequences can also be determined using the algorithm of E. Meyers and W. Miller ((1989) CABIOS, 4:11-17) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.
[0076] Amino acid(s) refer to all naturally occurring L--amino acids, e.g., and include D-amino acids. The phrase amino acid sequence variant refers to molecules with some differences in their amino acid sequences as compared to the sequences according to the present disclosure. Amino acid sequence variants of an IL-13 antagonist polypeptide according to the present disclosure, e.g., of a specified sequence, still have the ability to bind the human IL-13 or. Amino acid sequence variants include substitutional variants (those that have at least one amino acid residue removed and a different amino acid inserted in its place at the same position in a polypeptide according to the present disclosure), insertional variants (those with one or more amino acids inserted immediately adjacent to an amino acid at a particular position in a polypeptide according to the present disclosure) and deletional variants (those with one or more amino acids removed in a polypeptide according to the present disclosure).
[0077] The term pharmaceutically acceptable means a nontoxic material that does not interfere with the effectiveness of the biological activity of the active ingredient(s).
[0078] The term administering in relation to a compound, e.g., an IL-13 binding molecule or another agent, is used to refer to delivery of that compound to a patient by any route.
[0079] As used herein, a therapeutically effective amount refers to an amount of an IL-13 antagonist, (e.g., anti-IL-13 antibody or antigen-binding portion thereof) that is effective, upon single or multiple dose administration to a patient (such as a human) for treating, preventing, preventing the onset of, curing, delaying, reducing the severity of, ameliorating at least one symptom of a disorder or recurring disorder, or prolonging the survival of the patient beyond that expected in the absence of such treatment. When applied to an individual active ingredient (e.g., an IL-13 antagonist, administered alone, the term refers to that ingredient alone. When applied to a combination, the term refers to combined amounts of the active ingredients that result in the therapeutic effect, whether administered in combination, serially or simultaneously.
[0080] The term treatment or treat refer to both prophylactic or preventative treatment (as the case may be) as well as curative or disease modifying treatment, including treatment of a patient at risk of contracting the disease or suspected to have contracted the disease as well as patients who are ill or have been diagnosed as suffering from a disease or medical condition, and includes suppression of clinical relapse or exacerbation. The treatment may be administered to a patient having a medical disorder or who ultimately may acquire the disorder, in order to prevent, cure, delay the onset of, reduce the severity of, or ameliorate one or more symptoms of a disorder or recurring disorder, or in order to prolong the survival of a patient beyond that expected in the absence of such treatment.
[0081] The phrase responds to treatment is used to mean that a patient, upon being delivered a particular treatment, e.g., an IL-13 antagonist, shows a clinically meaningful benefit from said treatment. In the case of asthma, including severe to moderate asthma, such criteria include reduction in exacerbations. The phrase respond to treatment is meant to be construed comparatively, rather than as an absolute response. For example, an asthma patient having an AIR marker is predicted to have more benefit from treatment with an IL-13 antagonist than a patient who does not have the AIR marker. These carriers of AIR markers respond more favorably to treatment with the IL-13 antagonist, and respond to treatment with an IL-13 antagonist. In certain embodiments of the invention, the patient that responds to treatment with an IL-13 antagonist according to the methods disclosed herein, has determinably reduced exacerbation of asthma for at least 24 weeks, at least 24-52 weeks, at least 52 weeks, or longer. In particular embodiments of the invention, the reduction in exacerbations is at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or 100% in the patient that responds to treatment with an IL-13 antagonist according to the methods disclosed herein.
[0082] The phrase receiving data is used to mean obtaining possession of information by any available means, e.g., orally, electronically (e.g., by electronic mail, encoded on diskette or other media), written, etc.
[0083] As used herein, selecting and selected in reference to a patient is used to mean that a particular patient is specifically chosen from a larger group of patients on the basis of (due to) the particular patient having a predetermined criteria, e.g., the patient has an AIR marker. Similarly, selectively treating refers to providing treatment to a patient having a particular disease, where that patient is specifically chosen from a larger group of patients on the basis of the particular patient having a predetermined criteria, e.g., an asthma patient specifically chosen for treatment due to the patient having a AIR marker. Similarly, selectively administering refers to administering a drug to a patient that is specifically chosen from a larger group of patients on the basis of (due to) the particular patient having a predetermined criteria, e.g., a particular genetic or other biological marker. By selecting, selectively treating and selectively administering, it is meant that a patient is delivered a personalized therapy based on the patient's particular biology, rather than being delivered a standard treatment regimen based solely on the patient having a particular disease. Selecting, in reference to a method of treatment as used herein, does not refer to fortuitous treatment of a patient that has an AIR marker, but rather refers to the deliberate choice to administer an IL-13 antagonist to a patient based on the patient having an AIR marker. Thus, selective treatment differs from standard treatment, which delivers a particular drug to all patients, regardless of their allelic status.
[0084] As used herein, predicting indicates that the methods described herein provide information to enable a health care provider to determine the likelihood that an individual having asthma will respond to or will respond more favorably to treatment with an IL-13 antagonist. It does not refer to the ability to predict response with 100% accuracy. Instead, the skilled artisan will understand that it refers to an increased probability.
[0085] As used herein, likelihood and likely is a measurement of how probable an event is to occur. It may be used interchangably with probability. Likelihood refers to a probability that is more than speculation, but less than certainty. Thus, an event is likely if a reasonable person using common sense, training or experience concludes that, given the circumstances, an event is probable. In some embodiments, once likelihood has been ascertained, the patient may be treated (or treatment continued, or treatment proceed with a dosage increase) with the IL-13 antagonist or the patient may not be treated (or treatment discontinued, or treatment proceed with a lowered dose) with the IL-13 antagonist.
[0086] The phrase increased likelihood refers to an increase in the probability that an event will occur. For example, some methods herein allow prediction of whether a patient will display an increased likelihood of responding to treatment with an IL-13 antagonist or an increased likelihood of responding better to treatment with an IL-13 antagonist in comparison to a patient having asthma who does not have an AIR.
[0087] As used herein SNP refers to single nucleotide polymorphism. A single nucleotide polymorphism is a DNA sequence variation occurring when a single nucleotide in the genome (or other shared sequence) differs between members of a biological species or paired chromosomes in an individual. Most SNPs have only two alleles, and one is usually more common in the population. A SNP may be present in an exon or an intron of a gene, an upstream or downstream untranslated region of a gene, or in a purely genomic location (i.e., non-transcribed). When a SNP occurs in the coding region of a gene, the SNP may be silent (i.e., a synonymous polymorphism) due to the redundancy of the genetic code, or the SNP may result in a change in the sequence of the encoded polypeptide (i.e., a non-synonymous polymorphism). In the instant disclosure, SNPs are identified by their Single Nucleotide Polymorphism Database (dbSNP) rs number, e.g. rs1805010. The dbSNP is a free public archive for genetic variation within and across different species developed and hosted by the National Center for Biotechnology Information (NCBI) in collaboration with the National Human Genome Research Institute (NHGRI).
[0088] A polymorphic site, such as a SNP, is usually preceded by and followed by conserved sequences in the genome of the population of interest and thus the location of a polymorphic site can often be made in reference to a consensus nucleic acid sequence (e.g., of thirty to sixty nucleotides) that bracket the polymorphic site, which in the case of a SNP is commonly referred to as the SNP context sequence. Context sequences for the SNPs disclosed herein may be found in the NCBI SNP database available at: www.ncbi.nlm.nih.gov/snp. Alternatively, the location of the polymorphic site may be identified by its location in a reference sequence (e.g., GeneBank deposit) relative to the start of the gene, mRNA transcript, BAC clone or even relative to the initiation codon (ATG) for protein translation. The skilled artisan understands that the location of a particular polymorphic site may not occur at precisely the same position in a reference or context sequence in each individual in a population of interest due to the presence of one or more insertions or deletions in that individual's genome as compared to the consensus or reference sequence. It is routine for the skilled artisan to design robust, specific and accurate assays for detecting the alternative alleles at a polymorphic site in any given individual, when the skilled artisan is provided with the identity of the alternative alleles at the polymorphic site to be detected and one or both of a reference sequence or context sequence in which the polymorphic site occurs. Thus, the skilled artisan will understand that specifying the location of any polymorphic site described herein by reference to a particular position in a reference or context sequence (or with respect to an initiation codon in such a sequence) is merely for convenience and that any specifically enumerated nucleotide position literally includes whatever nucleotide position the same polymorphic site is actually located at in the same locus in any individual being tested for the genetic marker of the invention using any of the genotyping methods described herein or other genotyping methods known in the art.
[0089] In addition to SNPs, genetic polymorphisms include translocations, insertions, substitutions, deletions, etc., that occur in gene enhancers, exons, introns, promoters, 5 UTR, 3UTR, etc.
[0090] As used herein rs1110470 refers to a C/T (reverse strand) SNP located within an intron of the human IL-4RA gene (IL-4R; IL-4 receptor alpha) (GeneBank Accession No. NM_000418.3). The rs1110470 polymorphic site is located at chromosomal position 27336427 (build 138; assembly GRCh37.p10), which is position 27276427 of Contig NT_010393.16.
[0091] As used herein rs3024530 refers to an A/G (forward strand) SNP located within an intron of IL-4RA gene (GeneBank Accession No. NM_000418.3). The rs3024530 polymorphic site is located at chromosomal position 27350687 (build 138; assembly GRCh37.p10), which is position 27290687 of Contig NT_010393.16.
[0092] As used herein rs1805010 refers to an A/G (forward strand) SNP located within an exon of IL-4RA gene (GeneBank Accession No. NM_000418.3), and encoding an Ile to Val change. The rs1805010 polymorphic site is located at chromosomal position 27356203 (build 138; assembly GRCh37.p10), which is position 27296203 of Contig NT_010393.16.
[0093] As used herein rs2239347 refers to an G/T (reverse strand) SNP located within an intron of IL-4RA gene (GeneBank Accession No. NM_000418.3). The rs2239347 polymorphic site is located at chromosomal position 27359021 (build 138; assembly GRCh37.p10), which is position 27299021 of Contig NT_010393.16.
[0094] As used herein rs1805011 refers to an A/C (forward strand) SNP located within an exon of IL-4RA gene (GeneBank Accession No. NM_000418.3), and encoding an Glu to Ala change. The rs1805011 polymorphic site is located at chromosomal position 27373872 (build 138; assembly GRCh37.p10), which is position 27313872 of Contig NT_010393.16.
[0095] As used herein rs1801275 refers to an A/G (forward strand) SNP located within an exon of IL-4RA gene (GeneBank Accession No. NM_000418.3), and encoding an Gln to Arg change. The rs1801275 polymorphic site is located at chromosomal position 27374400 (build 138; assembly GRCh37.p10), which is position 27314400 of Contig NT_010393.16.
[0096] As used herein rs8832 refers to an A/G (forward strand) SNP located within the 3 UTR (untranslated) region of IL-4RA gene (GeneBank Accession No. NM_000418.3). The rs8832 polymorphic site is located at chromosomal position 27375787 (build 138; assembly GRCh37.p10), which is position 27315787 of Contig NT_010393.16.
[0097] As used herein rs1029489 refers to an C/T (reverse strand) SNP located 3 proximal of IL-4RA gene (GeneBank Accession No. NM_000418.3). The rs1029489 polymorphic site is located at chromosomal position 27376217 (build 138; assembly GRCh37.p10), which is position 27316217 of Contig NT_010393.16.
[0098] As used herein rs4787956 refers to an A/G (forward strand) SNP located 3 proximal of IL-4RA gene (GeneBank Accession No. NM_000418.3). The rs4787956 polymorphic site is located at chromosomal position 27378249 (build 138; assembly GRCh37.p10), which is position 27318249 of Contig NT_010393.16.
[0099] As recognized by the skilled artisan, nucleic acid samples containing a particular SNP may be complementary double stranded molecules and thus reference to a particular site on the sense strand refers as well to the corresponding site on the complementary antisense strand. Similarly, reference to a particular genotype obtained for a SNP on both copies of one strand of a chromosome is equivalent to the complementary genotype obtained for the same SNP on both copies of the other strand.
[0100] As used herein, genomic sequence refers to a DNA sequence present in a genome, and includes a region within an allele, an allele itself, or a larger DNA sequence of a chromosome containing an allele of interest.
[0101] Products of the AIR markers of the invention can include nucleic acid products and polypeptide products. Polypeptide product refers to a polypeptide including the amino acid encoded by an AIR marker and fragments thereof. Nucleic acid product refers to any DNA (e.g., genomic, cDNA, etc.) or RNA (e.g., pre-mRNA, mRNA, miRNA, etc.) products of an AIR markers and fragments thereof.
[0102] An equivalent genetic marker refers to a genetic marker that is correlated to an allele of interest, e.g., it displays linkage disequilibrium (LD) or is in genetic linkage with the allele of interest. Equivalent genetic markers may be used to determine if a patient has an AIR marker, rather than directly interrogating a biological sample from the patient for the allele per se. Various programs exist to help determine LD for particular SNPs, e.g, HaploBlock (available at bioinfo.cs.technion.ac.il/haploblock/), HapMap, WGA Viewer.
[0103] The term probe refers to any composition of matter that is useful for specifically detecting another substance, e.g., a substance related to an AIR marker. A probe can be an oligonucleotide (including a conjugated oligonucleotide) that specifically hybridizes to a genomic sequence of an AIR marker, or a nucleic acid product of an AIR marker. A conjugated oligonucleotide refers to an oligonucleotide covalently bound to chromophore or molecules containing a ligand (e.g., an antigen), which is highly specific to a receptor molecule (e.g., an antibody specific to the antigen). The probe can also be a PCR primer, e.g., together with another primer, for amplifying a particular region within an AIR marker. Further, the probe can be an antibody that specifically binds to polypeptide products of these alleles. Further, the probe can be any composition of matter capable of detecting (e.g., binding or hybridizing) an equivalent genetic marker of an AIR marker. In preferred embodiments, the probe specifically hybridizes to a nucleic acid sequence (preferably genomic DNA) or specifically binds to a polypeptide sequence of an allele of interest.
[0104] The phrase specifically hybridizes is used to refer to hybrization under stringent hybridization conditions. Stringent conditions are known to those skilled in the art and can be found in Current Protocols in Molecular Biology, John Wiley & Sons, N.Y. (1989), 6.3.1-6.3.6. Aqueous and nonaqueous methods are described in that reference and either can be used. One example of stringent hybridization conditions is hybridization in 6 sodium chloride/sodium citrate (SSC) at about 45 C., followed by at least one wash in 0.2SSC, 0.1% SDS at 50 C. A second example of stringent hybridization conditions is hybridization in 6SSC at about 45 C., followed by at least one wash in 0.2SSC, 0.1% SDS at 55 C. Another example of stringent hybridization conditions is hybridization in 6SSC at about 45 C., followed by at least one wash in 0.2SSC, 0.1% SDS at 60 C. A further example of stringent hybridization conditions is hybridization in 6SSC at about 45 C., followed by at least one wash in 0.2SSC, 0.1% SDS at 65 C. High stringent conditions include hybridization in 0.5 M sodium phosphate, 7% SDS at 65 C., followed by at least one wash at 0.2SSC, 1% SDS at 65 C.
[0105] The phrase a region of a nucleic acid is used to indicate a smaller sequence within a larger sequence of nucleic acids. For example, a gene is a region of a chromosome, an exon is a region of a gene, etc.
[0106] The term specifically binds in the context of polypeptides is used to mean that a probe binds a given polypeptide target (e.g., a polypeptide product an AIR marker) rather than randomly binding undesirable polypeptides. However, specifically binds does not exclude some cross reactivity with undesirable polypeptides, as long as that cross reactivity does not interfere with the capability of the probe to provide a useful measure of the presence of the given polypeptide target.
[0107] The term capable is used to mean that ability to achieve a given result, e.g., a probe that is capable of detecting the presence of a particular substance means that the probe may be used to detect the particular substance.
[0108] An oliogonucelotide refers to a short sequence of nucleotides, e.g., 2-100 bases.
[0109] The term biological sample as used herein refers to a sample from a patient, which may be used for the purpose of identification, diagnosis, prediction, or monitoring. Preferred samples include synovial fluid, blood, blood-derived product (such as buffy coat, serum, and plasma), lymph, urine, tear, saliva, hair bulb cells, cerebrospinal fluid, buccal swabs, feces, synovial fluid, synovial cells, sputum, or tissue samples (e.g., cartilage samples). In addition, one of skill in the art would realize that some samples would be more readily analyzed following a fractionation or purification procedure, for example, isolation of DNA from whole blood.
[0110] The term IL-13 includes wild-type IL-13 from various species (e.g., human, mouse, and monkey), polymorphic variants of IL-13, and functional equivalents of IL-13. Functional equivalents of IL-13 according to the present disclosure preferably have at least about 85%, 95%, 96%, 97%, 98%, or even 99% overall sequence identity with the wild-type IL-13 (e.g., human IL-13). More particularly, IL-13 refers to the polypeptide sequence set forth as in the following paragraph.
[0111] The IL-13 polypeptide has the below sequence. The N-terminal 34 amino acid residues (in italics) is a signal peptide. The mature cytokine thus has 112 amino acid residues. Anti-IL-13 antibodies will bind to an epitope on the mature polypeptide.
Interleukin 13 amino acid sequence:
TABLE-US-00002 (SEQIDNo.1) 1 MHPLLNPLLLALGLMALLLTTVIALTCLGGFASPGPVPPSTALRELIEELVNITQNQKAP 61 LCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRD 121 TKIEVAQFVKDLLLEILKKLFREGRFN
[0112] As also further set forth in detail in the EXAMPLES, in particular embodiments of the inventive methods, the IL-13 antagonist utilized in the methods, including antibody 01951/G12 binds an epitope that includes the residues: FCPHKV (SEQ ID NO: 67) (underlined as residues 103-107 of SEQ ID NO.1).
[0113] IL-13 Antagonists
[0114] In principle any anti-IL-13 antagonists, including antibodies, which inhibit or neutralize the activity of IL-13 may be used in the invention, so long as the anti-IL-13 antagonist or antibody determinably and selectively reduces exacerbations in an asthma patient that is positive for at least one AIR marker selected from said group consisting of AIR marker-1, 2, 3, 4, 5, 6, 7, 8, and 9 as set forth in the methods of the invention. Such antibodies can be selected among those known in the art, see for example in WO2005/007699, US6468528, WO03007685, WO03034984, US20030143199, US2004028650, US20040242841, US2004023337, US20040248260, US20050054055, US20050065327, WO2006/124451, WO2006/003407, WO2005/062967, WO2006/085938, WO2006/055638, WO2007/036745, WO2007/080174 or WO2007/085815 Such antibodies are known in the art, see for example in WO2005/007699, US6468528, WO03007685, WO03034984, US20030143199, US2004028650, US20040242841, US2004023337, US20040248260, US20050054055, US20050065327, WO2006/124451, WO2006/003407, WO2005/062967, WO2006/085938, WO2006/055638, WO2007/036745, WO2007/080174 or WO2007/085815, WO2012/049278, and WO2008/106116.
[0115] In one embodiment, the antibodies used in the methods of the invention comprise one or more of the following CDRs. The CDRs listed in table 2a and 3a were determined according to the Kabat definition (E. Kabat et al, 1991, Sequences of Proteins of immunological Interest, 5.sup.th edition, public health Service, HIH, Bethesda, Md.:
TABLE-US-00003 TABLE2 SEQID SEQID SEQID No. No. No. Antibody HCDR1 HCDR1 HCDR2 HCDR2 HCDR3 HCDR3 01951/G12 GFTFSSYG 2 IWYDGSN 3 ARLWFGDLD 4
TABLE-US-00004 TABLE2a SEQID SEQID SEQID No. No. No. Antibody HCDR1 HCDR1 HCDR2 HCDR2 HCDR3 HCDR3 01951/G12 SYGMH 5 IIWYDGSNKYYADSVKG 6 LWFGDLDAFDI 7
TABLE-US-00005 TABLE3 SEQID SEQID SEQID No. No. No. Antibody LCDR1 LCDR1 LCDR2 LCDR2 LCDR3 LCDR3 01951/G12 QSVSSY 8 DA 9 QQRSSWPPV 10
TABLE-US-00006 TABLE3a SEQID SEQID SEQID No. No. No. Antibody LCDR1 LCDR1 LCDR2 LCDR2 LCDR3 LCDR3 01951/G12 RAGQSVSSYLV 11 DASNRAT 12 QQRSSWPPVYT 13
[0116] The full IgG1 antibody light and heavy chain constant regions are also shown below, incorporating, as an example, the variable regions of antibody 01951/G12 (emboldened).
01951/G12 Antibody Sequence
(i) HC Variable Region
[0117] The HC variable amino acid sequence for 01951/G12 is shown in SEQ ID NO: 14 and is encoded by the nucleotide sequence shown in SEQ ID NO: 15
TABLE-US-00007 EVQLVESGGGVVQPGRSLRL gaagtgcagctggtggagtctgggggaggcgtggtccagcctgggaggtccctgagactc 60 SCAASGFTFSSYGMHWVRQA tcctgtgcagcgtctggattcaccttcagtagctatggcatgcactgggtccgccaggct 120 PGKGLEWVAIIWYDGSNKYY ccaggcaaggggctggagtgggtggcaattatatggtatgatggaagtaataaatactat 180 ADSVKGRFTISRDNSKNTLY gcggactccgtgaagggccgattcaccatctccagagacaattccaagaacacgctgtat 240 LQMNSLRAEDTAVYYCARLW ctgcaaatgaacagcctgagagccgaggacacggctgtgtattactgtgcgaggctatgg 300 FGDLDAFDIWGQGTMVT (SEQIDNO:14) ttcggggacttagatgcttttgatatctggggccaagggacaatggtcacc 351(SEQIDNO:15)
(ii) LC Variable Region
[0118] The LC variable amino acid sequence for 01951/G12 is shown in SEQ ID NO: 16 and is encoded by the nucleotide sequence shown in SEQ ID NO: 17
TABLE-US-00008 EIVLTSPATTLSLSPGERAI gaaattgtgttgacgcagtctccagccaccctgtctttgtctccaggggaaagagccatc 60 LSCRAGQSVSSYLVWYQQKP ctctcctgcagggccggtcagagtgttagcagttacttagtctggtaccaacagaaacct 120 GQAPRRLLIYDARATTGIPA ggccaggctcccaggctcctcatctatgatgcatccaacagggccactggcatcccagcc 180 RFSGSGSGTDFTLTISSLEP aggttcagtggcagtgggtctgggacagacttcactctcaccatcagcagcctagagcct 240 EDFAVYYCQQRSSWPPVYTF gaagattttgcagtttattactgtcagcagcgcagcagctggcctccggtgtacactttt 300 GQGT (SEQIDNO:16) ggccaggggacc 312(SEQIDNO:17)
Full Antibody IgG1 Light Chain Sequence Incorporating the Variable Region of Antibody 01951/G12 (Emboldened)
[0119] The LC amino acid sequence is shown in SEQ ID NO: 18 and is encoded by the nucleotide sequence of SEQ ID NO: 19
TABLE-US-00009 MSVLTQVLALLLLWLTG 1 ATGAGTGTGCTCACTCAGGTCCTGGCGTTGCTGCTGCTGTGGCTTACAGG TRCEIVLTQSPATLSLS 51 TACGCGTTGTGAAATTGTGTTGACGCAGTCTCCAGCCACCCTGTCTTTGT PGERAILSCRAGQSVS 101 CTCCAGGGGAAAGAGCCATCCTCTCCTGCAGGGCCGGTCAGAGTGTTAGC SYLVWYQQKPGQAPRLL 151 AGTTACTTAGTCTGGTACCAACAGAAACCTGGCCAGGCTCCCAGGCTCCT IYDASNRATGIPARFSG 201 CATCTATGATGCATCCAACAGGGCCACTGGCATCCCAGCCAGGTTCAGTG SGSGTDFTLTISSLEP 251 GCAGTGGGTCTGGGACAGACTTCACTCTCACCATCAGCAGCCTAGAGCCT EDFAVYYCQQRSSWPPV 301 GAAGATTTTGCAGTTTATTACTGTCAGCAGCGCAGCAGCTGGCCTCCGGT YTFGQGTKLEIKRTVAA 351 GTACACTTTTGGCCAGGGGACCAAGCTTGAAATCAAACGAACTGTGGCTG PSVFIFPPSDEQLKSG 401 CACCATCTGTCTTCATCTTCCCGCCATCTGATGAGCAGTTGAAATCTGGA TASVVCLLNNFYPREAK 451 ACTGCCTCTGTTGTGTGCCTGCTGAATAACTTCTATCCCAGAGAGGCCAA VQWKVDNALQSGNSQES 501 AGTACAGTGGAAGGTGGATAACGCCCTCCAATCGGGTAACTCCCAGGAGA VTEQDSKDSTYSLSST 551 GTGTCACAGAGCAGGACAGCAAGGACAGCACCTACAGCCTCAGCAGCACC LTLSKADYEKHKVYACE 601 CTGACGCTGAGCAAAGCAGACTACGAGAAACACAAAGTCTACGCCTGCGA VTHQGLSSPVTKSFNRG 651 AGTCACCCATCAGGGCCTGAGCTCGCCCGTCACAAAGAGCTTCAACAGGG EC*(SEQIDNO:18) 701 GAGAGTGTTAG(SEQIDNO:19)
Full Antibody IgG1 Heavy Chain Sequence Incorporating the Variable Region of Antibody 01951/G12 (Emboldened)
[0120] The HC amino acid sequence is shown in SEQ ID NO: 20 and is encoded by the nucleotide sequence of SEQ ID NO: 21
TABLE-US-00010 MAWVWTLPFLMAAAQSV 1 ATGGCTTGGGTGTGGACCTTGCCATTCCTGATGGCAGCTGCCCAAAGTGT QAEVQLVESGGGVVQPG 51 CCAGGCAGAAGTGCAGCTGGTGGAGTCTGGGGGAGGCGTGGTCCAGCCTG RSLRLSCAASGFTFSS 101 GGAGGTCCCTGAGACTCTCCTGTGCAGCGTCTGGATTCACCTTCAGTAGC YGMHWVRQAPGKGLEWV 151 TATGGCATGCACTGGGTCCGCCAGGCTCCAGGCAAGGGGCTGGAGTGGGT AIIWYDGSNKYYADSVK 201 GGCAATTATATGGTATGATGGAAGTAATAAATACTATGCGGACTCCGTGA GRFTISRDNSKNTLYL 251 AGGGCCGATTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTG QMNSLRAEDTAVYYCAR 301 CAAATGAACAGCCTGAGAGCCGAGGACACGGCTGTGTATTACTGTGCGAG LWFGDLDAFDIWGQGTM 351 GCTATGGTTCGGGGACTTAGATGCTTTTGATATCTGGGGCCAAGGGACAA VTVSSASTKGPSVFPL 401 TGGTCACCGTCTCCTCAGCCTCCACCAAGGGCCCATCGGTCTTCCCCCTG APSSKSTSGGTAALGCL 451 GCACCCTCCTCCAAGAGCACCTCTGGGGGCACAGCGGCCCTGGGCTGCCT VKDYFPEPVTVSWNSGA 501 GGTCAAGGACTACTTCCCCGAACCGGTGACGGTGTCGTGGAACTCAGGCG LTSGVHTFPAVLQSSG 551 CCCTGACCAGCGGCGTGCACACCTTCCCGGCTGTCCTACAGTCCTCAGGA LYSLSSVVTVPSSSLGT 601 CTCTACTCCCTCAGCAGCGTCGTGACCGTGCCCTCCAGCAGCTTGGGCAC QTYICNVNHKPSNTKVD 651 CCAGACCTACATCTGCAACGTGAATCACAAGCCCAGCAACACCAAGGTGG KRVEPKSCDKTHTCPP 701 ACAAGAGAGTTGAGCCCAAATCTTGTGACAAAACTCACACATGCCCACCG CPAPELLGGPSVFLFPP 751 TGCCCAGCACCTGAACTCCTGGGGGGACCGTCAGTCTTCCTCTTCCCCCC KPKDTLMISRTPEVTCV 801 AAAACCCAAGGACACCCTCATGATCTCCCGGACCCCTGAGGTCACATGCG VVDVSHEDPEVKFNWY 851 TGGTGGTGGACGTGAGCCACGAAGACCCTGAGGTCAAGTTCAACTGGTAC VDGVEVHNAKTKPREEQ 901 GTGGACGGCGTGGAGGTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCA YNSTYRVVSVLTVLHQD 951 GTACAACAGCACGTACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGG WLNGKEYKCKVSNKAL 1001 ACTGGCTGAATGGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGCCCTC PAPIEKTISKAKGQPRE 1051 CCAGCCCCCATCGAGAAAACCATCTCCAAAGCCAAAGGGCAGCCCCGAGA PQVYTLPPSREEMTKNQ 1101 ACCACAGGTGTACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACC VSLTCLVKGFYPSDIA 1151 AGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCC VEWESNGQPENNYKTTP 1201 GTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCACGCC PVLDSDGSFFLYSKLTV 1251 TCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTATAGCAAGCTCACCG DKSRWQQGNVFSCSVM 1301 TGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATG HEALHNHYTQKSLSLSP 1351 CATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCCCC GK*(SEQIDNO:20) 1401 GGGTAAATGA(SEQIDNO:21)
[0121] In various embodiments, the invention encompasses disclosed pharmaceutical compositions, regimens, processes, uses, methods and kits utilizing an IL-13 antagonist (e.g., an anti-IL-13 antibody or antigen-binding portion thereof) set forth herein. In particular embodiments the kits comprise nucleic acid probes for detecting an AIR marker set forth herein. In further embodiments, the kits further comprise instructions comprising diagnosis or treatment of asthma.
[0122] In a particular embodiment, the invention provides a kit for determining the presence of at least one AIR marker selected from the group consisting of AIR marker 1, 2, 3, 4, 5, 6, 7, 8, or 9 in a sample obtained from an asthma patient, the kit comprising: a container containing one or more probes that specifically hybridize under stringent conditions to a nucleic acid comprising the responsive allele in one or more SNPs selected from the group set forth in Table 1.
[0123] In another embodiment, the kit comprises instructional materials indicating that the presence of at least AIR marker in a nucleic acid sample from the patient indicates that the patient is a candidate for treatment with an IL-13 antagonist as set forth herein.
[0124] In another embodiment, the kit comprises instructional materials indicating that the presence of at least 2 AIR markers in a nucleic acid sample from the patient indicates that the patient is a candidate for treatment with an IL-13 antagonist as set forth herein.
[0125] In another embodiment, the kit comprises instructional materials indicating that the presence of at least 3, 4, 5, 6, 7, 8, or 9 AIR markers in a nucleic acid sample from the patient indicates that the patient is a candidate for treatment with an IL-13 antagonist as set forth herein.
[0126] In another embodiment, the kit comprises a container containing one or more probes that specifically hybridize under stringent conditions to a nucleic acid comprising the responsive allele in one or more SNPs selected from the group set forth in Table 1. In another, the nucleic acid comprises two or more SNPs selected from the group set forth in Table 1. In another, the nucleic acid comprises 2, 3, 3, 4, 5, 6, 7, 8, or 9 or more SNPs selected from the group set forth in Table 1.
[0127] In another embodiment, the one or more probes specifically hybridize under stringent conditions to a nucleic acid comprising the responsive allele in SNP rs 8832, and/or rs 1050.
[0128] In another, the one or more probes and/or primers comprise probes and/or primers for use in nucleic acid amplification reaction.
Techniques for Assaying, Diagnostic Methods and Methods of Producing a Transmittable Form of Information
[0129] The disclosed methods are useful for the treatment, prevention, or amelioration of asthma diseases, as well as predicting the likelihood of an asthma patient's response to treatment with an IL-13 antagonist. These methods employ, inter alia, determining whether a patient has an AIR marker in a sample from the patient.
[0130] A biological sample from the patient may be assayed for the presence of an AIR marker by any applicable conventional means, which will be selected depending on whether the particular marker falls within an exon, an intron, a non-coding portion of mRNA or a non-coding genomic sequence.
[0131] Numerous biological samples may be used to identify the presence of alleles or proteins, the level of expression of genes or proteins, and the activity of a protein, e.g., blood, synovial fluid, buffy coat, serum, plasma, lymph, feces, urine, tear, saliva, cerebrospinal fluid, buccal swabs, sputum, or tissue. Various sources within a biological sample may be used in the disclosed methods, e.g., one may assay genomic DNA obtained from a biological sample to detect an AIR marker, or one may assay products of a an AIR marker, e.g., nucleic acid products (e.g., DNA, pre-mRNA, mRNA, micro RNAs, etc.) and polypeptide products (e.g., expressed proteins) obtained from a biological sample.
[0132] The inventive discovery encompasses the determination that the various AIR markers of Table 1 are useful for predicting certain patient's response to treatment by IL-13 antagonism. Of the SNPs in Table 1, most are found in genomic DNA and introns, such that a patient's allelic status may be determined by interrogating, e.g., pre-mRNA or genomic DNA. However, the presence of the AIR markers corresponding to exonic locations may be determined by assaying genomic DNA, RNA and/or protein sequence. Accordingly, a skilled artisan will understand that one may identify whether a subject has a given AIR marker by assaying a nucleic acid product of an AIR marker, a polypeptide product of an AIR marker, or an equivalent genetic marker of an AIR marker, as appropriate. In preferred embodiments, a genomic sequence of an AIR marker is analyzed to determine whether a subject has an AIR marker.
[0133] Numerous methods and devices are available to identify the presence of an AIR marker or polymorphism that results in a decreased level of expression, level of the coded protein or level of the protein's activity. DNA (genomic and cDNA) for SNP detection can be prepared from a biological sample by methods well known in the art, e.g., phenol/chloroform extraction, PUREGENE DNA purification system from GentAS Systems (Qiagen, Calif.). Detection of a DNA sequence may include examining the nucleotide(s) located at either the sense or the antisense strand within that region. The presence of polymorphisms in a patient may be detected from DNA (genomic or cDNA) obtained from PCR using sequence-specific probes, e.g., hydrolysis probes from Taqman, Beacons, Scorpions; or hybridization probes that detect the marker or polymorphism. For the detection of the polymorphism, sequence specific probes may be designed such that they specifically hybridize to the genomic DNA for the alleles of interest or, in some cases, an RNA of interest. Primers and probes for polymorphic sites (e.g., SNP) may be designed based on context sequences found in the NCBI SNP database available at: www.ncbi.nlm.nih.gov/snp. These probes may be labeled for direct detection or contacted by a second, detectable molecule that specifically binds to the probe. The PCR products also can be detected by DNA-binding agents. Said PCR products can then be subsequently sequenced by any DNA sequencing method available in the art. Alternatively the presence of allele can be detected by sequencing using any sequencing methods such as, but not limited to, Sanger-based sequencing, pyrosequencing or next generation sequencing (Shendure J. and Ji, H., Nature Biotechnology (1998), Vol. 26, Nr 10, pages 1135-1145). Optimised allelic discrimination assays for SNPs may be purchased from Applied Biosystems (Foster City, Calif., USA).
[0134] Various techniques can be applied to interrogate a particular polymorphism (e.g., SNP), including, e.g., hybridization-based methods, such as dynamic allele-specific hybridization (DASH) genotyping, polymorphic site (e.g., SNP) detection through molecular beacons (Abravaya K., et al. (2003) Clin Chem Lab Med. 41:468-474), Luminex xMAP Technology, Illumina Golden Gate technology and commercially available high-density oligonucleotide SNP arrays (e.g., the Affymetrix Human SNP 5.0 GeneChip performs a genome-wide assay that can genotype over 500,000 human SNPs), BeadChip kits from Illumina, e.g, Human660W-Quad and Human 1.2M-Duo); enzyme-based methods, such as restriction fragment length polymorphism (RFLP), PCR-based methods (e.g., Tetra-primer ARMS-PCR), Invader assays (Olivier M. (2005) Mutat Res. 573(1-2):103-10), various primer extension assays (incorporated into detection formats, e.g., MALDI-TOF Mass spectrometry, electrophoresis, blotting, and ELISA-like methods), TaqMan assays, and oligonucleotide ligase assays; and other post-amplification methods, e.g., analysis of single strand conformation polymorphism (Costabile et al. (2006) Hum. Mutat. 27(12):1163-73), temperature gradient gel electrophoresis (TGGE), denaturing high performance liquid chromatography, high-resolution melting analysis, DNA mismatch-binding protein assays (e.g., MutS protein from Thermus aquaticus binds different single nucleotide mismatches with different affinities and can be used in capillary electrophoresis to differentiate all six sets of mismatches), SNPLex (proprietary SNP detecting system available from Applied Biosystems), capillary electrophoresis, mass spectrometry, and various sequencing methods, e.g., pyrosequencing and next generation sequencing, etc. Commercial kits for SNP genotyping include, e.g., Fluidigm Dynamic Array IFCs (Fluidigm), TaqMan SNP Genotyping Assay (Applied Biosystems), MassARRAY iPLEX Gold (Sequenom), Type-it Fast SNP Probe PCR Kit (Quiagen), etc.
[0135] In some embodiments, the presence of a polymorphic site (e.g., SNP) in a patient is detected using a hybridization assay. In a hybridization assay, the presence of the genetic marker is determined based on the ability of the nucleic acid from the sample to hybridize to a complementary nucleic acid molecule, e.g., an oligonucleotide probe. A variety of hybridization assays are available. In some, hybridization of a probe to the sequence of interest is detected directly by visualizing a bound probe, e.g., a Northern or Southern assay. In these assays, DNA (Southern) or RNA (Northern) is isolated. The DNA or RNA is then cleaved with a series of restriction enzymes that cleave infrequently in the genome and not near any of the markers being assayed. The DNA or RNA is then separated, e.g., on an agarose gel, and transferred to a membrane. A labeled probe or probes, e.g., by incorporating a radionucleotide or binding agent (e.g., SYBR Green), is allowed to contact the membrane under low-, medium- or high-stringency conditions. Unbound probe is removed and the presence of binding is detected by visualizing the labeled probe. In some embodiments, arrays, e.g., the MassARRAY system (Sequenom, San Diego, Calif., USA) may be used to genotype a subject.
[0136] Traditional genotyping methods may also be modified for use in genotyping. Such traditional methods include, e.g., DNA amplification techniques such as PCR and variants thereof, direct sequencing, SSO hybridization coupled with the Luminex xMAP technology, SSP typing, and SBT.
[0137] Sequence-Specific Oligonucleotide (SSO) typing uses PCR target amplification, hybridization of PCR products to a panel of immobilized sequence-specific oligonucleotides on the beads, detection of probe-bound amplified product by color formation followed by data analysis. Those skilled in the art would understand that the described Sequence-Specific Oligonucleotide (SSO) hybridization may be performed using various commercially available kits, such as those provided by One Lambda, Inc. (Canoga Park, Calif.) or Lifecodes HLA Typing Kits (Tepnel Life Sciences Corp.) coupled with Luminex technology (Luminex, Corporation, TX). LABType SSO is a reverse SSO (rSSO) DNA typing solution that uses sequence-specific oligonucleotide (SSO) probes and color-coded microspheres to identify HLA alleles. The target DNA is amplified by polymerase chain reactions (PCR) and then hybridized with the bead probe array. The assay takes place in a single well of a 96-well PCR plate; thus, 96 samples can be processed at one time.
[0138] Sequence Specific Primers (SSP) typing is a PCR based technique which uses sequence specific primers for DNA based typing. The SSP method is based on the principle that only primers with completely matched sequences to the target sequences result in amplified products under controlled PCR conditions. Allele sequence-specific primer pairs are designed to selectively amplify target sequences which are specific to a single allele or group of alleles. PCR products can be visualized on agarose gel. Control primer pairs that matches non-allelic sequences present in all samples act as an internal PCR control to verify the efficiency of the PCR amplification. Those skilled in the art would understand that low, medium and high resolution genotyping with the described sequence-specific primer typing may be performed using various commercially available kits, such as the Olerup SSP kits (Olerup, Pa.) or (Invitrogen) or Allset and Gold DQA1 Low resolution SSP (Invitrogen).
[0139] Sequence Based Typing (SBT) is based on PCR target amplification, followed by sequencing of the PCR products and data analysis.
[0140] In some cases, RNA, e.g., mature mRNA, pre-mRNA, can also be used to determine the presence of particular polymorphisms (see Table 1). Analysis of the sequence of mRNA transcribed from a given gene can be performed using any known method in the art including, but not limited, to Northern blot analysis, nuclease protection assays (NPA), in situ hybridization, reverse transcription-polymerase chain reaction (RT-PCR), RT-PCR ELISA, TaqMan-based quantitative RT-PCR (probe-based quantitative RT-PCR) and SYBR green-based quantitative RT-PCR. In one example, detection of mRNA levels involves contacting the isolated mRNA with an oligonucleotide that can hybridize to mRNA encoded by an AIR marker. The nucleic acid probe can typically be, for example, a full-length cDNA, or a portion thereof, such as an oligonucleotide of at least 7, 15, 30, 50, or 100 nucleotides in length and sufficient to specifically hybridize under stringent conditions to the mRNA. Hybridization of an mRNA with the probe indicates that the marker in question is being expressed. In one format, the RNA is immobilized on a solid surface and contacted with a probe, for example by running the isolated RNA on an agarose gel and transferring the mRNA from the gel to a membrane, such as nitrocellulose. Amplification primers are defined as being a pair of nucleic acid molecules that can anneal to 5 or 3 regions of a gene (plus and minus strands, respectively, or vice-versa) and contain a short region in between. In general, amplification primers are from about 10 to 30 nucleotides in length and flank a region from about 50 to 200 nucleotides in length. Under appropriate conditions and with appropriate reagents, such primers permit the amplification of a nucleic acid molecule comprising the nucleotide sequence flanked by the primers. PCR products can be detected by any suitable method including, but not limited to, gel electrophoresis and staining with a DNA-specific stain or hybridization to a labeled probe.
[0141] The level of expression of a gene may be determined by measuring RNA (or reverse transcribed cDNA) levels using various techniques, e.g., a PCR-based assay, reverse-transcriptase PCR (RT-PCR) assay, Northern blot, etc. Quantitative RT-PCR with standardized mixtures of competitive templates can also be utilized.
[0142] In some cases, the presence of a polymorphism in a patient can be determined by analyzing polypeptide products of the AIR markers (see Table 1). Detection of polypeptide products can be performed using any known method in the art including, but not limited, to immunocytochemical staining, ELISA, flow cytometry, Western blot, spectrophotometry, HPLC, and mass spectrometry.
[0143] The use of immobilized antibodies specific for the proteins or polypeptides is also contemplated by the present disclosure. The antibodies can be immobilized onto a variety of solid supports, such as magnetic or chromatographic matrix particles, the surface of an assay place (such as microtiter wells), pieces of a solid substrate material (such as plastic, nylon, paper), and the like. An assay strip can be prepared by coating the antibody or a plurality of antibodies in an array on solid support. This strip can then be dipped into the test sample and then processed quickly through washes and detection steps to generate a measurable signal, such as a colored spot.
[0144] In a two-step assay, immobilized polypeptide products of an AIR marker or ERAP1 protein may be incubated with an unlabeled antibody. The unlabeled antibody complex, if present, is then bound to a second, labeled antibody that is specific for the unlabeled antibody. The sample is washed and assayed for the presence of the label. The choice of marker used to label the antibodies will vary depending upon the application. However, the choice of the marker is readily determinable to one skilled in the art. The antibodies may be labeled with a radioactive atom, an enzyme, a chromophoric or fluorescent moiety, or a colorimetric tag. The choice of tagging label also will depend on the detection limitations desired. Enzyme assays (ELISAs) typically allow detection of a colored product formed by interaction of the enzyme-tagged complex with an enzyme substrate. Some examples of radioactive atoms include .sup.32P, .sup.125I, .sup.3H, and .sup.14P. Some examples of enzymes include horseradish peroxidase, alkaline phosphatase, beta-galactosidase, and glucose-6-phosphate dehydrogenase. Some examples of chromophoric moieties include fluorescein and rhodamine. The antibodies may be conjugated to these labels by methods known in the art. For example, enzymes and chromophoric molecules may be conjugated to the antibodies by means of coupling agents, such as dialdehydes, carbodiimides, dimaleimides, and the like. Alternatively, conjugation may occur through a ligand-receptor pair. Some suitable ligand-receptor pairs include, for example, biotin-avidin or -streptavidin, and antibody-antigen.
[0145] In one aspect, the present disclosure contemplates the use of a sandwich technique for detecting polypeptide products in biological samples. The technique requires two antibodies capable of binding the protein of interest: e.g., one immobilized onto a solid support and one free in solution, but labeled with some easily detectable chemical compound. Examples of chemical labels that may be used for the second antibody include but are not limited to radioisotopes, fluorescent compounds, and enzymes or other molecules which generate colored or electrochemically active products when exposed to a reactant or enzyme substrate. When samples containing polypeptide products are placed in this system, the polypeptide products binds to both the immobilized antibody and the labeled antibody. The result is a sandwich immune complex on the support's surface. The complexed protein is detected by washing away nonbound sample components and excess labeled antibody, and measuring the amount of labeled antibody complexed to protein on the support's surface. The sandwich immunoassay is highly specific and very sensitive, provided that labels with good limits of detection are used.
[0146] Preferably, the presence of polypeptide products in a sample is detected by radioimmunoassays or enzyme-linked immunoassays, competitive binding enzyme-linked immunoassays, dot blot, Western blot, chromatography, preferably high performance liquid chromatography (HPLC), or other assays known in the art. Specific immunological binding of the antibody to the protein or polypeptide can be detected directly or indirectly.
[0147] Dot blotting is routinely practiced by the skilled artisan to detect a desired protein using an antibody as a probe (Promega Protocols and Applications Guide, Second Edition, 1991, Page 263, Promega Corporation). Samples are applied to a membrane using a dot blot apparatus. A labeled probe is incubated with the membrane, and the presence of the protein is detected.
[0148] Western blot analysis is well known to the skilled artisan (Sambrook et al., Molecular Cloning, A Laboratory Manual, 1989, Vol. 3, Chapter 18, Cold Spring Harbor Laboratory). In Western blot, the sample is separated by SDS-PAGE. The gel is transferred to a membrane. The membrane is incubated with labeled antibody for detection of the desired protein.
[0149] The assays described above involve steps such as but not limited to, immunoblotting, immunodiffusion, immunoelectrophoresis, or immunoprecipitation. In some embodiments, an automatic analyzer is used to determine the presence of an AIR marker.
[0150] In performing any of the methods described herein that require determining the presence of an AIR marker or polymorphism, such determination may be made by consulting a data repository that contains sufficient information on the patient's genetic composition to determine whether the patient has the marker of interest. Preferably, the data repository lists the genotype present (or absent) in the individual. The data repository could include the individual's patient records, a medical data card, a file (e. g., a flat ASCII file) accessible by a computer or other electronic or non-electronic media on which appropriate information or genetic data can be stored. As used herein, a medical data card is a portable storage device such as a magnetic data card, a smart card, which has an on-board processing unit and which is sold by vendors such as Siemens of Munich Germany, or a flash-memory card. If the data repository is a file accessible by a computer; such files may be located on various media, including: a server, a client, a hard disk, a CD, a DVD, a personal digital assistant such as a smart phone, Palm Pilot, a tape recorder, a zip disk, the computer's internal ROM (read-only-memory) or the internet or worldwide web. Other media for the storage of files accessible by a computer will be obvious to one skilled in the art.
[0151] Typically, once the presence of an AIR marker or polymorphism is determined, physicians or genetic counselors or patients or other researchers may be informed of the result. Specifically the result can be cast in a transmittable form of information that can be communicated or transmitted to other researchers or physicians or genetic counselors or patients. Such a form can vary and can be tangible or intangible. The result in the individual tested can be embodied in descriptive statements, diagrams, photographs, charts, images or any other visual forms. For example, images of gel electrophoresis of PCR products can be used in explaining the results. Diagrams showing where a variant occurs in an individual's allele are also useful in indicating the testing results. Statements regarding the presence of an AIR marker or polymorphism are also useful in indicating the testing results. These statements and visual forms can be recorded on a tangible media such as papers, computer readable media such as floppy disks, compact disks, etc., or on an intangible media, e.g., an electronic media in the form of email or website on internet or intranet. In addition, the result can also be recorded in a sound form and transmitted through any suitable media, e.g., analog or digital cable lines, fiber optic cables, etc., via telephone, facsimile, wireless mobile phone, internet phone and the like. All such forms (tangible and intangible) would constitute a transmittable form of information. Thus, the information and data on a test result can be produced anywhere in the world and transmitted to a different location. For example, when a genotyping assay is conducted offshore, the information and data on a test result may be generated and cast in a transmittable form as described above. The test result in a transmittable form thus can be imported into the U.S. Accordingly, the present disclosure also encompasses a method for producing a transmittable form of information containing the presence or absence of an AIR marker or polymorphism in an individual. This form of information is useful for predicting the responsiveness of a patient having asthma, and for selectively treating a patient based upon that information.
Methods of Treatment and Uses of IL-13 Antagonists
[0152] The disclosed methods allow clinicians to provide a personalized therapy for asthma patients, i.e., they allow determination of whether to selectively treat the patient with an IL-13 antagonist. In this way, a clinician can maximize the benefit and minimize the risk of IL-13 antagnoism in the entire population of patients afflicted with asthma. It will be understood that IL-13 antagonists are useful for the treatment, prevention, or amelioration of asthma, including moderate or severe asthma. The IL-13 antagonists, may be used in vitro, ex vivo, or incorporated into pharmaceutical compositions and administered to individuals (e.g., human patients) in vivo to treat, ameliorate, or prevent asthma, e.g., in patients who have an AIR marker. A pharmaceutical composition will be formulated to be compatible with its intended route of administration (e.g., oral compositions generally include an inert diluent or an edible carrier). Other nonlimiting examples of routes of administration include parenteral (e.g., intravenous), intradermal, subcutaneous, oral (e.g., inhalation), transdermal (topical), transmucosal, and rectal administration. The pharmaceutical compositions compatible with each intended route are well known in the art.
[0153] The IL-13 antagonists, may be used as a pharmaceutical composition when combined with a pharmaceutically acceptable carrier. Such a composition may contain, in addition to an IL-13 antagonist, carriers, various diluents, fillers, salts, buffers, stabilizers, solubilizers, and other materials well known in the art. The characteristics of the carrier will depend on the route of administration.
[0154] Antibodies, e.g., antibodies to IL-13, are typically formulated either in aqueous form ready for parenteral administration or as lyophilisates for reconstitution with a suitable diluent prior to administration. In some embodiments of the disclosed methods and uses, the IL-13 antagonist, e.g., IL-13 antibody, is formulated as a lyophilisate. Suitable lyophilisate formulations can be reconstituted in a small liquid volume (e.g., 2 ml or less) to allow subcutaneous administration and can provide solutions with low levels of antibody aggregation. The use of antibodies as the active ingredient of pharmaceuticals is now widespread, including the products HERCEPTIN (trastuzumab), RITUXAN (rituximab), SYNAGIS (palivizumab), etc. Techniques for purification of antibodies to a pharmaceutical grade are well known in the art. When a therapeutically effective amount of an IL-13 antagonist is administered by intravenous, cutaneous or subcutaneous injection, the IL-13 antagonist will be in the form of a pyrogen-free, parenterally acceptable solution. A pharmaceutical composition for intravenous, cutaneous, or subcutaneous injection may contain, in addition to the IL-13 antagonist, an isotonic vehicle such as sodium chloride, Ringer's, dextrose, dextrose and sodium chloride, lactated Ringer's, or other vehicle as known in the art.
[0155] The appropriate dosage will, of course, vary depending upon, for example, the particular IL-13 antagonists to be employed, the host, the mode of administration and the nature and severity of the condition being treated, and on the nature of prior treatments that the patient has undergone. Ultimately, the attending health care provider will decide the amount of the IL-13 antagonist with which to treat each individual patient.
[0156] In practicing some of the methods of treatment or uses of the present disclosure, a therapeutically effective amount of an IL-13 antagonist is administered to a patient, e.g., a mammal (e.g., a human). While it is understood that the disclosed methods provide for selective treatment of patients depending on the presence of an AIR marker, this does not preclude that, if the patient is ultimately treated with an IL-13 antagonist, such IL-13 antagonist therapy is necessarily a monotherapy. Indeed, if a patient is selected for treatment with an IL-13 antagonist, then the IL-13 antagonist may be administered in accordance with the method of the disclosure either alone or in combination with other therapeutics for treating asthma. When coadministered with one or more additional therapeutics, an IL-13 antagonist may be administered either simultaneously with the other therapeutic, or sequentially. If administered sequentially, the attending physician will decide on the appropriate sequence of administering the IL-13 antagonist in combination with other therapeutics, as well as the appropriate dosages for co-delivery.
[0157] An IL-13 antagonist, is conveniently administered parenterally, intravenously, e.g., into the antecubital or other peripheral vein, intramuscularly, or subcutaneously. The duration of intravenous (i.v.) therapy using a pharmaceutical composition of the present disclosure will vary, depending on the severity of the disease being treated and the condition and personal response of each individual patient. Also contemplated is subcutaneous (s.c.) therapy using a pharmaceutical composition of the present disclosure. The health care provider will decide on the appropriate duration of i.v. or s.c. therapy and the timing of administration of the therapy, using the pharmaceutical composition of the present disclosure.
[0158] Doses may be delivered based on weight, e.g., 3 mg/kg, 10 mg/kg, 15 mg/kg, or as a fixed amount, e.g., 75 mg, 150 mg, 300 mg, 1000 mg depending on the severity of the disease.
Kits
[0159] The invention also encompasses kits for detecting an AIR marker or polymorphism, expression level, protein level or activity, in a biological sample (a test sample) from an asthma patient. Such kits can be used to predict if a patient having asthma is likely to respond (or have a higher response) to treatment with an IL-13 antagonist. For example, the kit can comprise a probe (e.g., an oligonucleotide, antibody, labeled compound or other agent) capable of detecting an AIR marker or polymorphism, products of those alleles and/or an equivalent genetic marker of those alleles in a biological sample. The kit may also comprise instructions for providing a prediction of the likelihood that the patient will respond to treatment with the IL-13 antagonist.
[0160] Probes may specifically hybridize to genomic sequences, nucleic acid products, or polypeptide products. Exemplary probes are oligonucleotides or conjugated oligonucleotides that specifically hybridizes to the responsive alleles of Table 1; an antibody that is capable of differentiating between polypeptide products encoded by the disclosed alleles; primer-extension oligonucleotides, allele-specific primers, a combination of allele-specific primers, allele-specific probes, and primer extension primers, etc. Optionally, the kit can contain a probe that targets an internal control allele, which can be any allele presented in the general population. Detection of an internal control allele is designed to assure the performance of the kit. The disclosed kits can also comprise, e.g., a buffering agent, a preservative, or a protein stabilizing agent. The kit can also comprise components necessary for detecting the detectable agent (e.g., an enzyme or a substrate). The kit can also contain a control sample or a series of control samples that can be assayed and compared to the test sample contained. Each component of the kit is usually enclosed within an individual container, and all of the various containers are within a single package along with instructions for use.
[0161] Such kits may also comprise an IL-13 antagonist or a pharmaceutical composition comprising the IL-13 antagonist. Such kits are useful in the selective treatment of asthma patients using an IL-13 antagonist. Additionally, such kits may comprise means for administering the IL-13 antagonist (e.g., a syringe and vial, a prefilled syringe, a prefilled pen) and instructions for use. These kits may contain additional therapeutic agents for treating asthma, e.g., for delivery in combination with the enclosed IL-13 antagonist.
[0162] The phrase means for administering is used to indicate any available implement for systemically administering a drug top a patient, including, but not limited to, a pre-filled syringe, a vial and syringe, an injection pen, an autoinjector, an i.v. drip and bag, a pump, etc. With such items, a patient may self-administer the drug (i.e., administer the drug on their own behalf) or a physician may administer the drug.
[0163] The details of one or more embodiments of the disclosure are set forth in the accompanying description above. Although any methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present disclosure, the preferred methods and materials are now described. Other features, objects, and advantages of the disclosure will be apparent from the description and from the claims. In the specification and the appended claims, the singular forms include plural referents unless the context clearly dictates otherwise. Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure belongs. All numerical ranges in this disclosure are inclusive of the endpoints and of all integers, decimals and fractions therebetween whether specifically stated or not. All patents and publications cited in this specification are incorporated by reference. The following Examples are presented in order to more fully illustrate the preferred embodiments of the disclosure. These examples should in no way be construed as limiting the scope of the disclosed patient matter, as defined by the appended claims.
EXAMPLES
List of Abbreviations
[0164]
TABLE-US-00011 Abbreviation Explanation ACQ Asthma Control Questionnaire DNA Deoxyribonucleic Acid FEV Forced Expiratory Volume IgE Immunoglobulin E IL-4 Interleukin 4 IL4-R Interleukin 4 Receptor, Alpha IL-13 Interleukin 13 LD Linkage Disequilibrium SNP Single Nucleotide Polymorphism UTR Untranslated Region
Example 1
Identification of Il-13 Antagonists
[0165] For the purposes of the invention, IL-13 antagonists that compete with a specified anti-IL-13 antibody set forth herein, including antibody 01951/G12 (SEQ ID NO:14 and 16) for binding to IL-13 can be identified by methods known in the art, and further as described in the following methodology.
[0166] All experiments are performed using a Biacore T200 instrument. Biacore T200 Control software and Biacore T200 Evaluation software are used for the control and analysis of experiments, respectively.
[0167] PART 1: The anti-human IL-13 antibody ANTIBODY 01951/G12 is immobilized to a CM5 sensorchip surface using the amine coupling method. Briefly, the surface of the measuring flow cell is activated with EDC/NHS, followed by a 700 second addition of 50 g/mL ANTIBODY 01951/G12 in 10 mM sodium acetate pH 4.5. Based on previous experiments, these buffers and injection times are sufficient to allow saturation of the chip surface with ANTIBODY 01951/G12, though exposure time could be reduced if saturation was achieved prior to 700 seconds. Immobilization buffers that are potentially more suitable could be determined by buffer scouting. Any remaining active surface groups are subsequently blocked with ethanolamine. The surface of the reference flow cell is activated with EDC/NHS and subsequently blocked with ethanolamine without immobilization of protein (blank immobilization) or by the addition of an isotype control antibody. Based on previous studies using ANTIBODY 01951/G12 immobilization, an appropriate running buffer is HBS-EP+ containing 10 mM HEPES, 150 mM NaCl, 0.005% (w/v) polysorbate 20 and 3 mM EDTA at pH 7.4.
[0168] PART 2: A concentration-response curve for human IL-13 is performed to determine the appropriate concentration of IL-13 to use in the subsequent epitope competition studies. IL-13 is diluted in running buffer and, beginning at 25 nM, is flowed over the reference and measuring flow cell at a flow rate of 30 L/min. The optimal rate can be adjusted experimentally. The association time is 120 seconds and dissociation time is 120 seconds, although dissociation time could be extended to 180 seconds, or 600 seconds or more if an affinity (K.sub.D) measurement is required. Regeneration of the surface with a 30 second injection of 10 mM Glycine at pH 2.0, at a flow rate of 10 L/min, is necessary to remove IL-13 from ANTIBODY 01951/G12 after the dissociation step. A second regeneration step immediately after the first is sometimes required. These steps are repeated over the following dilution series of IL-13: 25, 12.5, 6.25, 3.13, 1.56 and 0 nM. Based on previous studies, this dilution series would be suitable for preliminary experiments, but may need to be changed accordingly. The dilution series is run twice to provide n=2. Analysis temperature is 25 C. Running buffer is HBS-P+ containing 10 mM HEPES, 150 mM NaCl, 0.005% (w/v) and polysorbate 20 at pH 7.4. Data is evaluated using a 1:1 binding model with Biacore T200 Evaluation software.
[0169] PART 3: Epitope competition studies are done using a dual binding method. Based on the data from Part 2, a concentration of IL-13 that gives approximately 50 RU binding to ANTIBODY 01951/G12 is injected for 120 seconds at 30 L/min. There is NO dissociation phase; instead a second injection of a competitor anti-IL-13 antibody immediately follows, at a 10-fold*greater concentration than IL-13. Previous studies with respect to IL-25 have used an association phase of 120 seconds, with a flow rate of 30 L/min, mirroring the IL-13 addition. Any competitor that binds to IL-13 using a different epitope to that of ANTIBODY 01951/G12 will give a binding response. Those that bind to IL-13 using the same epitope as ANTIBODY 01951/G12 will give no binding response. A variable dissociation period can apply, followed by an acidic wash step to remove both the IL-13 and the competitor addition. This step can be reversed, with competitor antibody immobilized to the chip surface and ANTIBODY 01951/G12 as the second addition, to confirm results. Running buffer is HBS-P+ containing 10 mM HEPES, 150 mM NaCl, 0.005% (w/v) and polysorbate 20 at pH 7.4.
Example 2
Identification of the Antibody 01951/G12 Epitope Residues
Peptide Mapping:
[0170] The sequence of IL-13 was probed at the peptide level to identify the binding site with ANTIBODY 01951/G12. Thirty four 15-mer peptides were synthesized in order to scan the entire sequence with 12 residue overlap starting from the N-terminus. The synthesis of the peptides, preparation of the peptide-array slides, incubation with antibodies and data analysis where done as described by Maksimov et al. (PLoS ONE 7(3): e34212).
[0171] The results are shown in Table 4. The binding signal intensity (light unit) observed is reported for each peptide, in column 1 against a control unrelated human antibody and in column 2 against ANTIBODY 01951/G12. Signals above 10000 Light Units are considered as being significant. 2 overlapping peptides in the set of the 34 peptides produced a signal above that threshold, peptide 22 (TQRMLSGFCPHKVSA) (SEQ ID NO: 31) and peptide 23 (MLSGFCPHKVSAGQF) (SEQ ID NO: 32). The overlapping sequence between both peptides is MLSGFCPHKVSA (SEQ ID NO: 33).
[0172] In order to verify that this sequence is important for the binding of IL-13 to ANTIBODY 01951/G12 and eventually narrow it down further, a substitution analysis was performed. For this substitution analysis, a peptide array was created where each residue of the sequence MLSGFCPHKVSA was exchanged against every possible 20 standard amino acid, creating a set of 240 peptides in which 228 peptides differ from the original sequence by 1 amino acid at a time. The result of the binding study with ANTIBODY 01951/G12 is presented in
Sequence of IL-13 Used for Peptide Mapping:
[0173]
TABLE-US-00012 (SEQIDNO:34) SPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALE SLINVSGCSAIEKTQRMLSGFCPEIKVSAGQFSSLHVRDTKIEVAQFVKD LLLEILKKLFREGRFN.
TABLE-US-00013 TABLE4 Signalintensities(LightUnit)ofpeptidesofIL-13ofcontrol antibodyandtargetantibody(ANTIBODY01951/G12)incubations. SEQ CorrectedMean ID CorrectedMean ANTIBODY Index peptidesequence NO: control-antibody 01951/G12 1 SPGPVPPSTALRELI 35 44.3 -1072.3 2 PVPPSTALRELIEEL 36 -9 -1133.3 3 PSTALRELIEELVNI 37 -7.3 -210.5 4 ALRELIEELVNITQN 38 -16.7 -207 5 ELIEELVNITQNQKA 39 -2.7 -131 6 EELVNITQNQKAPLC 40 1.5 1 7 VNITQNQKAPLCNGS 41 28 -405 8 TQNQKAPLCNGSMVW 42 41.7 -350.5 9 QKAPLCNGSMVWSIN 43 27.7 -518 10 PLCNGSMVWSINLTA 44 -6.5 -982 11 NGSMVWSINLTAGMY 45 -5 -131.5 12 MVWSINLTAGMYCAA 46 19 56.5 13 SINLTAGMYCAALES 47 -1.5 -757 14 LTAGMYCAALESLIN 48 1 -99.7 15 GMYCAALESLINVSG 49 1 -987 16 CAALESLINVSGCSA 50 1 -586.7 17 LESLINVSGCSAIEK 51 18.7 -340.3 18 LINVSGCSAIEKTQR 52 12.5 -539.3 19 VSGCSAIEKTQRMLS 53 15 -830.3 20 CSAIEKTQRMLSGFC 54 26 -721.3 21 IEKTQRMLSGFCPHK 55 101 2207 22 TQRMLSGFCPHKVSA 31 123 38568 23 MLSGFCPHKVSAGQF 32 23 48125.7 24 GFCPHKVSAGQFSSL 56 3.3 492.7 25 PHKVSAGQFSSLHVR 57 -24.7 -386.5 26 VSAGQFSSLHVRDTK 58 3.7 -778.5 27 GQFSSLHVRDTKIEV 59 -10.5 -291 28 SSLHVRDTKIEVAQF 60 -6 -170 29 HVRDTKIEVAQFVKD 61 -17 -734.3 30 DTKIEVAQFVKDLLL 62 -13 -438.5 31 IEVAQFVKDLLLHLK 63 -11 -810 32 AQFVKDLLLHLKKLF 64 25 -746.5 33 VKDLLLHLKKLFREG 65 19 -203 34 LLLHLKKLFREGRFN 66 322 7152.3
Example 3
Pharmacogenetic Analysis of IL4-R SNPs and Discovery of AIR Markers 1-9
[0174] ANTIBODY 01951/G12 is a fully human IgG1/ monoclonal antibody. CQAX576A2207 was a Phase II clinical study to evaluate the effectiveness and safety of ANTIBODY 01951/G12 in patients with moderate to severe persistent asthma following multiple doses, when added to existing asthma therapy.
[0175] To assess associations of several single nucleotide polymorphisms (SNPs) in the IL4-R gene and risk of asthma exacerbation in patients treated with ANTIBODY 01951/G12, DNA was collected from patients enrolled in the CQAX576A2207 trial and nine SNPs in the IL4-R gene were genotyped in these samples. Statistical tests of association were performed to assess the evidence for association of SNPs in the IL4-R gene with risk of asthma exacerbation, as well as with other asthma clinical endpoints, in patients treated with ANTIBODY 01951/G12.
[0176] In this manner, a pharmacogenetic analysis was undertaken, with the objective: [0177] To evaluate whether certain SNPs in the IL4-R gene are associated with risk of asthma exacerbation in patients treated with ANTIBODY 01951/G12. [0178] To evaluate whether certain SNPs are associated with change from baseline in ACQ7 score, FEV1, or IgE level in patients treated with ANTIBODY 01951/G12. [0179] To evaluate whether the aforementioned SNPs are associated with risk of asthma exacerbation in patients treated with placebo.
Study Population
[0180] The study population included all patients who met the following criteria: [0181] Were included in the final analysis population of the CQAX576A2207 clinical study, and [0182] Did not have a discrepancy between gender as recorded in the clinical database vs. as determined genetically
Clinical Endpoints Evaluated
[0183] Statistical tests were performed to evaluate evidence for association between IL4-R SNPs and the following asthma clinical endpoints: [0184] Risk of occurrence of at least one asthma exacerbation from baseline to Week 24 [0185] Mean absolute change from baseline to Week 24 in ACQ7 score [0186] Mean percent change from baseline to Week 24 in FEV1 level [0187] Mean percent change from baseline to Week 24 in IgE level
Genetic Markers Evaluated
[0188] The following strategies were employed to identify genetic variants associated with response to ANTIBODY 01951/G12.
[0189] Candidate SNPs
[0190] The 9 SNPs utilized in this pharmacogenetic analysis are listed in Table 5 together with their location relative to the gene structure and, where applicable, their effect on the gene product. They are listed in their physical order along the gene. The SNPs were genotyped using the Taqman platform.
TABLE-US-00014 TABLE 5 Reported association with pitrakinra exacerbation SNP risk Location Effect rs1110470 yes intron unknown rs3024530 yes intron unknown rs1805010 yes exon amino acid change (I.fwdarw.V) rs2239347 yes intron unknown rs1805011 no exon amino acid change (E.fwdarw.A) rs1801275 no exon amino acid change (Q.fwdarw.R) rs8832 yes 3 UTR some UTR variants affect gene transcription level rs1029849 yes 3 proximal unknown rs4787956 yes 3 proximal unknown UTR, untranslated region
Genome-Wide Association Study (GWAS)
[0191] A genome-wide association study (GWAS) was performed using the Illumina Omni5Exome chip. All SNPs that map to the IL4-R gene were evaluated.
Resequencing of the IL4-R Gene
[0192] Sanger sequencing was performed on most exons in the IL4-R gene, as well as the 3 untranslated region (UTR), to determine whether any additional variants could be identified that were not included on the Omni5Exome chip.
Genotyping Methods
Candidate SNPs
[0193] Sample Reactions were prepared following the Protocol recommended by the vendor, TaqMan SNP Genotyping Assays Protocol (PN 4332856D), and using Taqman Universal Master mix (PN 4326614), with the following exceptions: [0194] 2.00 uL of DNA sample per reaction [0195] 0.25 ul of Water was added per reaction
[0196] PCR reactions were conducted on the GeneAmp 9700 (Applied Biosystems) using the program specified in the vendor protocol with the following exception: [0197] Standard thermal profile is used with 50 cycles, rather than 40
[0198] Endpoint reads were conducted on the ABI PRISM 7900HT Sequence Detection System, with data analysis by SNP Manager and SDS 2.2.2 (Applied Biosystems).
GWAS
[0199] Genotype data for the GWAS were generated using the Illumina HumanOMNI5Exome microarray platform.
Resequencing of the IL4-R Gene
[0200] SNPs were identified by Sanger sequencing in IL4R (NT_010393.15). PCR was performed using unique primers carrying M13 universal sequence tags. Amplicons for each coding region were bi-directionally sequenced with unique or universal primers and BigDye Terminator v3.1 (Applied Biosystems, 4337456). Sequencing products were cleaned up with CleanSEQ (Beckman, A29154) and run on a 3730xl Genetic Analyzer (Applied Biosystems) with POP-7 for sequence detection. Traces were aligned to reference sequences for each amplicon from NCBI using PhredPhrap (University of Washington) and were then visually inspected for discrepancies from canonical sequence using Consed (University of Washington, version 19.0). Sequence variations were noted and any corresponding coding changes characterized where possible.
Statistical Methods
Analysis of Asthma Exacerbation Risk
[0201] All tests of association between SNPs and risk of asthma exacerbations were conducted by way of a conditional logistic regression model using PROC LOGISTIC in SAS version 9.3, with country as the conditioning factor. All tests were designed to evaluate the hypothesis of an additive relationship between genotype and exacerbation risk (on the logit scale), meaning that the risk among heterozygotes is intermediate to that within the two homozygous classes. The additive hypothesis was tested by specifying genotype as a continuous variable equal to the number of copies of the minor (i.e., less common in the CQAX576A2207 sample) allele carried by the patient.
[0202] Race and ethnicity are known to be common confounding factors in genetic association studies; as such, it is advisable to adjust for race and ethnicity in association tests where possible. In the CQAX576A2207 study the distributions of race and ethnicity were too imbalanced to enable adjustment for these factors, so the logistic regression was instead conditioned on country as a proxy for those factors.
[0203] The score statistic was used to assess statistical significance. No adjustment was made for multiple testing.
Analysis of Change from Baseline in ACQ7, FEV1, and IgE
[0204] All tests for association between SNPs and absolute change from baseline in ACQ7, percent change from baseline in FEV1, and percent change from baseline in IgE were conducted by way of a linear model using PROC GENMOD in SAS version 9.3. All tests evaluated the hypothesis of an additive relationship between genotype and the endpoint, as described in Section 3.4.1. Country, history of atopy, maintenance oral corticosteroid use, and baseline level of the corresponding endpoint were included in the model as covariates. A Wald chi-square test was used to assess statistical significance. No adjustment was made for multiple testing.
Permutation Test to Assess Overall Significance
[0205] A permutation test was performed to assess the likelihood of finding that each of the top 7 SNPs in Table 5 (i.e. excluding the bottom 2 SNP's: rs1029849, and rs4787956) would be found to have a homozygous genotype class in which there were no exacerbations among ANTIBODY 01951/G12-treated patients, if in reality there were no association between any of the SNPs and ANTIBODY 01951/G12 exacerbation risk.
[0206] The permutation test proceeded according to the following steps: [0207] For the first permutation, exacerbation status (yes/no) was randomly permuted for the 94 ANTIBODY 01951/G12-treated patients, such that it remained the case that only 12 of the 94 patients experience an exacerbation but these 12 patients were selected at random. All genotype data remained unchanged. [0208] Using this permuted dataset, each SNP was evaluated to determine whether it had a homozygous genotype class in which there were no exacerbations. If all 7 SNPs were found to have such a genotype class, the permuted dataset was flagged to record that finding. [0209] The first 2 steps were iterated 1000 times. The percentage of permuted datasets that were flagged to indicate that each of the 7 SNPs had a homozygous genotype class with no exacerbations represented the empirical significance level of this finding. Thus, a small percentage of flagged datasets would indicate a low likelihood of observing such a result by random chance, and would be taken as evidence that risk of asthma exacerbation among ANTIBODY 01951/G12-treated patients is influenced by SNPs in the IL4-R gene.
Calculation of r-Squared Values in the Linkage Disequilibrium Graph
[0210] The r.sup.2 values in the LD graph were computed using Haploview software (Barrett et al, 2004).
Cross-Validation Analysis to Assess Optimal Number of SNPs for Prediction
[0211] Cross-validation is a statistical method that can be used to compare alternative approaches to building predictive models to assess which approach is most likely to yield the model with highest predictive accuracy. The method entails dividing the available set of patients into a training set and a test set, applying alternative model-building approaches to the training set only, using the resulting models to predict the outcome of the patients in the test set, and determining which model predicted most accurately. This procedure is repeated many times, the predictions are averaged across the test sets. If a particular approach tends to result in more accurate predictions than the other approaches, it suggests that this approach may also result in a model with the highest predictive accuracy when applied to future studies.
[0212] In this application of cross-validation, once the selected SNPs were determined for each of the model-building approaches listed below, linear discriminant analysis (LDA) was applied to build the predictive model. The set of markers available for selection consisted of 6 of the top 7 IL4-R SNPs listed in Table 5. rs3024530 was removed because it was almost perfectly correlated with rs1805010. The procedure was then applied to patients treated with ANTIBODY 01951/G12 to compare the following model-building approaches: [0213] Include the most significant SNP from each of the 2 linkage disequilibrium (LD) blocks [0214] Include the 2 SNPs selected above, as well as the next most significant SNP [0215] Include the 2 most significant SNPs from each of the 2 LD blocks [0216] Include the 4 SNPs selected above, as well as the next most significant SNP [0217] Include all 6 SNPs.
[0218] The results were compared to evaluate whether a predictive model that includes additional SNPs would be likely to have substantially higher predictive accuracy than one which contains only the single most significant SNP from each of the 2 LD blocks.
Results:
Genotype Frequencies of IL4-R SNPs
[0219] A total of 94 ANTIBODY 01951/G12-treated patients and 102 placebo-treated patients were genotyped for the 9 SNPs in the IL4-R gene listed in Table 5. Two patients, both placebo-treated, had a discrepancy between gender as recorded in the clinical database vs. as determined genetically, and were removed from the analysis. Both were from the same country, suggesting a possible sample switch.
[0220] Twelve of the 94 ANTIBODY 01951/G12-treated patients (12.8%) experienced at least one asthma exacerbation during the study, compared to 23 of 100 placebo-treated patients (23.0%). The distribution was consistent with Hardy-Weinberg equilibrium for each SNP.
TABLE-US-00015 TABLE 0-1 Genotype frequency distributions in ANTIBODY 01951/G12 and pitrakinra studies ANTIBODY Genotype 01951/G12 frequency study SNP distribution n (%) rs1110470 GG 61 (31.4%) AG 97 (50.0%) AA 36 (18.6%) rs3024530 AA 48 (24.7%) AG 106 (54.6%) GG 40 (20.6%) rs1805010 AA 47 (24.5%) AG 105 (54.7%) GG 40 (20.8%) rs2239347 AA 48 (24.7%) AC 98 (50.5%) CC 48 (24.7%) rs1805011 AA 159 (82.4%) AC 31 (16.1%) CC 3 (1.6%) rs1801275 AA 127 (65.5%) AG 56 (28.9%) GG 11 (5.7%) rs8832 GG 58 (29.9%) AG 93 (47.9%) AA 43 (22.2%) rs1029849 GG 68 (35.2%) AG 86 (44.6%) AA 39 (20.2%) rs4787956 AA 71 (36.6%) AG 99 (51.0%) GG 24 (12.4%) Genotype frequencies were calculated by combining the ANTIBODY 01951/G12 and placebo arms.
Association Between IL4-R SNPs and Risk of Exacerbation
[0221] The proportion of ANTIBODY 01951/G12-treated patients who experienced at least one asthma exacerbation during the study is shown in
[0222] Since race is well known to be a common confounding factor in genetic association studies, the association tests for ANTIBODY 01951/G12-treated patients were repeated using only self-reported Caucasian patients, but the p-values were unchanged. This is likely because 89 of the 94 patients (94.7%) were Caucasian, and the 5 non-Caucasians were all from countries in which there were no exacerbations.
[0223] Of particular note in the ANTIBODY 01951/G12 study, for each of the 7 SNPs there was one homozygous class for which no exacerbations were observed among ANTIBODY 01951/G12-treated patients, a result that would be unlikely to occur by random chance.
[0224] The results for the two bottom SNPs listed in Table 5, which code for amino acid changes in the IL-4RA receptor, showed weaker evidence for association with p-values 0.091 and 0.10.
[0225] The proportion of placebo-treated patients in the ANTIBODY 01951/G12 study who experienced at least one asthma exacerbation is shown in
[0226] The SNPs shown in all tables and figures for this pharmacogenetic analysis are ordered according to their physical location within the gene.
Association Between IL4-R SNPs and Other Asthma Endpoints
[0227] The 9 genotyped SNPs were also evaluated in ANTIBODY 01951/G12-treated patients for evidence of association with 3 other asthma endpoints: change from baseline in ACQ7 score, percent change from baseline in FEV1, and percent change from baseline in IgE. All endpoints were evaluated at Week 24. Since all association tests evaluated the hypothesis of an additive allelic effect (i.e., that the mean response among heterozygotes is intermediate to those of the two homozygous classes), Table 6 shows the effect of one additional copy of the minor allele (i.e., less common allele in this sample) on each of these 3 endpoints. For example, under the additive model, carrying one additional copy of the minor allele at rs8832whether carrying 1 copy instead of 0, of 2 copies instead of 1is associated with a mean increase from baseline in FEV1 of 7.6%. Thus, carrying 2 copies instead of 0 is associated with a mean increase of 15.2%.
[0228] The corresponding results for the asthma exacerbation endpoint are also provided for comparison. In this case the effect size represents the odds ratio associated with one additional copy of the minor allele. Hence, carrying one additional copy of the minor allele at rs8832 is associated with 3.8-fold increase in the odds of experiencing an exacerbation. Since odds ratios are multiplicative, carrying 2 copies instead of 0 is associated with a 3.8.sup.2, or 14.6-fold increase in odds of experiencing an exacerbation.
[0229] No SNPs attained or approached statistical significance for the ACQ7 or IgE endpoints, even without any adjustment for multiple testing. For the FEV1 endpoint, 4 SNPs attained significance, including a cluster of 3 SNPs with p<0.002 (rs8832, rs1029489, and rs4787956). However, the effect of these 3 SNPs on response to ANTIBODY 01951/G12 was in the opposite direction of that observed for asthma exacerbations: specifically, for each of the 3 SNPs the minor (less common in the sample) allele was associated with higher risk of exacerbation but also with a mean increase from baseline in FEV1. Another SNP, rs1110470, also attained borderline significance, but also in the opposite direction of that observed for exacerbations, and no other SNPs in its neighborhood attained or approached significance.
TABLE-US-00016 TABLE 6 Results of tests of association between SNPs and asthma endpoints at Week 24 ACQ 7 FEV1 Serum IgE (Change from BL) (% Change from BL) (% Change from BL) Asthma Exacerbations Effect Size.sup.1 Effect Size.sup.2 Effect Size.sup.2 Effect Size.sup.3 SNP (mean (mean (mean (odds ratio (minor allele) with 95% CI) P-value with 95% CI) P-value with 95% CI) P-value with 95% CI) P-value rs1110470 (A) 0.039 0.23 0.73 5.4 5.3 0.047 +4.7 13.9 0.51 0.15 0.0058 (0.036, 0.64) rs3024530 (G) +0.142 0.24 0.24 +2.7 5.8 0.37 +0.6 14.7 0.94 4.2 0.015 (1.2, 14.6) rs1805010 (G) +0.172 0.24 0.16 +2.7 5. 0.38 0.6 14.9 0.94 5.1 0.010 (1.3, 19.9) rs2239347 (C) +0.023 0.22 0.84 +3.2 5.4 0.25 0.2 13.7 0.98 2.
0.066 (0.9, 8.7) rs1805011 (C) 0.106 0.35 0.55 +0.1 8.5 0.98 4.6 21.4 0.67 NC.sup.4 0.091 rs1801275 (G) 0.042 0.25 0.74 +2.9 6.3 0.36 3.7 15.6 0.64 0.30 0.10 (0.0
, 1.4) rs8832 (A) 0.049 0.20 0.
3 +7.6 4.7 0.0014 7.2 12.5 0.26 3.8 0.013 (1.2, 11.9) rs1029489 (A) 0.037 0.20 0.72 +7.0 4.6 0.0033
.3 12.4 0.32 4.2 0.0054 (1.4, 12.9) rs4787956 (G) 0.081 0.22 0.47 +7.2 5.1 0.0064 5.4 13.7 0.44 3.9 0.0080 (1.3, 11.7) .sup.1Mean absolute change in ACQ7 from baseline to Week 24 associated with one additional copy of the minor allele .sup.2Mean percent change in FEV1 or IgE from baseline to Week 24 associated with one additional copy of the minor allele .sup.3Odds ratio for risk of experiencing an asthma exacerbation between baseline and Week 24 associated with one additional copy of the minor allele .sup.4Not calculable because all patients with an exacerbation had the same genotype (AA)
indicates data missing or illegible when filed
[0230] Permutation test to evaluate overall significance of exacerbation associations A permutation test was performed to evaluate how likely it would be to obtain association results similar to the ANTIBODY 01951/G12 exacerbation results if there were actually no association between the SNPs and exacerbation riski.e., as an artifact of random chance. Of particular interest was the finding that for each of the top 7 SNPs listed in Table 5, the ANTIBODY 01951/G12 analysis yielded one homozygous class in which there were no exacerbations; therefore, the permutation test was focused on how often this would be expected to occur by random chance. Among 1000 permuted datasets generated, only 2 yielded a result in which each of the 7 SNPs had one homozygous class with no exacerbations. Hence the probability of observing this result if there were no true associations was estimated to be 0.002.
Linkage Disequilibrium Analysis of the SNPs
[0231] Alleles that are located near each other on a chromosome tend to be inherited together. When these alleles also have similar population frequencies, they are likely to be correlated with each other, such that knowing a subject's genotype at a given SNP can enable one to predict the same subject's genotype at a nearby SNP with relatively high accuracy. This concept is referred to as linkage disequilibrium (LD). The relevance to genetic association studies is that multiple SNPs in a small region may show evidence of association with a phenotype; however, because these SNPs may be in LD with each other, any given SNP may not provide a substantial amount of independent evidence of association with the phenotype beyond that already obtained from other nearby SNPs.
[0232] LD is known to occur in a block structure throughout the genome. Each block, or cluster, contains a group of SNPs such that the correlations between pairs of SNPs within the same block are relatively high whereas the correlations between pairs of SNPs in different blocks are relatively low. An analysis of LD between the top 7 SNPs listed in Table 5 and ANTIBODY 01951/G12 exacerbation risk revealed the presence of 2 LD blocks, as illustrated in
[0233] As can be seen from the figure, the first 4 SNPs form one block, within which correlations between pairs of SNPs range from 56 to 95. SNPs rs3024530 and rs1805010 are almost perfectly correlated. The last 3 SNPs form the second block, with pairwise correlations ranging from 59 to 80. In contrast, no SNP from the first block shows high correlation with any SNP from the second block, the highest pairwise correlation being 32.
Cross-Validation Analysis to Assess Optimal Number of SNPs for Prediction
[0234] A cross-validation analysis was conducted to compare strategies for utilizing the 6 of the top 7 IL4-R SNPs listed in Table 5 (rs3024530 was excluded because it was nearly perfectly correlated with rs1805010) to predict a patient's risk of asthma exacerbation after treatment with ANTIBODY 01951/G12. Because the LD analysis identified 2 largely independent blocks of SNPs that each show evidence of association with exacerbation risk, it is reasonable to expect that a predictive model with representation from both blocks would likely have greater ability to identify patients at low risk of exacerbation than one with representation from only one block. However, this raised the question of whether it would be sufficient to select only one SNP from each block or whether it would be beneficial to include additional SNPs. The cross-validation analysis showed that the expected ability of a predictive model to identify patients at low risk of asthma exacerbation would not improve substantially if additional SNPs were included beyond one from each block.
Additional Information
[0235] Genotype frequency distributions for the 7 SNPs are listed by country and ethnic population in Tables 7 and 8.
TABLE-US-00017 TABLE 7 Genotype frequency distribution of IL4-R SNPs by country Genotype QAX576A2207 ARG BEL CZE DEU POL RUS USA SNP N= 194 25 12 30 57 25 35 12 rs1805010 AA 0.24 0.20 0.00 0.25 0.37 0.24 0.12 0.36 AG 0.55 0.64 0.67 0.46 0.53 0.60 0.53 0.45 GG 0.21 0.16 0.33 0.29 0.11 0.16 0.35 0.18 rs8832 GG 0.30 0.36 0.17 0.29 0.30 0.28 0.31 0.33 AG 0.48 0.48 0.50 0.50 0.47 0.60 0.46 0.25 AA 0.22 0.16 0.33 0.21 0.23 0.12 0.23 0.42 rs4787956 AA 0.37 0.40 0.08 0.32 0.39 0.44 0.37 0.42 AG 0.51 0.56 0.67 0.50 0.47 0.52 0.51 0.42 GG 0.12 0.04 0.25 0.18 0.14 0.04 0.11 0.17 rs3024530 AA 0.25 0.20 0.00 0.25 0.37 0.24 0.14 0.33 AG 0.55 0.64 0.67 0.46 0.51 0.60 0.54 0.50 GG 0.21 0.16 0.33 0.29 0.12 0.16 0.31 0.17 rs1028489 GG 0.35 0.36 0.18 0.36 0.37 0.40 0.34 0.33 AG 0.45 0.48 0.46 0.43 0.46 0.48 0.43 0.33 AA 0.20 0.16 0.36 0.21 0.18 0.12 0.23 0.33 rs1110470 GG 0.31 0.36 0.42 0.39 0.25 0.24 0.37 0.25 AG 0.50 0.48 0.50 0.46 0.51 0.56 0.49 0.50 AA 0.19 0.16 0.08 0.14 0.25 0.20 0.14 0.25 rs2239347 AA 0.25 0.24 0.08 0.25 0.32 0.24 0.14 0.42 AC 0.51 0.48 0.42 0.46 0.56 0.48 0.54 0.42 CC 0.25 0.28 0.50 0.29 0.12 0.28 0.31 0.17
TABLE-US-00018 TABLE 8 Genotype frequency distribution of IL4-R SNPs by ethnic population Genotype QAX576A2207 ASW CHB CHD GIH LWK MEX MKK TSI CEU HCB JPT YRI SNP N= 194 49 41 84 88 90 49 142 88 112 42 86 112 rs1805010 AA 0.24 0.24 0.27 0.23 0.39 0.24 0.24 0.20 0.32 0.24 0.50 0.19 0.30 AG 0.55 0.51 0.46 0.54 0.45 0.46 0.43 0.43 0.55 0.54 0.33 0.34 0.49 GG 0.21 0.24 0.27 0.24 0.16 0.30 0.33 0.37 0.14 0.22 0.17 0.48 0.21 rs8832 GG 0.30 0.00 0.20 0.25 0.35 0.00 0.27 0.03 0.32 0.26 0.24 0.19 0.02 AG 0.48 0.33 0.44 0.52 0.49 0.24 0.53 0.27 0.52 0.47 0.43 0.39 0.25 AA 0.22 0.67 0.37 0.24 0.16 0.76 0.20 0.69 0.16 0.28 0.33 0.42 0.73 rs4787956 AA 0.37 0.43 0.17 0.24 0.40 0.37 0.30 0.38 0.38 0.39 0.26 0.16 0.41 AG 0.51 0.49 0.44 0.50 0.45 0.56 0.52 0.52 0.50 0.43 0.44 0.41 0.43 GG 0.12 0.06 0.39 0.26 0.15 0.08 0.18 0.10 0.13 0.18 0.30 0.43 0.16 rs3024530 AA 0.25 0.22 0.27 0.26 0.39 0.26 0.24 0.17 0.30 0.23 0.49 0.19 0.27 AG 0.55 0.53 0.49 0.55 0.42 0.42 0.44 0.54 0.57 0.54 0.30 0.31 0.50 GG 0.21 0.24 0.24 0.19 0.19 0.32 0.32 0.29 0.14 0.23 0.21 0.50 0.24 N= 60 45 45 60 rs1029489 GG 0.35 0.48 0.22 0.18 0.03 AG 0.45 0.38 0.44 0.31 0.22 AA 0.20 0.13 0.33 0.51 0.75 rs1110470 GG 0.31 0.27 0.41 0.50 0.27 AG 0.50 0.41 0.27 0.36 0.49 AA 0.19 0.32 0.32 0.04 0.24 rs2239347 AA 0.25 0.28 0.40 0.20 0.32 AC 0.51 0.50 0.42 0.49 0.45 CC 0.25 0.22 0.18 0.31 0.23 Population Description ASW African ancestry in Southwest USA CHB Han Chinese in Beijing, China (current) CHD Chinese in Metropolitan Denver, Colorado GIH Indians in Houston, Texas LWK Luhya in Webuye, Kenya MEX Mexican ancestry in Los Angeles, California MKK Maasai in Kinyawa, Kenya TSI Toscan in Italy CEU Utah residents with Northern and Western European ancestry HCB Han Chinese in Bejing, China (
) JPT Japanese in Tokyo, Japan YRI Yoruba in Ibadan, Nigeria Source: dbSNP database, National Center for Biotechnology Information
indicates data missing or illegible when filed
[0236] The 7 top SNPs listed in Table 5 were found in this study to associate with exacerbation risk among patients treated with ANTIBODY 01951/G12. Six of the 7 SNPs yielded significant p-values ranging from 0.005 to 0.015, while the remaining SNP approached significance. The same p-values were obtained when the analysis was restricted to Caucasian patients to mitigate the risk of confounding. Moreover, the particular pattern of association with response to ANTIBODY 01951/G12 with most SNPs exhibited an additive relationship with exacerbation risk; i.e., the risk within heterozygotes was observed to be intermediate to that within the 2 homozygous classes. Finally, it was observed that among ANTIBODY 01951/G12-treated patients each of the 7 SNPs had a particular homozygous class in which there were no exacerbations. A permutation test showed that the probability of observing this result in the absence of any true associations is 0.002. Taken together, along with the importance of the IL4-R gene to the mechanism of ANTIBODY 01951/G12, these results suggest a strong likelihood that the risk of asthma exacerbations in patients treated with ANTIBODY 01951/G12 is influenced by SNPs in the IL4-R gene.
[0237] In addition, the two other SNPs in the IL4-R gene (listed as bottom two SNPs in Table 5) were evaluated for possible association with exacerbation risk in ANTIBODY 01951/G12-treated patients because of their reported association with asthma disease phenotypes and because they code for amino acid changes. Although, both were less significant than the other 7 SNPs (p=0.091 and 0.10).
[0238] No evidence was found for association between SNPs in the IL4-R gene and exacerbation risk among patients treated with placebo in the ANTIBODY 01951/G12 study. Taken together with knowledge of the ANTIBODY 01951/G12 mechanism, this suggests that the influence of these SNPs on exacerbation risk is specific to the drug mechanism and is not reflective of a more general disease severity association. Moreover, no evidence was found for association between these SNPs and change from baseline in ACQ7 score or IgE level, and only a few SNPs were significantly associated with change in FEV1, with these associations pointing in the opposite direction of that seen for exacerbation risk. This suggests that the genetic mechanism influencing patient's susceptibility to exacerbations is different from that for other asthma endpoints.
[0239] The strong evidence for this pharmacogenetic association among ANTIBODY 01951/G12-treated patients suggests the use of particular genotypes or combination of genotypes at these SNPs to predict a patient's risk of asthma exacerbation after treatment with ANTIBODY 01951/G12.
[0240] As shown in Table 5, rs1805010 causes an amino acid substitution, while rs8832 is in the 3 untranslated region (UTR), a region known to influence gene transcription levels. Since rs1805010 lies in the first LD block while rs8832 lies in the second, these 2 SNPs are useful in developing a predictive model for exacerbation risk. The cross-tabulated genotype frequencies for these 2 SNPs in the CQAX576A2207 study are shown in Table 9.
TABLE-US-00019 TABLE 9 Cross-tabulated genotype frequencies for rs1805010 and rs8832 in the rs8832 GG (lower AA (higher exacerbation exacerbation risk) AG risk) rs1805010 AA (lower 33 (17.2%) 9 (4.7%) 5 (2.6%) exacerbation risk) AG 20 (10.4%) 71 (37.0%) 14 (7.3%) GG (higher 5 (2.6%) 11 (5.7%) 24 (12.5%) exacerbation risk) Genotype frequencies were calculated by combining the ANTIBODY 01951/G12 and placebo arms.
Example 4
[0241] Methods to evaluate reduction in asthma exacerbations will be known to the skilled practitioner and include use of ACQ-5 and/or AQLQ-S: