STABLE IgG4 ANTIBODIES
20170029521 ยท 2017-02-02
Assignee
Inventors
- Jan Van De Winkel (Zeist, NL)
- Tom Vink (Alphen aan den Rijn, NL)
- Janine Schuurman (Diemen, NL)
- Paul Parren (Odijk, NL)
- Rob AALBERSE (Duivendrecht, NL)
- Marijn Van Der Neut Kolfschoten (Amsterdam, NL)
Cpc classification
A61P1/04
HUMAN NECESSITIES
A61K51/10
HUMAN NECESSITIES
A61P31/00
HUMAN NECESSITIES
A61P17/02
HUMAN NECESSITIES
C07K16/00
CHEMISTRY; METALLURGY
A61P43/00
HUMAN NECESSITIES
A61P19/06
HUMAN NECESSITIES
A61P13/02
HUMAN NECESSITIES
A61P1/18
HUMAN NECESSITIES
A61K47/6845
HUMAN NECESSITIES
C07K16/28
CHEMISTRY; METALLURGY
A61P37/06
HUMAN NECESSITIES
A61K51/1006
HUMAN NECESSITIES
A61P15/00
HUMAN NECESSITIES
C07K16/2863
CHEMISTRY; METALLURGY
A61P29/00
HUMAN NECESSITIES
A61K47/6835
HUMAN NECESSITIES
A61P1/02
HUMAN NECESSITIES
A61P19/08
HUMAN NECESSITIES
A61P7/00
HUMAN NECESSITIES
A61P9/10
HUMAN NECESSITIES
A61K47/6849
HUMAN NECESSITIES
A61K51/1027
HUMAN NECESSITIES
A61P1/16
HUMAN NECESSITIES
A61K51/103
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
C07K2317/94
CHEMISTRY; METALLURGY
C07K2317/24
CHEMISTRY; METALLURGY
A61P21/00
HUMAN NECESSITIES
A61P25/28
HUMAN NECESSITIES
A61K47/6803
HUMAN NECESSITIES
A61K51/1021
HUMAN NECESSITIES
International classification
C07K16/28
CHEMISTRY; METALLURGY
Abstract
The present invention relates to stabilized IgG4 antibodies, to methods of producing such antibodies and to uses of such antibodies as a medicament. In a main aspect, the invention relates to a stabilized IgG4 antibody, comprising a heavy chain and a light chain, wherein said heavy chain comprises a human IgG4 constant region having a substitution of the Arg residue at position (409), the Phe residue at position (405) or the Lys residue at position (370).
Claims
1.-75. (canceled)
76. A stabilized IgG4 antibody, comprising a heavy chain and a light chain, wherein said heavy chain comprises a human IgG4 constant region having a substitution of the Lys residue at EU index position 370, alone or in combination with up to two additional amino acid substitutions, and wherein said antibody comprises a CXPC or CPXC sequence in the hinge region, wherein X can be any amino acid.
77. The stabilized IgG4 antibody of claim 76, wherein the antibody comprises a Thr residue at EU index position 370.
78. The stabilized IgG4 antibody of claim 76, wherein the additional amino acid substitutions comprise a substitution of the Arg residue at EU index position 409 and/or a substitution of the Phe residue at EU index position 405.
79. The stabilized IgG4 antibody of claim 78, wherein the antibody comprises a Lys, Ala, Thr, Met, or Leu residue at EU index position 409.
80. The stabilized IgG4 antibody of claim 78, wherein the antibody comprises a Lys, Thr, Met, or Leu residue at EU index position 409.
81. The stabilized IgG4 antibody of claim 78, wherein the antibody comprises a Lys, Met, or Leu residue at EU index position 409.
82. The stabilized IgG4 antibody of claim 78, wherein the antibody comprises a residue which has a lower mass than Phe at EU index position 405.
83. The stabilized IgG4 antibody of claim 78, wherein the antibody comprises an Ala or Leu residue at EU index position 405.
84. The stabilized IgG4 antibody of claim 76, wherein the antibody has reduced ability to undergo Fab-arm exchange.
85. The stabilized IgG4 antibody of claim 76, wherein the antibody has reduced effector functions.
86. The stabilized IgG4 antibody of claim 76, wherein the additional amino acid substitutions comprise a substitution of the Leu residue at EU index position 235.
87. The stabilized IgG4 antibody of claim 76, wherein the additional amino acid substitutions comprise one or more of: an Ala at EU index position 234, an Ala at EU index position 236, an Ala at EU index position 237, an Ala at EU index position 297, an Ala or Val at EU index position 318, an Ala at EU index position 320, and an Ala or Gin at EU index position 322.
88. The stabilized IgG4 antibody of claim 76, wherein the antibody comprises a CXPC or CPXC sequence in the hinge region, wherein X can be any amino acid except for proline.
89. The stabilized IgG4 antibody of claim 76, wherein the antibody does not comprise a Cys-Pro-Pro-Cys sequence (SEQ ID NO: 50) in the hinge region.
90. The stabilized IgG4 antibody of claim 76, wherein the antibody comprises a Cys-Pro-Pro-Cys sequence (SEQ ID NO: 50) in the hinge region.
91. The stabilized IgG4 antibody of claim 76, wherein the antibody comprises a Cys-Pro-Ser-Cys sequence (amino acids 106-109 of SEQ ID NO: 39) in the hinge region.
92. The stabilized IgG4 antibody of claim 76, wherein the antibody is selected from the group consisting of: a human antibody, a humanized antibody, and a chimeric antibody.
93. The stabilized IgG4 antibody of claim 76, wherein the antibody comprises a human kappa light chain.
94. The stabilized IgG4 antibody of claim 76, wherein the antibody comprises a human lambda light chain.
95. The stabilized IgG4 antibody of claim 76, wherein the antibody is a full-length antibody.
96. The stabilized IgG4 antibody of claim 76, wherein the antibody is linked to a cytotoxic agent; a radioisotope; a prodrug; or a drug.
97. The stabilized IgG4 antibody of claim 76, wherein the antibody binds erythropoietin, beta amyloid, thrombopoietin, interferon-alpha (2a and 2b), interferon-beta (1b), interferon gamma, TNFR I (CD120a), TNFR II (CD120b), IL-1R type 1 (CD121a), IL-1R type 2 (CD121b), IL-2, IL2R (CD25), IL-2R-beta (CD123), IL-3, IL-4, IL-3R (CD123), IL-4R (CD124), IL-5R (CD125), IL-6R-alpha (CD126), IL-6R-beta (CD130), IL-8, IL-10, IL-11, IL-15, IL-15BP, IL-15R, IL-20, IL-21, TCR variable chain, RANK, RANK-L, CTLA4, CXCR4R, CCR5R, TGF-beta1, TGF-beta2, TGF-beta3, G-CSF, GM-CSF, MIF-R (CD74), M-CSF-R (CD115), GM-CSFR (CD116), soluble FcRI, sFcRII, sFcRIII, FcRn, Factor VII, Factor VIII, Factor IX, VEGF, VEGFxxxb, alpha-4 integrin, Cd11a, CD18, CD20, CD38, CD25, CD74, FcalphaRI, FcepsilonRI, acetyl choline receptor, fas, fasL, TRAIL, hepatitis virus, hepatitis C virus, envelope E2 of hepatitis C virus, tissue factor, a complex of tissue factor and Factor VII, EGFr, CD4, CD28, VLA-1, VLA-2, VLA-3, VLA-4, LFA-1, MAC-1, I-selectin, PSGL-1, ICAM-I, P-selectin, periostin, CD33 (Siglec 3), Siglec 8, TNF, CCL1, CCL2, CCL3, CCL4, CCL5, CCL11, CCL13, CCL17, CCL18, CCL20, CCL22, CCL26, CCL27, CX3CL1, LIGHT, EGF, TGFalpha, HGF, PDGF, NGF, complement, C1q, C4, C2, C3, CS, C6, C7, C8, C9, MBL, factor B, a Matrix Metallo Protease, any of MMP1 to MMP28, CD32b, CD200, CD200R, Killer Immunoglobulin-Like Receptors (KIRs), NKG2D, leukocyte-associated immunoglobulin-like receptors (LAIRs), ly49, PD-L2, CD26, BST-2, ML-IAP (melanoma inhibitor of apoptosis protein), cathepsin D, CD40, CD40R, CD86, a B cell receptor, CD79, PD-1, or a T cell receptor.
98. The stabilized IgG4 antibody of claim 76, wherein the additional amino acid substitutions comprise a substitution of the Leu residue at EU index position 235 by a Glu.
99. A pharmaceutical composition comprising the stabilized IgG4 antibody of claim 76.
100. A method of producing the stabilized IgG4 antibody of claim 76, comprising expressing a nucleic acid construct encoding the antibody in a host cell.
Description
BRIEF DESCRIPTION OF THE FIGURES
[0017]
[0018]
[0019]
[0020]
[0021] Plasma (10 l) drawn at t=24 h from a mouse dosed with an IgG4 mix was fractionated on a Superdex200 column. The mouse was dosed with a mix containing 300 g of Bet v 1 binding IgG4 and 300 g of Fel d 1 binding IgG4. In the fractions, the concentration of Fel d 1 specific IgG (.square-solid.) was measured in the antigen binding test and the concentration of bispecific IgG Bet v 1-Fel d 1 () was determined in the Bet v 1-Fel d 1 cross-linking assay. Calibration of this column using IVIg has revealed that monomeric, dimeric and aggregated IgG elute at 12.9, 11.0 and 8.4 ml, respectively (data not shown).
[0022]
[0023] Exchange of IgG4 and IgG1 was evaluated by incubating chimeric IgG mixtures in whole blood, blood cells, plasma and serum for 24 h at 37 C., after which bispecific activity in the heterologous cross-linking assay (Fel d 1-Bet v 1) was measured. Blood was obtained from two donors: donor A (black bars) and donor B (grey bars). Bispecific activities were determined in mixtures supplemented with chimeric IgG4 (
[0024]
[0025] Fab arm exchange of IgG4 (black bars) and IgG1 (grey bars) was evaluated by incubating chimeric IgG mixtures with mononuclear cells (MNC), thrombocytes (Thr) and erythrocytes (Ery) for 48 h at 37 C., after which bispecific activity in the heterologous cross-linking assay (Fel d 1-Bet v 1) was measured. As a control, the antibody mixtures were also incubated in serum free culture medium (SFC). Bispecificity is expressed as percentage .sup.125I-Bet v 1 bound relative to amount added.
[0026]
[0027] Fab arm exchange of IgG4 half molecules was evaluated by incubating a chimeric IgG4 mixture with HEK cells, murine B cells (J558) or hybridoma cells at 37 C. Bispecific activity in the heterologous cross-linking assay (Fel d 1-Bet v 1) was measured in samples of 1 l drawn at t=0 h (gray bars) and at t=24 h (black bars). Bispecificity is expressed as percentage .sup.125I-Bet v 1 bound relative to amount added.
[0028]
[0029] Incubation of IgG4-Betv1/IgG4-Feld1 mixtures with freshly purified erythrocytes (ery, closed symbols) resulted in the generation of bispecific antibodies, whereas no bispecificity was observed for the mixture of the IgG1 isotypes. As control, antibody mixtures were incubated in PBS without erythrocytes (open symbols). The arrow indicates the maximal expected percentage of bispecific IgG (50%). Error bars represent range of duplicate measurements.
[0030]
[0031] Fab arm exchange in PBS of IgG1 (white bars), IgG4 (grey bars) and IgG4 In the presence of excess irrelevant IgG4 (black bars) was evaluated by measuring bispecific activity, bivalency and antigen binding.
[0032]
[0033] Fab arm exchange of IgG4 was evaluated by incubating a chimeric IgG4 mixture in lysate from erythrocytes at 37 C. IgG4 was incubated with increasing dilutions of lysate. Bispecific activity in the heterologous cross-linking assay (Bet v 1-Fel d 1) was measured in samples drawn at indicated time points. Bispecificity is expressed as percentage .sup.125I-Bet v 1 bound relative to amount added.
[0034]
[0035] IgG4 was incubated with freshly prepared erythrocyte lysate at 37 C. for 24 h and subsequently fractionated on a Superdex200 column, which was run at 0.5 ml/min on an KTA HPLC unit (Amersham Biosciences, Uppsala, Sweden). In the fractions the concentration of Bet v 1 specific IgG (.square-solid.) was measured in the antigen binding test and the concentration of bispecific IgG Fel d 1-Bet v 1 () was determined in the Bet v 1-Fel d 1 cross-linking assay. Calibration of this column has revealed that monomeric, dimeric and aggregated IgG elute at 12.1, 10.3 and 8.3 ml, respectively (data not shown).
[0036]
[0037] GSH mediated exchange of IgG4 Fab arms was evaluated by Incubating IgG4 In the presence of increasing concentrations of GSH in PBS/Azide. At indicated time points samples were drawn in which antigen binding and bispecific activity was measured. The exchange of IgG4 Fab arms was calculated from the measured concentration of bispecific IgG (as determined in the heterologous cross-linking assay) and the maximal expected concentration of bispecific IgG4 If the exchange of IgG4 Fab arms is random and complete. The exchange was expressed as percentage of the maximal exchange, set at 100%.
[0038]
[0039] IgG4 was incubated with GSH (0.5 mM) and subsequently fractionated on a Superdex200 column, which was run at 0.5 ml/min on an KTA HPLC unit (Amersham Biosciences, Uppsala, Sweden). In the fractions the concentration of Bet v 1 specific IgG () was measured in the antigen binding test and the concentration of bispecific IgG Fel d 1-Bet v 1 () was determined in the Bet v 1-Fel d 1 cross-linking assay. Calibration of this column has revealed that monomeric, dimeric and aggregated IgG elute at 12.1, 10.3 and 8.3 ml, respectively (data not shown).
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050] The effect of GSH concentration on the Fab arm exchange from different IgG1 mutants was tested using 0, 0.1, 1 and 10 mM GSH. Fab arm exchange was tested using the following mixtures: [0051] IgG4 anti-feld1 wt with IgG4 anti-betv1 wt (Indicated as IgG4 wt in the figure) [0052] IgG1 anti-feld1 wt with IgG4 anti-betv1 wt (Indicated as IgG1 wt) [0053] IgG1 anti-feld1 CPSC with IgG1 anti-betv1 CPSC (Indicated as IgG1-CPSC) [0054] IgG1 anti-feld1 CH3(IgG4) with IgG1 anti-betv1 CH3(IgG4) (Indicated as IgG1-CH3 (IgG4)) [0055] IgG1 anti-feld1 CPSC/CH3(IgG4) with anti-betv1 IgG1 CPSC/CH3(IgG4) (indicated as IgG1-CPSC-CH3 (IgG4))
[0056]
[0057]
[0058]
[0059]
[0060]
[0061]
DETAILED DESCRIPTION OF THE INVENTION
Definitions
[0062] The term immunoglobulin refers to a class of structurally related glycoproteins consisting of two pairs of polypeptide chains, one pair of light (L) low molecular weight chains and one pair of heavy (H) chains, all four inter-connected by disulfide bonds. The structure of immunoglobulins has been well characterized. See for instance Fundamental Immunology Ch. 7 (Paul, W., ed., 2nd ed. Raven Press, N.Y. (1989)). Briefly, each heavy chain typically is comprised of a heavy chain variable region (abbreviated herein as V.sub.H or VH) and a heavy chain constant region. The heavy chain constant region typically is comprised of three domains, C.sub.H1, C.sub.H2, and C.sub.H.sup.3. Each light chain typically is comprised of a light chain variable region (abbreviated herein as V.sub.L or VL) and a light chain constant region. The light chain constant region typically is comprised of one domain, C.sub.L. The V.sub.H and V.sub.L regions may be further subdivided into regions of hypervariability (or hypervariable regions which may be hypervariable in sequence and/or form of structurally defined loops), also termed complementarity determining regions (CDRs), interspersed with regions that are more conserved, termed framework regions (FRs). Each V.sub.H and V.sub.L is typically composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4 (see also Chothia and Lesk J. Mol. Biol. 2.6, 901-917 (1987)).
[0063] Often, the numbering of amino acid residues is performed by the method described in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991). Using this numbering system, the actual linear amino add sequence of a peptide may contain fewer or additional amino acids corresponding to a shortening of, or insertion into, a FR or CDR of the variable domain. For example, a heavy chain variable domain may include a single amino acid insert (residue 52a according to Kabat) after residue 52 of V.sub.H CDR2 and inserted residues (for instance residues 82a, 82b, and 82c, etc. according to Kabat) after heavy chain FR residue 82. The Kabat numbering of residues may be determined for a given antibody by alignment at regions of homology of the sequence of the antibody with a standard Kabat numbered sequence.
[0064] Alternatively, the numbering of amino acid residues is performed by the EU-index also described in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991). This numbering is often used in literature dealing with the Fc part of human immunoglobulin G molecules and is also used throughout this application.
[0065]
[0066] The term antibody (Ab) in the context of the present invention refers to an immunoglobulin molecule, a fragment of an immunoglobulin molecule, or a derivative of either thereof, which has the ability to specifically bind to an antigen under typical physiological conditions with a half life of significant periods of time, such as at least about 30 minutes, at least about 45 minutes, at least about one hour, at least about two hours, at least about four hours, at least about 8 hours, at least about 12 hours, about 24 hours or more, about 48 hours or more, about 3, 4, 5, 6, 7 or more days, etc., or any other relevant functionally-defined period (such as a time sufficient to induce, promote, enhance, and/or modulate a physiological response associated with antibody binding to the antigen and/or time sufficient for the antibody to recruit an Fc-mediated effector activity). The variable regions of the heavy and light chains of the immunoglobulin molecule contain a binding domain that interacts with an antigen. The constant regions of the antibodies (Abs) may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (such as effector cells) and components of the complement system such as C1q, the first component in the classical pathway of complement activation. As indicated above, the term antibody herein, unless otherwise stated or dearly contradicted by context, includes fragments of an antibody that comprise a mutated or wildtype core hinge region and retain the ability to specifically bind to the antigen.
[0067] It has been shown that the antigen-binding function of an antibody may be performed by fragments of a full-length antibody. Although such fragments are generally included within the meaning of antibody, they collectively and each independently are unique features of the present invention, exhibiting different biological properties and utility. It also should be understood that the term antibody, unless specified otherwise, also includes polyclonal antibodies, monoclonal antibodies (mAbs), antibody-like polypeptides, such as chimeric antibodies and humanized antibodies, and antibody fragments retaining the ability to specifically bind to the antigen (antigen-binding fragments) provided by any known technique, such as enzymatic cleavage, peptide synthesis, and recombinant techniques.
[0068] The term human antibody, as used herein, is intended to include antibodies having variable and constant regions derived from human germline immunoglobulin sequences. The human antibodies of the invention may include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo). However, the term human antibody, as used herein, is not intended to include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences.
[0069] The term chimeric antibody refers to an antibody that contains one or more regions from one antibody and one or more regions from one or more other antibodies. The term chimeric antibody includes divalent and polyvalent antibodies. Chimeric antibodies are produced by recombinant processes well known in the art (see for instance Cabilly et al., PNAS USA 81, 3273-3277 (1984), Morrison et al., PNAS USA 81. 6851-6855 (1984), Boullanne et al., Nature 312, 643-646 (1984), EP125023, Neuberger et al., Nature 31, 268-270 (1985), EP171496, EP173494, WO86/01533, EP184187, Sahagan et al., J. Immunol. 137, 1066-1074 (1986), WO87/02671, Liu et al., PNAS USA 84, 3439-3443 (1987), Sun et al., PNAS USA 84, 214-218 (1987), Better et al., Science 240, 1041-1043 (1988) and Harlow et al., Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., (1988)).
[0070] A humanized antibody is an antibody that is derived from a non-human species, in which certain amino acids in the framework and constant domains of the heavy and light chains have been mutated so as to avoid or abrogate an immune response in humans. Humanized forms of non-human (for instance murine) antibodies are chimeric antibodies which contain minimal sequence derived from non-human immunoglobulin. For the most part, humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a hypervariable region of the recipient are replaced by residues from a hypervariable region of a non-human species (donor antibody) such as mouse, rat, rabbit or nonhuman primate having the desired specificity, affinity, and capacity. In some instances, Fv framework region (FR) residues of the human Immunoglobulin are replaced by corresponding non-human residues. Furthermore, humanized antibodies may comprise residues which are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance. In general, a humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin and all or substantially all of the FR regions are those of a human immunoglobulin sequence. A humanized antibody typically also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin. For further details, see Jones et al., Nature 321, 522-525 (1986), Riechmann et al., Nature, 323-329 (1988) and Presta, Curr. Op. Struct. Biol. 2, 593-596 (1992).
[0071] An isolated antibody as used herein, is intended to refer to an antibody which is substantially free of other antibodies having different antigenic specificities. An isolated antibody that specifically binds to an epitope, isoform or variant of a particular human target antigen may, however, have cross-reactivity to other related antigens, for instance from other species (such as species homologs). Moreover, an isolated antibody may be substantially free of other cellular material and/or chemicals.
[0072] The terms monoclonal antibody or monoclonal antibody composition as used herein refer to a preparation of antibody molecules of single molecular composition. A monoclonal antibody composition displays a single binding specificity and affinity for a particular epitope. Accordingly, the term human monoclonal antibody refers to antibodies displaying a single binding specificity which have variable and constant regions derived from human germline immunoglobulin sequences. The human monoclonal antibodies may be generated by a hybridoma which includes a B cell obtained from a transgenic or transchromosomal nonhuman animal, such as a transgenic mouse, having a genome comprising a human heavy chain transgene and a light chain transgene, fused to an immortalized cell.
[0073] As used herein, the term binding In the context of the binding of an antibody to a predetermined antigen typically is a binding with an affinity corresponding to a K.sub.D of about 10.sup.7 M or less, such as about 10.sup.11 M or less, such as about 10.sup.9 M or less, about 10.sup.10 M or less, or about 10.sup.11 M or even less when determined by for instance surface plasmon resonance (SPR) technology in a BIAcore 3000 instrument using the antigen as the ligand and the antibody as the analyte, and binds to the predetermined antigen with an affinity corresponding to a K.sub.D that is at least ten-fold lower, such as at least 100 fold lower, for instance at least 1000 fold lower, such as at least 10,000 fold lower, for instance at least 100,000 fold lower than its affinity for binding to a non-specific antigen (e.g., BSA, casein) other than the predetermined antigen or a closely-related antigen. The amount with which the affinity is lower is dependent on the K.sub.D of the antibody, so that when the K.sub.D of the antibody is very low (that is, the antibody is highly specific), then the amount with which the affinity for the antigen is lower than the affinity for a non-specific antigen may be at least 10,000 fold.
[0074] The term k.sub.d (sec.sup.1), as used herein, refers to the dissociation rate constant of a particular antibody-antigen interaction. Said value is also referred to as the k.sub.off value.
[0075] The term k.sub.n (M.sup.1sec.sup.1), as used herein, refers to the association rate constant of a particular antibody-antigen interaction.
[0076] The term K.sub.D (M), as used herein, refers to the dissociation equilibrium constant of a particular antibody-antigen interaction.
[0077] The term K.sub.A (M.sup.1), as used herein, refers to the association equilibrium constant of a particular antibody-antigen interaction and is obtained by dividing the k.sub.a by the k.sub.d.
[0078] As used herein, isotype refers to the immunoglobulin (sub)class, for instance IgG1, IgG2, IgG3, IgG4, IgD, IgA, IgE, or IgM, that is encoded by heavy chain constant region genes.
[0079] As used herein, a human antibody is derived from a particular germline sequence if the antibody is obtained from a system using human immunoglobulin sequences, for instance by immunizing a transgenic mouse carrying human immunoglobulin genes or by screening a human immunoglobulin gene library, and wherein the selected human antibody is at least 90%, such as at least 95%, for instance at least 96%, such as at least 97%, for instance at least 98%, or such as at least 99% identical in amino acid sequence to the amino acid sequence encoded by the germline immunoglobulin gene. Typically, outside the heavy chain CDR3, a human antibody derived from a particular human germline sequence will display no more than 20 amino acid differences, e.g. no more than 10 amino add differences, such as no more than 5, for instance no more than 4, 3, 2, or 1 amino acid difference from the amino acid sequence encoded by the germline immunoglobulin gene.
[0080] The term bispecific antibody is intended to include any antibody, which has two different binding specificities, i.e. the antibody binds two different epitopes, which may be located on the same target antigen or, more commonly, on different target antigens.
[0081] As used herein, the term effector cell refers to an immune cell which is involved in the effector phase of an immune response, as opposed to the cognitive and activation phases of an immune response. Exemplary immune cells include a cell of a myeloid or lymphoid origin, for instance lymphocytes (such as B cells and T cells including cytolytic T cells (CTLs)), killer cells, natural killer cells, macrophages, monocytes, eosinophils, polymorphonuclear cells, such as neutrophils, granulocytes, mast cells, and basophils. Some effector cells express specific Fc receptors and carry out specific immune functions. In some embodiments, an effector cell is capable of inducing antibody-dependent cellular cytotoxicity (ADCC), such as a natural killer cell, capable of inducing ADCC. For example, monocytes, macrophages, which express FcR are involved in specific killing of target cells and presenting antigens to other components of the immune system, or binding to cells that present antigens. In some embodiments, an effector cell may phagocytose a target antigen or target cell. The expression of a particular FcR on an effector cell may be regulated by humoral factors such as cytokines. For example, expression of FcRI has been found to be up-regulated by interferon (IFN-) and/or G-CSF. This enhanced expression increases the cytotoxic activity of FcRI-bearing cells against targets. An effector cell can phagocytose or lyse a target antigen or a target cell.
[0082] Treatment refers to the administration of an effective amount of a therapeutically active compound of the present invention with the purpose of easing, ameliorating, arresting or eradicating (curing) symptoms or disease states.
[0083] An effective amount refers to an amount effective, at dosages and for periods of time necessary, to achieve a desired therapeutic result. A therapeutically effective amount of an antibody may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the antibody to elicit a desired response in the individual. A therapeutically effective amount is also one in which any toxic or detrimental effects of the antibody or antibody portion are outweighed by the therapeutically beneficial effects.
[0084] The terms half-molecule exchange and Fab arm exchange are used interchangeably herein and refer to a type of protein modification for human IgG4, in which an IgG4 heavy chain and attached light chain (half-molecule) is swapped for a heavy-light chain pair from another IgG4 molecule. Thus, IgG4 molecules may acquire two distinct Fab arms recognizing two distinct antigens (resulting in bispecific molecules) while their Fc domain structure remains unchanged. As shown herein, Fab arm exchange occurs naturally in vivo and can be induced in vitro by purified blood cells or reducing agents such as reduced glutathione.
Further Aspects and Embodiments of the Invention
[0085] As described above, in a first main aspect, the invention relates to a stabilized IgG4 antibody for use as a medicament, comprising a heavy chain and a light chain, wherein said heavy chain comprises a human IgG4 constant region having a substitution of the Arg residue at position 409, the Phe residue at position 405 or the Lys residue at position 370, wherein said antibody optionally comprises one or more further substitutions, deletions and/or insertions, with the proviso that if the antibody has a residue selected from the group consisting of: Lys, Ala, Thr, Met and Leu at the position corresponding to 409, then the antibody does not comprise a Cys-Pro-Pro-Cys sequence in the hinge region.
[0086] In one embodiment, the antibody, comprises a heavy chain and a light chain, wherein said heavy chain comprises a human IgG4 constant region having a residue selected from the group consisting of: Lys, Ala, Thr, Met and Leu at the position corresponding to 409 and/or a residue selected from the group consisting of: Ala, Val, Gly, Ile and Leu at the position corresponding to 405, and wherein said antibody optionally comprises one or more further substitutions, deletions and/or insertions, but does not comprise a Cys-Pro-Pro-Cys sequence in the hinge region.
[0087] The numbers 405 and 409 refer to the Phe and Lys residues at positions 405 and 409, respectively, using the numbering according to the EU index, see also Example 38 and
[0088] In a further main aspect, the invention relates to an isolated stabilized IgG4 antibody, comprising a heavy chain and a light chain, wherein said heavy chain comprises a human IgG4 constant region having a residue selected from the group consisting of: Lys, Ala, Thr, Met and Leu at the position corresponding to 409 and/or a residue selected from the group consisting of: Ala, Val, Gly, Ile and Leu at the position corresponding to 405, and wherein said antibody optionally comprises further substitutions, deletions and/or insertions, but does not comprise a Cys-Pro-Pro-Cys sequence in the hinge region and does not comprise both a Lys at position 409 and a Leu at position 309.
[0089] In one embodiment, said antibody comprises a Lys, Ala, Thr, Met or Leu residue at the position corresponding to 409.
[0090] In another embodiment, said antibody comprises a Lys, Thr, Met or Leu residue at the position corresponding to 409.
[0091] In a further embodiment, said antibody comprises a Lys, Met or Leu residue at the position corresponding to 409.
[0092] In a yet other embodiment, the CH3 region of the antibody has been replaced by the CH3 region of human IgG1, of human IgG2 or of human IgG3.
[0093] In a further embodiment of the stabilized IgG4 antibody of the invention, the antibody has a residue which is has a lower mass (in Da) than Phe at the position corresponding to 405.
[0094] In a further embodiment, said antibody comprises an Ala, Val, Gly, lie or Leu residue at the position corresponding to 405.
[0095] In an even further embodiment, said antibody comprises an Ala or Leu residue at the position corresponding to 405.
[0096] In a further embodiment of the stabilized IgG4 antibody of the invention, the antibody has a Thr residue at the position corresponding to 370.
[0097] In an even further embodiment, the stabilized IgG4 antibody of the invention does not comprise a substitution of the Leu residue at the position corresponding to 235 by a Glu.
[0098] However, in another embodiment, said antibody does comprise a substitution of the Leu residue at the position corresponding to 235 by a Glu.
[0099] In a further embodiment, the antibody of the invention may have been further modified to even further reduce effector functions.
[0100] Accordingly, in one embodiment, the antibody of the invention comprises one or more of the following substitutions: an Ala at position 234, an Ala at position 236, an Ala at position 237, an Ala at position 297, an Ala or Val at position 318, an Ala at position 320, an Ala or Gin at position 322.
[0101] In another embodiment, the stabilized IgG4 antibody of the invention does not comprise a Cys-Pro-Pro-Cys sequence in the hinge region.
[0102] In one embodiment, the stabilized IgG4 antibody of the invention comprises a CXPC or CPXC sequence in the hinge region, wherein X can be any amino acid except for proline.
[0103] In a further embodiment, the antibody of the invention does not comprise a CPRC sequence in the core hinge region and/or does not comprise an extended IgG3-like hinge region, such as the extended hinge region as set forth in
[0104] In one embodiment, the stabilized IgG4 antibody of the invention comprises a CPSC sequence in the hinge region.
[0105] As explained above, the antibody of the invention may contain further modifications. In one embodiment, the stabilized IgG4 antibody of the invention comprises a constant heavy chain region comprising an amino acid sequence selected from the group consisting of: SEQ ID NO:39, 40 and 41 or a variant of said amino acid sequence having less than 25, such as less than 10, e.g. less than 9, 8, 7, 6, 5, 4, 3, or 2 substitutions, deletions and/or insertions compared to said amino acid sequence.
[0106] Typically, the stabilized IgG4 antibody of the invention has a lower ability to activate effector functions as compared to IgG1 and IgG3, Thus, in one embodiment, said antibody is less efficient in mediating CDC and/or ADCC than a corresponding IgG1 or IgG3 antibody having the same variable regions. Assays for measuring CDC or ADCC activity are well known in the art.
[0107] In one embodiment, the stabilized IgG4 antibody of the invention comprises a constant heavy chain region comprising the amino acid sequence set forth in SEQ ID NO:40.
[0108] In one embodiment of the invention, the stabilized IgG4 antibody is selected from the group consisting of: a human antibody, a humanized antibody and a chimeric antibody.
[0109] In one further embodiment, the antibody of the Invention comprises a human kappa light chain. In another embodiment, said antibody comprises a human lambda light chain.
[0110] Typically, the stabilized IgG4 antibody of the invention is a bivalent antibody, for example an antibody which is bivalent even in the presence of excess of irrelevant antibodies, as explained in Example 38. Furthermore, the stabilized IgG4 antibody of the invention is preferably a full-length antibody, i.e. not a fragment.
[0111] Methods for the production of antibodies are well-known in the art. In a preferred embodiment, antibodies of the Invention are monoclonal antibodies. Monoclonal antibodies may e.g. be produced by the hybridoma method first described by Kohler et al., Nature 256, 495 (1975), or may be produced by recombinant DNA methods. Monoclonal antibodies may also be isolated from phage antibody libraries using the techniques described in, for example, Clackson et al., Nature 352, 624-628 (1991) and Marks et al., J. Mol. Biol. 222, 581-597 (1991). Monoclonal antibodies may be obtained from any suitable source. Thus, for example, monoclonal antibodies may be obtained from hybridomas prepared from murine splenic B cells obtained from mice immunized with an antigen of interest, for instance in form of cells expressing the antigen on the surface, or a nucleic add encoding an antigen of interest. Monoclonal antibodies may also be obtained from hybridomas derived from antibody-expressing cells of immunized humans or non-human mammals such as rats, dogs, primates, etc.
[0112] Further modifications, such as amino acid substitutions, deletions or insertion as described above, may be performed using standard recombinant DNA techniques well-known in the art.
[0113] In one embodiment, the antibody of the invention is a human antibody. Human monoclonal antibodies directed may be generated using transgenic or transchromosomal mice carrying parts of the human immune system rather than the mouse system. Such transgenic and transchromosomic mice include mice referred to herein as HuMAb mice and KM mice, respectively, and are collectively referred to herein as transgenic mice.
[0114] The HuMAb mouse contains a human immunoglobulin gene miniloci that encodes unrearranged human heavy ( and ) and K light chain immunoglobulin sequences, together with targeted mutations that inactivate the endogenous p and K chain loci (Lonberg, N. et al., Nature 368, 856-859 (1994)). Accordingly, the mice exhibit reduced expression of mouse IgM or K and in response to immunization, the introduced human heavy and light chain transgenes, undergo class switching and somatic mutation to generate high affinity human IgG, monoclonal antibodies (Lonberg, N. et al. (1994), supra; reviewed in Lonberg, N. Handbook of Experimental Pharmacology 13, 49-101 (1994), Lonberg, N. and Huszar, D., Intern. Rev. Immunol. Vol. 13 65-93 (1995) and Harding, F. and Lonberg, N. Ann. N.Y. Acad. Sci 764 536-546 (1995)). The preparation of HuMAb mice is described in detail in Taylor, L. et al., Nucleic Acids Research 20, 6287-6295 (1992), Chen, J. et al., International Immunology 5, 647-656 (1993), Tuaillon et al., 3. Immunol. 152, 2912-2920 (1994), Taylor, L. et al., International Immunology 6, 579-591 (1994), Fishwild, D. et al., Nature Biotechnology 14, 845-851 (1996). See also U.S. Pat. No. 5,545,806, U.S. Pat. No. 5,569,825, U.S. Pat. No. 5,625,126, U.S. Pat. No. 5,633,425, U.S. Pat. No. 5,789,650, U.S. Pat. No. 5,877,397, U.S. Pat. No. 5,661,016, U.S. Pat. No. 5,814,318, U.S. Pat. No. 5,874,299, U.S. Pat. No. 5,770,429, U.S. Pat. No. 5,545,807, WO 98/24884, WO 94/25585, WO 93/1227, WO 92/22645, WO 92/03918 and WO 01/09187.
[0115] The HCo7 mice have a JKD disruption in their endogenous light chain (kappa) genes (as described in Chen et al., EMBO J. 12, 821-830 (1993)), a CMD disruption in their endogenous heavy chain genes (as described in Example 1 of WO 01/14424), a KCo5 human kappa light chain transgene (as described in Fishwild et al., Nature Biotechnology 14, 845-851 (1996)), and a HCo7 human heavy chain transgene (as described in U.S. Pat. No. 5,770,429).
[0116] The HCo12 mice have a JKD disruption in their endogenous light chain (kappa) genes (as described in Chen et al., EMBO J. 12, 821-830 (1993)), a CMD disruption in their endogenous heavy chain genes (as described in Example 1 of WO 01/14424), a KCo5 human kappa light chain transgene (as described in Fishwild et al., Nature Biotechnology 14, 845-851 (1996)), and a HCo12 human heavy chain transgene (as described in Example 2 of WO 01/14424).
[0117] In the KM mouse strain, the endogenous mouse kappa light chain gene has been homozygously disrupted as described in Chen et al., EMBO J. 12, 811-820 (1993) and the endogenous mouse heavy chain gene has been homozygously disrupted as described in Example 1 of WO 01/09187. This mouse strain carries a human kappa light chain transgene, KCo5, as described in Fishwild et al., Nature Biotechnology 14, 845-851 (1996). This mouse strain also carries a human heavy chain transchromosome composed of chromosome 14 fragment hCF (SC20) as described in WO 02/43478.
[0118] Splenocytes from these transgenic mice may be used to generate hybridomas that secrete human monoclonal antibodies according to well known techniques. Such transgenic non-human animals, non-human animals comprising an operable nucleic acid sequence coding for expression of antibody used in the invention, non-human animals stably transfected with one or more target-encoding nucleic acid sequences, and the like, are additional features of the present invention.
[0119] Human monoclonal or polyclonal antibodies to be used in the present invention, or antibodies used in the present invention originating from other species may also be generated transgenically through the generation of another non-human mammal or plant that is transgenic for the immunoglobulin heavy and light chain sequences of interest and production of the antibody in a recoverable form therefrom. In connection with the transgenic production in mammals, antibodies may be produced in, and recovered from, the milk of goats, cows, or other mammals. See for instance U.S. Pat. No. 5,827,690, U.S. Pat. No. 5,756,687, U.S. Pat. No. 5,750,172 and U.S. Pat. No. 5,741,957.
[0120] Further, human or other antibodies to be used in the present invention may be generated through display-type technologies, including, without limitation, phage display, retroviral display, ribosomal display, and other techniques, using techniques well known in the art and the resulting molecules may be subjected to additional maturation, such as affinity maturation, as such techniques are well known in the art (see for instance Hoogenboom et al., J. Mol. Biol. 227, 381 (1991) (phage display), Vaughan et al., Nature Biotech 14, 309 (1996) (phage display), Hanes and Pluckthun, PNAS USA 94, 4937-4942 (1997) (ribosomal display), Parmley and Smith, Gene 73, 305-318 (1988) (phage display), Scott TIBS 17, 241-245 (1992), Cwirla et al., PNAS USA 87, 6378-6382 (1990), Russel et al., Nucl. Acids Research 21, 1081-1085 (1993), Hoogenboom et al., Immunol. Reviews 130, 43-68 (1992), Chiswell and McCafferty TIBTECH 10, 80-84 (1992), and U.S. Pat. No. 5,733,743). If display technologies are utilized to produce antibodies that are not human, such antibodies may be humanized.
[0121] In a further main aspect, the invention relates to a method for producing a stabilized IgG4 antibody of the invention, said method comprising expressing a nucleic add construct encoding said antibody in a host cell and optionally purifying said antibody. In one embodiment of this method, said stabilized IgG4 antibody does not comprise both a Lys at position 409 and a Leu at position 309.
[0122] In one embodiment, the antibody of the invention is linked to a compound selected from the group consisting of: a cytotoxic agent; a radioisotope; a prodrug or drug, such as a taxane; a cytokine; and a chemokine. Methods for linking (conjugating) such compounds to an antibody are well-known in the art. References to suitable methods have been given in WO 2004/056847 (Genmab).
[0123] In a further main aspect, the invention relates to a pharmaceutical composition comprising a stabilized IgG4 antibody as defined herein above. The pharmaceutical compositions may be formulated with pharmaceutically acceptable carriers or diluents as well as any other known adjuvants and excipients in accordance with conventional techniques, such as those disclosed in Remington: The Science and Practice of Pharmacy, 19th Edition, Gennaro, Ed., Mack Publishing Co., Easton, Pa., 1995.
[0124] The pharmaceutically acceptable carriers or diluents as well as any other known adjuvants and excipients should be suitable for the chosen compound of the present invention and the chosen mode of administration. Suitability for carriers and other components of pharmaceutical compositions is determined based on the lack of significant negative impact on the desired biological properties of the chosen compound or pharmaceutical composition of the present invention (e.g., less than a substantial impact (10% or less relative inhibition, 5% or less relative inhibition, etc.) on antigen binding.
[0125] A pharmaceutical composition of the present invention may also include diluents, fillers, salts, buffers, detergents (e.g., a nonionic detergent, such as Tween-80), stabilizers, stabilizers (e.g., sugars or protein-free amino adds), preservatives, tissue fixatives, solubilizers, and/or other materials suitable for inclusion in a pharmaceutical composition.
[0126] Actual dosage levels of the active ingredients in the pharmaceutical compositions of the present invention may be varied so as to obtain an amount of the active ingredient which is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, without being toxic to the patient. The selected dosage level will depend upon a variety of pharmacokinetic factors including the activity of the particular compositions of the present invention employed, or the ester, salt or amide thereof, the route of administration, the time of administration, the rate of excretion of the particular compound being employed, the duration of the treatment, other drugs, compounds and/or materials used in combination with the particular compositions employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors well known in the medical arts.
[0127] A physician or veterinarian having ordinary skill in the art can readily determine and prescribe the effective amount of the pharmaceutical composition required. For example, the physician or veterinarian could start doses of the compounds of the invention employed in the pharmaceutical composition at levels lower than that required in order to achieve the desired therapeutic effect and gradually increase the dosage until the desired effect is achieved. In general, a suitable daily dose of a composition of the invention will be that amount of the compound which is the lowest dose effective to produce a therapeutic effect. Such an effective dose will generally depend upon the factors described above. It is preferred that administration be intravenous, intramuscular, intraperitoneal, by inhalation or subcutaneous. If desired, the effective daily dose of a therapeutic composition may be administered as two, three, four, five, six or more sub-doses administered separately at appropriate intervals throughout the day, optionally, in unit dosage forms.
[0128] In one embodiment, a pharmaceutical composition of the present invention is administered parenterally. The phrases parenteral administration and administered parenterally as used herein means modes of administration other than enteral and topical administration, usually by injection, and include epidermal, intravenous, intramuscular, intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, intratendinous, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, intracranial, intrathoradc, epidural and intrasternal injection and Infusion.
[0129] Stabilized IgG4 antibodies of the invention can be used in the treatment and/or prevention of a number of diseases, and be directed to an antigen selected from a broad variety of suitable target molecules. In one embodiment of the invention, the antibody binds an antigen selected from the group consisting of: erythropoietin, beta-amyloid, thrombopoietin, interferon-alpha (2a and 2b), interferon-beta (1b), interferon-gamma, TNFR I (CD120a), TNFR II (CD120b), IL-1R type 1 (CD121a), IL-1R type 2 (CD121b), IL-2, IL2R (CD25), IL-2R-beta (CD123), IL-3, IL-4, IL-3R (CD123), IL-4R (CD124), IL-5R (CD125), IL-6R-alpha (CD126), -beta (CD130), IL-8, IL-10, IL-11, IL-15, IL-15BP, IL-15R, IL-20, IL-21, TCR variable chain, RANK, RANK-L, CTLA4, CXCR4R, CCR5R, TGF-beta1, -beta2, -beta3, G-CSF, GM-CSF, MIF-R (CD74), M-CSF-R (CD115), GM-CSFR (CD116), soluble FcRI, sFcRII, sFcRIII, FcRn, Factor VII, Factor VIII, Factor IX, VEGF, VEGFxxxb, alpha-4 integrin, Cd11a, CD18, CD20, CD38, CD25, CD74, FcalphaRI, FcepsilonRI, acetyl choline receptor, fas, fasL, TRAIL, hepatitis virus, hepatitis C virus, envelope E2 of hepatitis C virus, tissue factor, a complex of tissue factor and Factor VII, EGFr, CD4, CD28, VLA-1, 2, 3, or 4, LFA-1, MAC-1, I-selectin, PSGL-1, ICAM-I, P-selectin, periostin, CD33 (Siglec 3), Siglec 8, TNF, CCL1, CCL2, CCL3, CCL4, CCL5, CCLL1, CCL13, CCL17, CCL18, CCL20, CCL22, CCL26, CCL27, CX3CL1, LIGHT, EGF, VEGF, TGFalpha, HGF, PDGF, NGF, complement or a related components such as: C1q, C4, C2, C3, C5, C6, C7, C8, C9, MBL, factor B, a Matrix Metallo Protease such as any of MMP1 to MMP28, CD32b, CD200, CD200R, Killer immunoglobulin-Like Receptors (KIRs), NKG2D and related molecules, leukocyte-associated immunoglobulin-like receptors (LAIRs), ly49, PD-L2, CD26, BST-2, ML-IAP (melanoma inhibitor of apoptosis protein), cathepsin D, CD40, CD40R, CD86, a B cell receptor, CD79, PD-1, and a T cell receptor.
[0130] In one embodiment of the invention, the antibody binds an alpha-4 integrin and is for use in the treatment of inflammatory and autoimmune diseases, such as rheumatoid arthritis, multiple sclerosis, inflammatory bowel disease, asthma and sepsis.
[0131] In another embodiment of the invention, the antibody binds VLA-1, 2, 3, or 4 and is for use in the treatment of inflammatory and autoimmune diseases, such as rheumatoid arthritis, multiple sclerosis, inflammatory bowel disease, asthma, type-1 diabetes, SLE, psoriasis, atopic dermatitis, COPD and sepsis.
[0132] In another embodiment of the invention, the antibody binds a molecule selected from the group consisting of: LFA-1, MAC-1, I-selectin and PSGL-1 and is for use in the treatment of inflammatory and autoimmune diseases, such as rheumatoid arthritis, multiple sclerosis, inflammatory bowel disease, asthma, type-1 diabetes, SLE, psoriasis, atopic dermatitis, and COPD.
[0133] In another embodiment of the invention, the antibody binds a molecule selected from the group consisting of: LFA-1, MAC-1, I-selectin and PSGL-1 and is for use in the treatment of a disease selected from the group consisting of ischemia-reperfusion injury, cystic fibrosis, osteomyelitis, glomeruloneprltis, gout and sepsis.
[0134] In another embodiment of the invention, the antibody binds CD18 and is for use in the treatment of inflammatory and autoimmune diseases, such as rheumatoid arthritis, multiple sclerosis, inflammatory bowel disease, asthma, type-1 diabetes, SLE, psoriasis, atopic dermatitis and COPD.
[0135] In another embodiment of the invention, the antibody binds Cd11a and is for use in the treatment of inflammatory and autoimmune diseases, such as rheumatoid arthritis, multiple sclerosis, inflammatory bowel disease, asthma, type-1 diabetes, SLE, psoriasis, atopic dermatitis and COPD.
[0136] In another embodiment of the invention, the antibody binds ICAM-1 and is for use in the treatment of inflammatory and autoimmune diseases, such as rheumatoid arthritis, multiple sclerosis, inflammatory bowel disease, asthma, type-1 diabetes, SLE, psoriasis, atopic dermatitis and COPD.
[0137] In another embodiment of the invention, the antibody binds P-selectin and is for use in the treatment of cardiovascular diseases, post-thrombotic vein wall fibrosis, Ischemia reperfusion injury, inflammatory diseases or sepsis.
[0138] In another embodiment of the invention, the antibody binds periostin and is for use in the treatment of malignant diseases and/or metastising diseases, such as ovary cancer, endometrial cancer, NSCLC, glioblastoma, brain-related tumors, breast cancer, OSCC, colon cancer, pancreatic cancer, HNSCC, kidney cancer, thymoma, lung cancer, skin cancer, larynx cancer, liver cancer, parotid tumors, gastric cancer, esophagus cancer, prostate cancer, bladder cancer and cancer of the testis.
[0139] In another embodiment of the Invention, the antibody binds CD33 (Siglec 3), is optionally coupled to a toxin, cytotoxic or cytostatic drug, and is for use in the treatment of tumors expressing CD33 or acute myeloid leukemia.
[0140] In another embodiment of the invention, the antibody binds Siglec 8 and is for use in the treatment of: asthma, inflammatory or autoimmune diseases, such as rheumatoid arthritis, multiple sclerosis, inflammatory bowel disease, asthma, type-1 diabetes, SLE, psoriasis, atopic dermatitis and COPD.
[0141] In another embodiment of the Invention, the antibody binds nucleolin and is for use in the treatment of malignant diseases and/or metastising diseases, such as ovary cancer, cervical cancer, endometrial cancer, NSCLC, glioblastoma, brain-related tumors, breast cancer, OSCC, colon cancer, pancreatic cancer, HNSCC, kidney cancer, thymoma, lung cancer, skin cancer, larynx cancer, liver cancer, parotid tumors, gastric cancer, esophagus cancer, prostate cancer, bladder cancer, cancer of the testis and lymphomas.
[0142] In another embodiment of the Invention, the antibody binds TNF and is for use in the treatment of: Inflammatory and autoimmune diseases, such as rheumatoid arthritis, multiple sclerosis, inflammatory bowel disease, asthma, type-1 diabetes, SLE, psoriasis, atopic dermatitis, COPD and sepsis.
[0143] In another embodiment of the invention, the antibody binds CCL1, CCL2, CCL3, CCL4, CCL5, CCL11, CCL13, CCL17, CCL18, CCL20, CCL22, CCL26, CCL27 or CX3CL1 and is for use in the treatment of: atopic dermatitis, inflammatory and autoimmune diseases, such as rheumatoid arthritis, multiple sclerosis, inflammatory bowel disease, asthma, type-1 diabetes, SLE, psoriasis, COPD and sepsis.
[0144] In another embodiment of the invention, the antibody binds PD-1 and is for use in restoring T cell function in HIV-1 Infection and therapy of AIDS.
[0145] In another embodiment of the invention, the antibody binds LIGHT and is for use in the treatment of a disease selected from the group consisting of: hepatitis, inflammatory bowel disease, graft-versus-host disease (GVHD) and Inflammation.
[0146] In another embodiment of the invention, the antibody binds EGF, VEGF, TGFalpha or HGF and is for use in the treatment of: malignant diseases, such as solid cancers.
[0147] In another embodiment of the invention, the antibody binds PDGF and is for use in the treatment of: diseases in which abnormal cell proliferation cell migration and/or angiogenesis occurs, such as atherosclerosis, fibrosis, and malignant diseases.
[0148] In another embodiment of the invention, the antibody binds NGF and is for use in the treatment of: neurological diseases, neurodegenerative diseases, such as Alzhelmer's disease and Parkinson's disease, or cancer, such as prostate cancer.
[0149] In another embodiment of the Invention, the antibody binds complement or a related components such as: C1q, C4, C2, C3, C5, C6, C7, C8, C9, MBL, or factor B and is for use in: diseases in which complement and related components play a detrimental role, such as organ transplant rejection, multiple sclerosis, Guillain-Barr syndrome, hemolytic anemia, Paroxysmal Nocturnal Hemoglobinuria, stroke, heart attacks, burn injuries, age-related macular degeneration, asthma, lupus, arthritis, myasthenia gravis, anti-phospholipid syndrome, sepsis and ischemia reperfusion injury.
[0150] In another embodiment of the invention, the antibody binds a Matrix Metallo Protease such as any of MMP1 to MMP28 and is for use in the treatment of: inflammatory and autoimmune diseases, cancer, including metastatic cancer; arthritis, inflammation, cardiovascular diseases, cerebrovascular diseases such as stroke or cerebral aneurysms, pulmonary diseases such as asthma, ocular diseases such as corneal wound healing or degenerative genetic eye diseases, gastrointestinal diseases such as inflammatory bowel disease or ulcers, oral diseases such as dental caries, oral cancer or periodontitis, ischemia reperfusion injury or sepsis.
[0151] In another embodiment of the invention, the antibody binds CD32b and is for use in enhancement of T-cell responses to tumor antigens and ADCC/phagocytosis by macrophages, in combination with another therapeutic antibody; vaccination, immunotherapy of B-cell lymphoma's, asthma or allergy.
[0152] In another embodiment of the invention, the antibody binds CD200 or CD200R and is for use in the treatment of: asthma, rheumatoid arthritis, GVHD, other autoimmune diseases, or cancer, such as solid tumors or lymphomas.
[0153] In another embodiment of the Invention, the antibody binds Killer immunoglobulin-Like Receptors (KIRs), NKG2D or related molecules, leukocyte-associated immunoglobulin-like receptors (LAIRs), or ly49 and is for use in the treatment of: cancer, such as solid tumors or lymphomas; asthma, rheumatoid arthritis, GVHD or other autoimmune diseases.
[0154] In another embodiment of the invention, the antibody binds PD-L2 and is for use in the treatment of: cancer, asthma, or for use in vaccine enhancement.
[0155] In another embodiment of the invention, the antibody binds CD26 and is for use in the treatment of: atherosclerosis, GVHD, or auto-immune diseases.
[0156] In another embodiment of the invention, the antibody binds BST-2 and is for use in the treatment of: asthma, atherosclerosis, rheumatoid arthritis, psoriasis, Crohn's disease, ulcerative cholitis, atopic dermatitis, sepsis or inflammation.
[0157] In another embodiment of the invention, the antibody binds ML-IAP (melanoma inhibitor of apoptosis protein) and is for use in the treatment of melanoma.
[0158] In another embodiment of the invention, the antibody binds cathepsin D and is for use in the treatment of: malignant diseases such as breast cancer, ovarian cancer, glioma, NSCLC, bladder cancer, endometrial cancer, liver cancer, sarcoma, gastric cancer, SCCHN, prostate cancer or colorectal cancer.
[0159] In another embodiment of the invention, the antibody binds CD40 or CD40R and is for use in the treatment of: cancer, in particular B-cell lymphomas, B-cell-related or -mediated diseases, autoimmune diseases such as psoriatic arthritis, rheumatoid arthritis, multiple sclerosis, psoriasis, Crohn's disease or ulcerative cholitis.
[0160] In another embodiment of the invention, the antibody binds CD86 and is for use in conjunction with organ transplantation.
[0161] In another embodiment of the invention, the antibody binds a B cell receptor and is for use in the treatment of: B-cell-related or -mediated diseases, such as B cell lymphoma's, leukemia, autoimmune diseases, inflammation or allergy.
[0162] In another embodiment of the Invention, the antibody binds CD79 and is for use in the treatment of B-cell-related or -mediated diseases, such as B-cell lymphomas, leukemia, autoimmune diseases, inflammation or allergy.
[0163] In another embodiment of the invention, the antibody binds a T cell receptor and is for use in the treatment of T-cell-related or -mediated diseases, such as T-cell lymphomas, leukemia, autoimmune diseases, inflammation or allergy.
[0164] In another embodiment of the invention, the antibody binds FcalphaRI and is for use in the treatment of a disease or disorder selected from: allergic asthma or other allergic diseases such as allergic rhinitis, seasonal/perennial allergies, hay fever, nasal allergies, atopic dermatitis, eczema, hives, urticaria, contact allergies, allergic conjunctivitis, ocular allergies, food and drug allergies, latex allergies, or insect allergies, or IgA nephropathy, such as IgA pemphigus.
[0165] In another embodiment of the invention, the antibody binds CD25 and is for use in the treatment of a disease or disorder selected from the group consisting of: transplant rejection, graft-versus-host disease, inflammatory, immune or autoimmune diseases, inflammatory or hyperproliferative skin disorders, lymphoid neoplasms, malignancies, hematological disorders, skin disorders, hepato-gastrointestinal disorders, cardiac disorders, vascular disorders, renal disorders, pulmonary disorders, neurological disorders, connective tissue disorders, endocrinological disorders, viral infections.
[0166] In another embodiment of the Invention, the antibody binds IL-15 or the IL15 receptor and is for use in the treatment of a disease or disorder selected from the group consisting of: arthritides, gout, connective disorders, neurological disorders, gastrointestinal disorders, hepatic disorders, allergic disorders, hematological disorders, skin disorders, pulmonary disorders, malignant disorders, endocrinological disorders, vascular disorders, Infectious disorders, kidney disorders, cardiac disorders, circulatory disorders, metabolic disorders, bone, disorders and muscle disorders.
[0167] In another embodiment of the invention, the antibody binds IL-8 and is for use in the treatment of a disease or disorder selected from the group consisting of: palmoplantar pustulosis (PPP), psoriasis, or other skin diseases, inflammatory, autoimmune and immune disorders, alcoholic hepatitis and acute pancreatitis, diseases involving IL-8 mediated angiogenesis.
[0168] In another embodiment of the invention, the antibody binds CD20 and is for use in the treatment of a disease or disorder selected from the group consisting of: rheumatoid arthritis, (auto)immune and inflammatory disorders, non-Hodgkin's lymphoma, B-CLL, lymphoid neoplasms, malignancies and hematological disorders, infectious diseases and connective disorders, neurological disorders, gastrointestinal disorders, hepatic disorders, allergic disorders, hematological disorders, skin disorders, pulmonary disorders, malignant disorders, endocrinological disorders, vascular disorders, infectious disorders, kidney disorders, cardiac disorders, circulatory disorders, metabolic disorders, bone and muscle disorders, and Immune mediated cytopenia.
[0169] In another embodiment of the invention, the antibody binds CD38 and is for use in the treatment of a disease or disorder selected from the group consisting of: tumorigenic disorders, immune disorders in which CD38 expressing B cells, plasma cells, monocytes and T cells are involved, acute respiratory distress syndrome and choreoretinitis, rheumatoid arthritis, inflammatory, immune and/or autoimmune disorders in which autoantibodies and/or excessive B and T lymphocyte activity are prominent, skin disorders, immune-mediated cytopenias, connective tissue disorders, arthritides, hematological disorders, endocrinopathles, hepato-gastrointestinal disorders, nephropathies, neurological disorders, cardiac and pulmonary disorders, allergic disorders, ophthalmologic disorders, infectious diseases, gynecological-obstetrical disorders, male reproductive disorders, transplantation-derived disorders,
[0170] In another embodiment of the invention, the antibody binds EGFr and is for use in the treatment of a disease or disorder selected from the group consisting of: cancers (over)expressing EGFr and other EGFr related diseases, such as autoimmune diseases, psoriasis, inflammatory arthritis.
[0171] In another embodiment of the invention, the antibody binds CD4 and is for use in the treatment of a disease or disorder selected from the group consisting of: rheumatoid arthritis, (auto)immune and inflammatory disorders, cutaneous T cell lymphomas, non-cutaneous T cell lymphomas, lymphoid neoplasms, malignancies and hematological disorders, infectious diseases, and connective disorders, neurological disorders, gastrointestinal disorders, hepatic disorders, allergic disorders, hematologic disorders, skin disorders, pulmonary disorders, malignant disorders, endocrinological disorders, vascular disorders, infectious disorders, kidney disorders, cardiac disorders, circulatory disorders, metabolic disorders, bone disorders, muscle disorders, immune mediated cytopenia, and HIV infection/AIDS.
[0172] In another embodiment of the invention, the antibody binds CD28 and is for use in the treatment of a disease or disorder selected from the group consisting of: an inflammatory disease, autoimmune disease and immune disorder.
[0173] In another embodiment of the invention, the antibody binds tissue factor, or a complex of Factor VII and tissue factor and is for use in the treatment of a disease or disorder selected from the group consisting of: vascular diseases, such as myocardial vascular disease, cerebral vascular disease, retinopathy and macular degeneration, and inflammatory disorders.
[0174] In a further aspect, the invention relates to the use of a stabilized IgG4 antibody that binds any of the antigen mentioned herein above for the preparation of a medicament for the treatment of a disease or disorder as mentioned herein above in connection with said target antigen.
[0175] The present invention is further illustrated by the following examples which should not be construed as further limiting.
EXAMPLES
Example 1
Oligonucleotide Primers and PCR Amplification
[0176] Oligonucleotide primers were synthesized and quantified by isogen Bioscience (Maarssen, The Netherlands). Primers were dissolved in H.sub.2O to 100 mol/l and stored at 20 C. A summary of all PCR and sequencing primers is given below. For PCR, PfuTurbo Hotstart DNA polymerase (Stratagene, Amsterdam, The Netherlands) was used according to the manufacturer's instructions. Each reaction mix contained 200 M mixed dNTPs (Roche Diagnostics, Almere, The Netherlands), 6.7 pmol of both the forward and reverse primer, 100 ng of genomic DNA or 1 ng of plasmid DNA and 1 unit of PfuTurbo Hotstart DNA polymerase in PCR reaction buffer (supplied with polymerase) in a total volume of 20 l. PCR reactions were carried out with a TGradient Thermocycler 96 (Whatman Biometra, Goettingen, Germany) using a 32-cycle program: denaturing at 95 C. for 2 min; 30 cycles of 95 C. for 30 sec, a 60-70 C. gradient (or another specific annealing temperature) for 30 sec, and 72 C. for 3 min; final extension at 72 C. for 10 min. If appropriate, the PCR mixtures were stored at 4 C. until further analysis or processing.
Example 2
Agarose Gel Electrophoresis
[0177] Agarose gel electrophoresis was performed according to Sambrook (Sambrook, Russell et al. 2000 Molecular cloning. A laboratory manual (third edition), Cold Spring Harbor Laboratory Press) using gels of 50 ml, in 1Tris Acetate EDTA buffer. DNA was visualized by the inclusion of ethidium bromide in the gel and observation under UV light. Gel images were recorded by a CCD camera and an image analysis system (GeneGnome; Syngene, via Westburg B. V., Leusden, The Netherlands).
Example 3
Analysis and Purification of PCR Products and Enzymatic Digestion
[0178] Purification of desired PCR fragments was carried out using a MinElute PCR Purification Kit (Qiagen, via Westburg, Leusden, The Netherlands; product#28006), according to the manufacturer's instructions. Isolated DNA was quantified by UV spectroscopy and the quality was assessed by agarose gel electrophoresis.
[0179] Alternatively, PCR or digestion products were separated by agarose gel electrophoresis (e.g. when multiple fragments were present) using a 1% Tris Acetate EDTA agarose gel. The desired fragment was excised from the gel and recovered using the QIAEX II Gel Extraction Kit (Qiagen; product#20051), according to the manufacturer's instructions.
Example 4
Quantification of DNA by UV Spectroscopy
[0180] Optical density of nucleic acids was determined using a NanoDrop ND-1000 Spectrophotometer (Isogen Life Science, Maarssen, The Netherlands) according to the manufacturer's instructions. The DNA concentration was measured by analysis of the optical density (OD) at 260 nm (one OD.sub.260 n m unit=50 g/ml). For all samples, the buffer in which the nucleic adds were dissolved was used as a reference.
Example 5
Restriction Enzyme Digestions
[0181] Restriction enzymes and supplements were obtained from New England Biolabs (Beverly, Mass., USA) or Fermetas (Vilnius, Lithuania) and used according to the manufacturer's instructions.
[0182] DNA (100 ng) was digested with 5 units of enzyme(s) in the appropriate buffer in a final volume of 10 l (reaction volumes were scaled up as appropriate). Digestions were incubated at the recommended temperature for a minimum of 60 min. For fragments requiring double digestions with restriction enzymes which involve incompatible buffers or temperature requirements, digestions were performed sequentially. If necessary digestion products were purified by agarose gel electrophoresis and gel extraction.
Example 6
Ligation of DNA Fragments
[0183] Ligations of DNA fragments were performed with the Quick Ligation Kit (New England Biolabs) according to the manufacturer's instructions. For each ligation, vector DNA was mixed with approximately three-fold molar excess of insert DNA.
Example 7
Transformation of E. coli
[0184] Plasmid DNA (1-5 l of DNA solution, typically 2 l of DNA ligation mix) was transformed into One Shot DH5-T1.sup.R or MACH-1 T1.sup.R competent E. coli cells (Invitrogen, Breda, The Netherlands; product#12297-016) using the heat-shock method, according to the manufacturer's instructions. Next, cells were plated on Luria-Bertani (LB) agar plates containing 50 g/ml ampicillin. Plates were incubated for 16-18 h at 37 C. until bacterial colonies became evident.
Example 8
Screening of Bacterial Colonies by PCR
[0185] Bacterial colonies were screened for the presence of vectors containing the desired sequences via colony PCR using the HotStarTaq Master Mix Kit (Qiagen; product#203445) and the appropriate forward and reverse primers. Selected colonies were lightly touched with a 20 l pipette tip and touched briefly in 2 ml LB for small scale culture, and then resuspended in the PCR mix. PCR was performed with a TGradient Thermocycler 96 using a 35-cycle program: denaturation at 95 C. for 15 min; 35 cycles of 94 C. for 30 sec, 55 C. for 30 sec and 72 C. for 2 min; followed by a final extension step of 10 min at 72 C. If appropriate, the PCR mixtures were stored at 4 C. until analysis by agarose gel electrophoresis.
Example 9
Plasmid DNA Isolation from E. coli Culture
[0186] Plasmid DNA was isolated from E. coli cultures using the following kits from Qiagen (via Westburg, Leusden, The Netherlands), according to the manufacturer's instructions. For bulk plasmid preparation (50-150 ml culture), either a HiSpeed Plasmid Maxi Kit (product#12663) or a HiSpeed Plasmid Midi Kit (product#12643) was used. For small scale plasmid preparation (*2 ml culture) a Qiaprep Spin Miniprep Kit (product#27106) was used and DNA was eluted in 50 l elution buffer (supplied with kit).
Example 10
DNA Sequencing
[0187] Plasmid DNA was sequenced using standard procedures known in the art. Sequences were analyzed using Vector NTI software (Informax, Oxford, UK).
Example 11
Transient Expression in HEK-293F Cells
[0188] Freestyle 293-F (a HEK-293 subclone adapted to suspension growth and chemically defined Freestyle medium, e.g. HEK-293F) cells were obtained from Invitrogen and transfected according to the manufacturer's protocol using 293fectin (Invitrogen).
Example 12
Construction of pTomG4; a Vector for the Expression of Variable Heavy Chain Regions with the Constant Region of Human IgG4
[0189] Genomic DNA was isolated from a blood sample of a volunteer and used as a template in a PCR with primers IGG4gene2f and IGG4gene2r (see table below), amplifying the complete genomic constant region of the heavy chain of IgG4 and introducing suitable restriction sites for cloning into the mammalian expression vector pEE6.4 (Lonza Biologics). The PCR fragment was purified and cloned into pEE6.4. For this the PCR product was digested with HindIII and EcoRI, followed by heat inactivation of the restriction enzymes. The pEE6.4 vector was digested HindIII and EcoRI, followed by heat Inactivation of the restriction enzymes and dephosphorylation of the vector fragment with shrimp alkaline phosphatase, followed by heat inactivation of the phosphatase. The IgG4 fragment and the pEE6.4HindII/EcoRI dephosphorylated vector were ligated and transformed into competent MACH1-T1.sup.R cells (Invitrogen). Three clones were grown in LB and plasmid DNA was isolated from a small culture (1.5 mL). Restriction digestion revealed a pattern consistent with the cloning of the IgG4 fragment in the pEE6.4 vector. Plasmid DNA from two clones was transformed in DH5-T1.sup.R E. coli and plasmid DNA was isolated and the constructs were checked by sequence analysis of the Insert and one done was found to be identical to a genomic IgG4 clone from the Genbank database, apart from some minor differences in introns. These differences are presumably either polymorphisms or sequence faults in the Genbank sequence. The plasmid was named pTomG4.
TABLE-US-00001 TABLE1 Name OligonucleotideSequence VLexbetv1rev AGCCACCGTACGTTTGATTTCCAGCTTGGTGCCTCC (SEQIDNO:1) VLexbetv1for GATGCAAGCTTGCCGCCACCATGGAGTCACAGATTC AGGCATTT(SEQIDNO:2) VHexbetv1rev CGATGGGCCCTTGGTGCTGGCTGAGGAGACGGTGAC TGAGGT(SEQIDNO:3) VHexbetV1for GATGCAAGCTTGCCGCCACCATGAAATGCAGCTGGG TTATCTTC(SEQIDNO:4) VLexfeld1rev AGCCACCGTACGTTTTATTTCCAACTTTGTCCCCGA (SEQIDNO:5) VLexfeld1for GATGCAAGCTTGCCGCCACCATGGAATCACAGACTC AGGTCCTC(SEQIDNO:6) VHexfeld1rev CGATGGGCCCTTGGTGCTGGCTGCAGAGAAAGTGAC CAGAGT(SEQIDNO:7) VHexfeld1for GATGCAAGCTTGCCGCCACCATGGGATGGAGCTATA TCATCCTC(SEQIDNO:8) IGG4gene2r TGAGAATTCGGTGGGTGCTTTATTTCCATGCT (SEQIDNO:9) IGG4gene2f GTAGAAGCTTACCATCGCGGATAGACAAGAACC (SEQIDNO:10) RACEKmm1 TGTTAACTGCTCACTGGATGGTGGGA (SEQIDNO:11) RACEG1mm1 TCCCTGGGCACAATTTTCTTGTCCACC (SEQIDNO:12) ShortUPMH3 TGAAAGCTTCTAATACGACTCACTATAGGGC (SEQIDNO:13)
Example 13
Cloning of the Variable Regions of the Mouse Anti-Betv1 and Anti-Feld1 Antibodies
[0190] Total RNA was prepared from 0.310.sup.5 (Betv1) or 0.910.sup.5 (Feld1) mouse hybridoma cells (For Betv1: clone 2H8 from Akkerdaas, van Ree et al. 1995 Allergy 50(3), 215-220 and for Feld1: clone 4F7 from de Groot et al. 1988 J. Allergy Clin. Immunol. 82, 778) with the RNeasy kit (Qiagen, Westburg, Leusden, Netherlands) according to the manufacturer's protocol.
[0191] 5-RACE-Complementary DNA (cDNA) of RNA was prepared from approximately 100 ng total RNA, using the SMART RACE cDNA Amplification kit (BD Biosciences Clontech, Mountain View, Calif., USA), following the manufacturer's protocol. The VL and VH regions of the Betv1 and Feld1 antibody were amplified by PCR. For this PfuTurbo Hotstart DNA polymerase (Stratagene) was used according to the manufacturer's instructions. Each reaction mix contained 200 M mixed dNTPs (Roche Diagnostics), 12 pmol of the reverse primer (RACEG1 mm1 for the VH region and RACEKmm1 for the VL region), 7.2 pmol UPM-Mix (UPM-Mix: 2 M ShortUPMH3 and 0.4 M LongUPMH3 oligonucleotide), 0.6 l of the 5RACE cDNA template as described above, and 1.5 unit of PfuTurbo Hotstart DNA polymerase in PCR reaction buffer (supplied with polymerase) in a total volume of 30 l.
[0192] PCR reactions were carried out with a TGradient Thermocycler 96 (Whatman Biometra) using a 35-cycle program: denaturing at 95 C. for 2 min; 35 cycles of 95 C. for 30 sec, a 55 C. for 30 sec, and 72 C. for 1.5 min; final extension at 72 C. for 10 min. The reaction products were separated by agarose gel electrophoresis on a 1% TAE agarose gel and stained with ethidium bromide. Bands of the correct size were cut from the gels and the DNA was isolated from the agarose using the QiaexII gel extraction kit (Qiagen).
[0193] Gel isolated PCR fragments were A tailed by a 10 min 72 C. incubation with 200 M dATP and 2.5 units Amplitaq (Perkin Elmer) and purified using minielute columns (Qiagen). A-tailed PCR fragments were cloned into the pGEMTeasy vector (Promega) using the pGEMT easy vector system II kit (Promega), following the manufacturer's protocol. 2 l of the ligation mixture was transformed into OneShot DH5T1R competent E. coli (Invitrogen) and plated on LB/Amp/IPTG/Xgal plates. Four, insert containing, white colonies each for the VH and VL sequences were picked and the inserts were sequenced. The deduced amino acid sequences of the VH and VL of Betv1 are given in SEQ ID NO:15 and 16 and the deduced amino acid sequences of Feld1 are depicted in SEQ ID NO:17 and 18.
TABLE-US-00002 VHsequenceBetv1(SEQIDNO:15): mkcswvifflmavvtgvnsevqlqqsgaelvkpgasvkisctasgfnikd tyihwvkqrpeqglewvgridpatgntrydpkfqgkatitadtssntayl qissltsedtavyycasfrpgyaldywgqgtsvtvss VLsequenceBetv1(SEQIDNO:16): mesqiqafvfvflwlsgvdgdivmtqshkfmstsvgdrvsftckasqdvf tavawyqqkpgqspklliywastrrtgvpdrftgsgsgtdytltissvqa edialyycqqhfstpptfgggtkleik VHsequenceFeld1(SEQIDNo:17): mgwsyillflvatatdvhsqvqlqqpgaelvkpgasvkisckasgysfts ywmhwlkqrpgqglewlgeinpnngrtyynekfktkatitvdkssstaym qlnsltsedsavyycarritmvesfaywgqgtlvtfsa VLsequenceFeld1(SEQIDNO:18): mesqtqvlmsllfwvsgtcgdivmtqspssltvtagekvtmsckssqsll nsgnqknyltwyqqkpgqppklliywastresgvpdrftgsgsgtdfslt issvqaedlaiyycqndysypftfgsgtkleik
Example 14
Construction of pConG1fBetV1: A Vector for the Production of the Heavy Chain of Betv1-1 gG1
[0194] The V.sub.H coding region of mouse anti-BetV1 antibody was amplified by PCR from a plasmid containing this region (example 13) using the primers VHexbetv1for and VHexbetv1rev, Introducing suitable restriction sites for cloning into pConG1f0.4 and an ideal Kozak sequence. The VH fragment was gel purified and cloned into pConG1f0.4. For this the PCR product and the pConKappa0.4 vector were digested with HindIII and ApaI and purified. The V.sub.H fragment and the pConG1f0.4HindIII-ApaI digested vector were ligated and transformed into competent DH5-T1.sup.R cells. A clone was selected containing the correct insert size and the correct sequence was confirmed. This plasmid was named pConG1fBetv1.
Example 15
Construction of pConKBetv1: A Vector for the Production of the Light Chain of Betv1
[0195] The V.sub.L coding region mouse anti-BetV1 antibody was amplified from a plasmid containing this region (example 13) using the primers VLexbetv1for and VLexbetv1rev, Introducing suitable restriction sites for cloning into pConK0.4 and an ideal Kozak sequence. The PCR product and the pConKappa0.4 vector were digested with HindIII and BsiWI and purified. The V.sub.L fragment and the pConKappa0.4HindIII-BsiWI digested vector were ligated and transformed into competent DH5 T1.sup.R E. coli. A clone was selected containing the correct insert size and the sequence was confirmed. This plasmid was named pConKBetv1.
Example 16
Construction of pTomG4Betv1: A Vector for the Production of the Heavy Chain of Betv1-IgG4
[0196] To construct a vector for expression of Betv1-IgG4, the VH region of BetV1 was cloned in pTomG4. For this, pTomG4 and pConG1fBetv1 were digested with HindIII and ApaI and the relevant fragments were isolated. The Betv1 V.sub.H fragment and the pTomG4HindIII-ApaI digested vector were ligated and transformed into competent DH5-T1.sup.R cells. A clone was selected containing the correct insert size and the sequence was confirmed. This plasmid was named pTomG4Betv1.
Example 17
Construction of pConG1Feld1: A Vector for the Production of the Heavy Chain of Feld1-IgG1
[0197] The V.sub.H coding region of mouse anti-Feld1 antibody was amplified by PCR from a plasmid containing this region (example 13) using the primers VHexfeld1for and VHexfeld1rev, Introducing suitable restriction sites for cloning into pConG1f0.4 and an ideal Kozak sequence. The VH fragment was gel purified and cloned into pConG1f0.4. For this the PCR product and the pConKappa0.4 vector were digested with HindIII and ApaI and purified. The V.sub.H fragment and the pConG1f0.4HindII-ApaI digested vector were ligated and transformed into competent DH5-T1.sup.R cells. A clone was selected containing the correct insert size and the correct sequence was confirmed. This plasmid was named pConG1fFeld1.
Example 18
Construction of pConKFeld1: A Vector for the Production of the Light Chain of Feld1
[0198] The V.sub.L coding region mouse anti-Feld1 antibody was amplified from a plasmid containing this region (example 13) using the primers VLexfeld1for and VLexfeld1rev, introducing suitable restriction sites for cloning into pConK0.4 and an ideal Kozak sequence. The PCR product and the pConKappa0.4 vector were digested with HindIII and BsiWI and purified. The V.sub.1 fragment and the pConKappa0.4HindIII-BsiWI digested vector were ligated and transformed into competent DH5a T1.sup.R E. coli. A clone was selected containing the correct insert size and the sequence was confirmed. This plasmid was named pConKFeld1.
Example 19
Construction of pTomG4Feld1: A Vector for the Production of the Heavy Chain of Feld1-IgG4
[0199] To construct a vector for expression of Feld1-IgG4, the VH region of Feld1 was cloned in pTomG4. For this, pTomG4 and pConG1f Feld1 were digested with HindIII and ApaI and the relevant fragments were isolated. The Feld1 V.sub.H fragment and the pTomG4HindIII-ApaI digested vector were ligated and transformed into competent DH5-T1.sup.R cells. A clone was selected containing the correct insert size and the sequence was confirmed. This plasmid was named pTomG4Feld1.
Example 20
Construction of Antibody Expression Vectors for the Expression of 2F8-IgG4 and 7D8-IgG4
[0200] Expression vectors for the expression of HuMab 2F8 (IgG1-EGFR) and HuMab 7D8 (IgG1-CD20) were constructed. The VH and VL coding regions of HuMab 2F8 (WO 02/100348) and HuMab 7D8 (WO 04/035607) were cloned in the expression vector pConG1f (Lonza Biologics) for the production of the IgG1 heavy chain and pConKappa for the production of the kappa light chain, yielding the vectors pConG1f2F8, pConG1f7D8, pConKappa2F8 and pConKappa7D8. The VH regions of pConG1f2F8 and pConG1f7D8 were removed from these vectors by a HindIII/ApaI digestion and inserted into a HindIII/ApaI digested pTomG4 vector, resulting in pTomG42F8 and pTomG47D8 respectively.
Example 21
Production of Betv1-IgG1, Betv1-IgG4, Feld1-IgG1 and Feld1-IgG4 by Transient Expression in HEK-293F Cells
[0201] Antibodies were produced from all constructs by cotransfecting the relevant heavy and light chain vectors in HEK-293F cells using 293fectin according to the manufacturer's instructions. For Betv1-IgG1, pConG1Betv1 and pConKBetv1 were coexpressed. For Betv1-IgG4, pTomG4Betv1 and pConKBetv1 were coexpressed. For Feld1-IgG1, pConG1Feld1 and pConKFeld1 were coexpressed. For Feld1-IgG4, pTomG4Feld1 and pConKFeld1 were coexpressed. For IgG1-EGFr, pConG1f2F8 and pConKappa2F8 were coexpressed. For IgG4-EGFr, pTomG42F8 and pConKappa2F8 were coexpressed. For IgG1-CD20, pConG1f7D8 and pConKappa7D8 were coexpressed. For IgG4-CD20, pTomG47D8 and pConkappa7D8 were coexpressed.
Example 22
Purification of IgG1 and IgG4 Antibodies
[0202] IgG1 and IgG4 antibodies were purified by protein A affinity chromatography. The cell culture supernatants were filtered over a 0.20 M dead-end filter, followed by loading on a 5 ml Protein A column (rProtein A FF, GE Healthvcare) and elution of the IgG with 0.1 M citric acid-NaOH, pH 3. The eluate was immediately neutralized with 2 M Tris-HCl, pH 9 and dialyzed overnight to 12.6 mM sodium phosphate, 140 mM NaCl, pH 7.4 (B. Braun, Oss, The Netherlands). After dialysis, samples were sterile filtered over a 0.20 M dead-end filter. Concentration of the purified IgGs was determined by nephelometry and absorbance at 280 nm. Purified proteins were analyzed by SDS-PAGE, IEF, Mass spectrometry and Glycoanalysis.
Example 23
SDS-PAGE Analysis of Purified IgGs
[0203] After purification, the Betv1 and Feld1, IgG1 and IgG4 antibodies were analyzed on non-reducing SDS-PAGE. The Bis-Tris electrophoresis method used is a modification of the Laemmli method (Laemmli 1970Nature 227(5259): 680-5), where the samples were run at neutral pH. The SDS-PAGE gels were stained with Coomassie and digitally imaged using the GeneGenius (Synoptics, Cambridge, UK).
[0204] As can be seen in
Example 24
Evaluation of IgG4 Fab Arm Exchange in Mice
[0205] Five nu/nu Balb/c mice 6-8 weeks of age were used to follow the exchange of IgG4 half molecules. The mice were housed in a barrier unit of the Central Laboratory Animal Facility (Utrecht, The Netherlands) and kept in filter-top cages with water and food provided ad libitum. All experiments were approved by the Utrecht University animal ethics committee.
[0206] Chimeric antibodies were administered intraperitoneally. Blood samples (75-100 l) were drawn at 4.25 hours, 24 hours, 48 hours and 72 hours after administration. Blood was collected in heparin-containing vials and centrifuged for 5 minutes at 10.000 g to separate plasma from cells. Plasma was stored at 20 C. for determination of antigen specific antibody and bispecific antibody levels.
[0207] In this experiment the exchange of chimeric IgG4 half molecules (n=2) was compared with the exchange of IgG1 half molecules (n=3). Mixtures of Bet v 1 and Fel d 1 specific antibodies (IgG1 or IgG4) were administered to the mice at a dose of 600 g (300 g of each antigen specific antibody) in 200 l per mouse.
[0208] Plasma concentrations of Bet v 1 or Fel d 1 binding antibodies were measured in the antigen binding test. To this end, plasma samples were incubated with 0.75 mg of protein G Sepharose (Amersham Biosciences, Uppsala, Sweden) In 750 l PBS-IAT (PBS supplemented with 1 g/ml IVIg, 0.3% bovine serum albumin, 0.1% Tween-20 and 0.05% (w/v) NaN.sub.3) in the presence of .sup.125I-labeled Bet v 1 or .sup.125I-labeled Fel d 1 for 24 h. Next, the Sepharose was washed with PBS-T (PBS supplemented with 0.1% Tween-20 and 0.05% (w/v) NaN.sub.3) and the amount of radioactivity bound relative to the amount of radioactivity added was measured. The concentration of Bet v 1 or Fel d 1 specific IgG was calculated using purified Bet v 1 specific antibodies or Fel d 1 specific antibodies as a standard (range 0-200 ng per test as determined by nephelometer). The concentration of bispecific IgG was measured in two variants of the heterologous cross-linking assay. In the first assay, plasma was incubated for 24 h with Sepharose-coupled Bet v 1 (0.5 mg) in a total volume of 300 l in PBS-IAT. Subsequently, the Sepharose was washed with PBS-T and Incubated for 24 h with .sup.125I-labeled Fel d 1, after which the Sepharose was washed with PBS-T and the amount of radioactivity bound relative to the amount of radioactivity added was measured. The concentration of bispecific IgG (Bet v 1-Fel d 1) was calculated using the calibration curve of the Fel d 1 binding test, which was obtained from purified Fel d 1 binding rIgG. In the second assay Fel d 1-Bet v 1 cross-linking activity was measured in a similar procedure using Sepharose-coupled rFel d 1 (0.5 mg) and .sup.125I-labeled Bet v 1. The concentration of bispecific IgG (Fel d 1-Bet v 1) was calculated using purified Bet v 1 specific rIgG as a standard (same curve as in Bet v 1 binding test).
[0209] In
[0210] In
[0211] In another experiment (
[0212] Size-exclusion chromatography was performed to exclude the possibility that bispecific activity observed in the mice dosed with IgG4 was the result of IgG aggregation (
Example 25
Evaluation of Fab Arm Exchange Activity by Whole Blood (Components)
[0213] Chimeric antibodies were mixed and subsequently incubated with whole blood, blood cells, plasma or serum to investigate the exchange activity of whole blood (components).
[0214] In this experiment the exchange of IgG4 half molecules was evaluated in whole blood from two healthy blood donors, A and B, in which the endogenous plasma level of IgG4 was determined by nephelometry (being 346 and 554 g/ml, respectively). Whole blood was obtained in vacutainers supplemented with TFPI (Tissue Factor Pathway Inhibitor from Chiron Corporation, Emeryville, Calif.) in a final concentration of 40 g/ml. Blood cells and plasma were obtained by centrifugation of whole blood. The cellular fraction was washed 3 times with Optimem (Invitrogen, Breda, The Netherlands) and subsequently resuspended in Optimem. Serum was obtained by incubating whole blood in a glass vacutainer with clot activator for 30 min at 37 C., after which the clotted blood was spinned down. The exchange of IgG4 half molecules was evaluated and compared to the exchange of IgG1 half molecules. As a control the blood samples were also incubated in the absence of chimeric antibodies. The following antibodies mixtures were prepared in PBS:
[0215] 1. Bet v 1 specific IgG4 (10 g) and Fel d 1 specific IgG4 (10 g)
[0216] 2. Bet v 1 specific IgG1 (10 g) and Fel d 1 specific IgG1 (10 g)
[0217] These antibody mixtures were incubated with blood, blood cells, plasma or serum in a total volume of 100 l (final concentration for each antibody was 0.1 g/ml) on a horizontal orbital shaker (125 rpm) at 37 C. Final hematocrit in the incubation mixtures with whole blood and blood cells was around 40%. After 24 h the incubation mixtures were centrifuged for 1 min at 2800 rpm in an Eppendorf centrifuge, after which a sample of 10 l was drawn in 500 l PBS-AT (PBS supplemented with 0.3% bovine serum albumin, 0.1% Tween-20 and 0.05% (w/v) NaN.sub.3). Samples were stored, if necessary, at 4 C.
[0218] Bispecific activity (i.e. Fel d 1-Bet v 1 cross-linking activity) was measured in the heterologous cross-linking assay. In this assay, a sample was incubated for 24 h with 0.5 mg Sepharose-coupled recombinant Fel d 1 In a total volume of 300 l in PBS-IAT (PBS-AT supplemented with 1 g/ml IVIg). Subsequently, the Sepharose was washed with PBS-T and incubated for 24 h with .sup.125I-labeled Bet v 1, after which the Sepharose was washed with PBS-T and the amount of radioactivity bound relative to the amount of radioactivity added was measured.
[0219] In
Example 26
Evaluation of Blood Cell Mediated IgG4 Fab Arm Exchange Activity
[0220] Chimeric antibodies were mixed and subsequently incubated with three different types of human blood cells (i.e. mononuclear cells (MNC), erythrocytes and platelets) to investigate IgG4 exchange activity.
[0221] Whole blood from an anonymous donor was drawn in a heparin containing vacutainer and subsequently centrifuged in Percoll (Pharmacia Fine Chemicals, Uppsala, Sweden) to isolate MNCs. The isolated MNCs were resuspended in Optimem serum free culture medium (Invitrogen, Breda, The Netherlands) before use. Freshly purified erythrocytes and platelets (provided by the Blood Cell Research Department of Sanquin) were obtained from two different anonymous donors. These cells were also resuspended in Optimem after being washed 3 times. In addition, platelets were supplemented with 10 mM glucose.
[0222] The exchange of IgG4 half molecules was evaluated and compared to the exchange of IgG1 half molecules. The following antibodies mixtures were prepared in PBS: [0223] Bet v 1 specific IgG4 (10 g) and Fel d 1 specific IgG4 (10 g) [0224] Bet v 1 specific IgG1 (10 g) and Fel d 1 specific IgG1 (10 g)
[0225] These antibody mixtures were incubated with 1.810.sup.4 MNCs, 4.010.sup.8 erythrocytes or 3.510.sup.4 platelets in a total volume of 100 l (final concentration for each antibody was 0.1 g/ml) on a horizontal orbital shaker (125 rpm) at 37 C. After 48 h the incubation mixtures were centrifuged for 1 min at 2800 rpm in an Eppendorf centrifuge, after which a sample of 10 l was drawn in 500 l PBS-AT (PBS supplemented with 0.3% bovine serum albumin, 0.1% Tween-20 and 0.05% (w/v) NaN.sub.3). Samples were stored, if necessary, at 4 C.
[0226] Bispecific activity (i.e. Fel d 1-Bet v 1 cross-linking activity) was measured in the heterologous cross-linking assay. In this assay, a sample was incubated for 24 h with 0.5 mg Sepharose-coupled recombinant Fel d 1 in a total volume of 300 l in PBS-IAT (PBS-AT supplemented with 1 g/ml IVIg). Subsequently, the Sepharose was washed with PBS-T and incubated for 24 h with 125I-labeled Bet v 1, after which the Sepharose was washed with PBS-T and the amount of radioactivity bound relative to the amount of radioactivity added was measured.
[0227] In
Example 27
Evaluation of IgG4 Fab Arm Exchange by Human and Murine Cell Lines
[0228] Chimeric IgG4 antibodies were mixed and subsequently incubated with three different cell lines (i.e. Human Embryo Kidney (HEK) cells, murine B cells or hybridomas) to investigate IgG4 exchange activity.
[0229] Cell line 3558 (provided by the Antigen Presentation Research Group of Sanquin) was chosen as a source of murine B cells. Hybridomas, which produce an anti-C1 esterase inhibitor, were obtained from the Autoimmune Research Group of Sanquin. Suspension HEK (293F) cells were from Invitrogen, Breda, The Netherlands. All cells were washed three times with PBS, after which the cells were resuspended in PBS.
[0230] The exchange of IgG4 half molecules was evaluated by incubating an IgG4 antibody mixture consisting of Bet v 1 specific IgG4 (2 lag) and Fel d 1 specific IgG4 (2 g) with the aforementioned cells. The antibody mixture was incubated with 2410.sup.5 HEK cells, 2510.sup.5 murine B cells or 2110.sup.5 hybridomas in a total volume of 50 l (final concentration for each antibody was 80 g/ml) on a horizontal orbital shaker (125 rpm) at 37 C. After 0 h and 24 h the incubation mixtures were centrifuged for 1 min at 2800 rpm in an Eppendorf centrifuge, after which a sample was drawn in PBS-AT (PBS supplemented with 0.3% bovine serum albumin, 0.1% Tween-20 and 0.05% (w/v) NaN.sub.3). Samples were stored, if necessary, at 4 C.
[0231] Bispecific activity (i.e. Fel d 1-Bet v 1 cross-linking activity) was measured in the heterologous cross-linking assay. In this assay, sample dilutions were incubated for 24 h with 0.5 mg Sepharose-coupled recombinant Fel d 1 in a total volume of 300 l in PBS-IAT (PBS-AT supplemented with 1 g/ml IVIg). Subsequently, the Sepharose was washed with PBS-T and incubated for 24 h with .sup.125I-labeled Bet v 1, after which the Sepharose was washed with PBS-T and the amount of radioactivity bound relative to the amount of radioactivity added was measured.
[0232] In
Example 28
Evaluation of IgG4 Fab Arm Exchange by Erythrocytes
[0233] Chimeric antibodies were mixed and subsequently incubated with human erythrocytes to investigate the exchange of IgG4 half molecules. Erythrocytes were purified from a single donor and stored at 4 C. in SAGM (Saline Adenine Glucose Mannitol) buffer. Before use the cells were washed three times with PBS.
[0234] In this experiment the exchange of IgG4 half molecules was compared with the exchange of IgG1. Also, the exchange of IgG4 in the presence of excess irrelevant IgG4 was evaluated. The following antibodies mixtures were prepared in PBS: [0235] Bet v 1 specific IgG4 (4 g) and Fel d 1 specific IgG4 (4 g) [0236] Bet v 1 specific IgG1 (4 g) and Fel d 1 specific IgG1 (4 g) [0237] Bet v 1 specific IgG4 (4 g), Fel d 1 specific IgG4 (4 g) and irrelevant IgG4 specific for antigen X (80 g)
[0238] These mixtures were incubated with erythrocytes in PBS supplemented with 0.05% (w/v) NaN.sub.3 in a total volume of 100 l (final hematocrit was around 40%) and subsequently incubated on a horizontal orbital shaker (125 rpm) at 37 C. At indicated time points the erythrocytes were centrifuged for 1 min at 2800 rpm in an Eppendorf centrifuge, after which a sample of 10 l was drawn in 500 l PBS-AT (PBS supplemented with 0.3% bovine serum albumin, 0.1% Tween-20 and 0.05% (w/v) NaN.sub.3). Samples were stored at 4 C. before measuring bispecific activity, bivalency and antigen binding. As a control the same mixtures were also incubated in PBS without erythrocytes.
[0239] Levels of Bet v 1 binding antibodies were measured in the antigen binding test. To this end, samples were incubated with 0.75 mg of protein G Sepharose (Amersham Biosciences, Uppsala, Sweden) in 750 l PBS-IAT (PBS-AT supplemented with 1 g/ml IVIg) in the presence of .sup.125I-labeled Bet v 1 for 24 h. Next, the Sepharose was washed with PBS-T (PBS supplemented with 0.1% Tween-20 and 0.05% (w/v) NaN.sub.3) and the amount of radioactivity bound relative to the amount of radioactivity added was measured. The concentration of Bet v 1 specific IgG was calculated using purified Bet v 1 specific antibodies as a standard (range 0-200 ng per test as determined by nephelometer). Bispecific activity in experiments using Fel d 1 and Bet v 1 specific antibodies was measured in the Feld1-Betv1 cross-linking assay. In this assay, IgG containing sample was incubated for 24 h with Sepharose-coupled cat extract (0.5 mg) in a total volume of 300 l in PBS-AT. Subsequently, the Sepharose was washed with PBS-T and incubated for 24 h with .sup.125I-labeled Bet v 1, after which the Sepharose was washed with PBS-T and the amount of radioactivity bound relative to the amount of radioactivity added was measured. The concentration of bispecific IgG (Feld1-Betv1) was calculated using purified IgG1-Betv1 as a standard (obtained in Bet v 1 binding test using Prot G sepharose).
[0240] In
[0241] In theory, the exchange of IgG4 half molecules is also associated with a decrease in bivalency. To test this, bivalency in the incubation mixtures was measured. Almost no reduction of Fel d 1 bivalency was observed in the IgG1 mix, whereas a reduction of 50% was observed in the IgG4 mix. This reduction is in agreement with the maximal exchange of two different IgG4 molecules mixed in a 1 to 1 ratio. As expected, the reduction of bivalency in the IgG4 mix with excess irrelevant IgG4 was higher (80%), which is due to the low probability of rehybridization of two homologous half molecules (Bet v 1 or Fel dl specific) in the presence of excess irrelevant IgG4 half molecules. The strong reduction in bivalency was not the result of loss of antigen binding during the incubation, because the antigen binding was only slightly (10%) decreased after 72 h of incubation (data not shown).
[0242] The exchange of IgG in PBS (supplemented with 0.05% (w/v) NaN.sub.3) was also evaluated to investigate whether IgG4 half molecules can be exchanged spontaneously. The set-up of this experiment was similar to the exchange in the presence of erythrocytes with the exception that no erythrocytes were added. No spontaneous exchange of IgG1 or IgG4 half molecules was observed during the incubation in PBS at 37 C. as is demonstrated
Example 29
Evaluation of IgG4 Fab Arm Exchange by Erythrocyte Lysate
[0243] Chimeric IgG4 antibodies were mixed and subsequently incubated with increasing dilutions of erythrocyte lysate. Erythrocytes were isolated from a healthy donor and stored at 4 C. in SAGM (Saline Adenine Glucose Mannitol) buffer with a hematocrit of 60.7%. To obtain lysate the cells were washed three times with PBS-Azide (PBS supplemented with 0.05% (w/v) NaN.sub.3) and resuspended in water with a volume that was two fold higher than the volume of the storage buffer. As a result, undiluted erythrocyte lysate was equivalent to a hematocrit of 30%.
[0244] The exchange of IgG4 half molecules was evaluated by incubating an IgG4 antibody mixture consisting of Bet v 1 specific IgG4 (1 g) and Fel d 1 specific IgG4 (1 g) with 50 l of freshly prepared lysate (supplemented with PBS/Azide to a total volume of 100 l) at 37 C. Final concentration of each antibody was 10 g/ml. At indicated time points a sample was drawn from the incubation mix in PBS-AT (PBS supplemented with 0.3% bovine serum albumin, 0.1% Tween-20 and 0.05% (w/v) NaN.sub.3) to measure bispecific activity. Samples were stored, if necessary, at 4 C.
[0245] Bispecific activity (i.e. Bet v 1-Fel d 1 cross-linking activity) was measured in the heterologous cross-linking assay. In this assay, sample dilutions were incubated for 24 h with 0.5 mg Sepharose-coupled birch extract in a total volume of 300 l in PBS-IAT (PBS-AT supplemented with 1 g/ml IVIg). Subsequently, the Sepharose was washed with PBS-T and incubated for 24 h with .sup.125I-labeled Fel d 1, after which the Sepharose was washed with PBS-T and the amount of radioactivity bound relative to the amount of radioactivity added was measured. The concentration of bispecific IgG (Bet v 1-Fel d 1) was calculated using the calibration curve of the Fel d 1 binding test, which was obtained from purified Fel d 1 binding rIgG.
[0246] In
[0247] Size-exclusion chromatography was performed to exclude the possibility that bispecific activity induced by erythrocyte lysate was the result of IgG aggregation (
[0248] Bet v 1 binding antibodies eluted in one peak with a retention volume of 12.6 ml, which corresponds to the retention volume of monomeric IgG (
Example 30
Evaluation of IgG4 Fab Arm Exchange Activity in Dialyzed Erythrocyte Lysate
[0249] Erythrocytes were isolated from a healthy donor and stored at 4 C. in SAGM (Saline Adenine Glucose Mannitol) buffer with a hematocrit of 60.7%. To obtain lysate the cells were washed three times with PBS-Azide (PBS supplemented with 0.05% (w/v) NaN.sub.3) and resuspended in water with a volume that was two-fold higher than the volume of the storage buffer. Therefore, undiluted erythrocyte lysate was equivalent to a hematocrit of 30%. Part of the lysate was dialyzed against PBS-Azide using a dialysis membrane cassette from Pierce (3.5 kD cut-off). Ultrafiltrate was obtained by centrifugation of non-dialyzed lysate in an Amicon filter (3.5 kD cut-off).
[0250] The exchange of IgG4 half molecules was evaluated by incubating an IgG4 antibody mixture (Bet v 1 specific IgG4 (0.5 g) and Fel d 1 specific IgG4 (0.5 g) with freshly prepared erythrocyte lysate (25 l) or dialyzed lysate (25 l) at 37 C. Total volume of each incubation was 50 l resulting in a final concentration of 10 g/ml for each antibody. The following supplements were used: reduced glutathione (GSH) from Sigma, Glucose-6-phosphate (G-6-P) and NADPH (both from Roche). These compounds were dissolved in water before use. After 24 h of incubation a sample was drawn from the incubation mix in PBS-AT (PBS supplemented with 0.3% bovine serum albumin, 0.1% Tween-20 and 0.05% (w/v) NaN.sub.3) to measure bispecific activity. Samples were stored, if necessary, at 4 C.
[0251] Bispecific activity (i.e. Fel d 1-Bet v 1 cross-linking activity) was measured in the heterologous cross-linking assay. In this assay, sample dilutions were incubated for 24 h with 0.5 mg Sepharose-coupled cat extract in a total volume of 300 l in PBS-IAT (PBS-AT supplemented with 1 g/ml IVIg). Subsequently, the Sepharose was washed with PBS-T and incubated for 24 h with .sup.125I-labeled Bet v 1, after which the Sepharose was washed with PBS-T and the amount of radioactivity bound relative to the amount of radioactivity added was measured.
[0252] The exchange levels were compared with the bispecific activity generated by freshly prepared lysate (Table 2).
TABLE-US-00003 TABLE 2 Overview of factors that restore bispecific activity in dialyzed erythrocyte lists. Exchange activity of dialyzed erythrocyte lysate was compared with freshly prepared lysate. Dialyzed lysate was supplemented with 5 l of ultrafiltrate. Final concentrations of G-6-P, NADPH and GSH were 5 mM, 0.1 mM and 0.5 mM, respectively. Exchange source Supplement Exchange activity Lysate ++ Dialyzed lysate Dialyzed lysate Ultrafiltrate + Dialyzed lysate G-6-P, NADPH, GSH ++ Dialyzed lysate G-6-P Dialyzed lysate NADPH Dialyzed lysate GSH ++
[0253] From these data it is evident that the activity of erythrocyte lysate was lost after dialysis. Addition of ultrafiltrate restored the exchange for a large part. This result suggested that during dialysis a component (<3.5 kD) was lost, which is essential for the exchange reaction. Such a component is likely to be involved in the redox cycle, because disulfide bridge reduction and oxidation is required for the exchange of IgG4 half molecules. Therefore, three co-factors (G-6-P, NADPH and GSH) of the redox cycle were added to dialyzed lysate to investigate whether these compounds could restore the exchange activity. The exchange activity could be restored if G-6-P, NADPH and GSH were supplemented together. Incubation of dialyzed lysate in the presence of separate factors revealed that the exchange activity was restored by GSH, but not by G-6-P or NADPH.
Example 31
Evaluation of IgG4 Half Molecule Exchange by Reduced Glutathione
[0254] Chimeric antibodies were mixed and subsequently incubated with reduced glutathione (GSH) to investigate the exchange of IgG4 half molecules. GSH (Sigma-Aldrich, St. Louis, Mo.) was solved in water before use.
[0255] In this experiment the exchange of IgG4 half molecules was evaluated by incubating an IgG4 antibody mixture consisting of Bet v 1 specific IgG4 (1 g) and Fel d 1 specific IgG4 (1 g) in PBS/Azide containing GSH at 37 C. Total incubation volume was 100 l resulting in a final concentration of 10 g/ml for each antibody. At indicated time points a sample was drawn from the incubation mixture in PBS-AT (PBS supplemented with 0.3% bovine serum albumin, 0.1% Tween-20 and 0.05% (w/v) NaN.sub.3). Samples were stored at 4 C. for measuring of antigen binding and bispecific activity
[0256] Levels of Bet v 1 binding antibodies were measured in the antigen binding test. Samples were incubated with 0.75 mg of protein G Sepharose (Amersham Biosciences, Uppsala, Sweden) In 750 l PBS-IAT (PBS-AT supplemented with 1 g/ml IVIg) in the presence of .sup.125I-labeled Bet v 1 for 24 h. Next, the Sepharose was washed with PBS-T (PBS supplemented with 0.1% Tween-20 and 0.05% (w/v) NaN.sub.3) and the amount of radioactivity bound relative to the amount of radioactivity added was measured. The concentration of Bet v 1 specific IgG was calculated using purified Bet v 1 specific antibodies as a standard (range 0-200 ng per test as determined by nephelometer). The concentration of bispecific IgG (i.e. Fel d 1-Bet v 1 cross-linking activity) was measured in the heterologous cross-linking assay. In this assay, a sample was incubated for 24 h with 0.5 mg Sepharose-coupled cat extract, in which Fel d 1 antigen is present, in a total volume of 300 l in PBS-IAT. Subsequently, the Sepharose was washed with PBS-T and incubated for 24 h with .sup.125I-labeled Bet v 1, after which the Sepharose was washed with PBS-T and the amount of radioactivity bound relative to the amount of radioactivity added was measured. The concentration of bispecific IgG (Fel d 1-Bet v 1) was calculated using the same calibration curve as used in the Bet v 1 binding test, which was obtained from purified Bet v 1 binding IgG.
[0257] In
[0258] Size-exclusion chromatography was performed to exclude the possibility that bispecific activity observed after GSH mediated exchange of IgG4 was the result of IgG aggregation (
Example 32
Generation of Bispecific IgG in the Presence of Other Agents
[0259] IgG1-Betv1 and IgG1-Feld1 or IgG4-Betv1 and IgG4-Feld1 were mixed at a final concentration of 10 g/ml for antibody and incubated with reducing agents in a total volume of 50 l. Apart from GSH the following agents were tested (final concentration in incubation mixture): L-cysteine was from Sigma (100 M), dithlothreitol (DTT) was from Biorad (50 M), B-mercapto-ethanol (BME) was from Biorad (100 M) and oxidized glutathione (GSSG, note that of the panel of agents this agent is not reducing, while all others are) was from Sigma (100 M). The mixtures were incubated at 37 C. for 24 h and samples were drawn in PBS/AT, in which the (bi)specific IgG concentrations were measured.
Example 33
Exchange of Fully Human IgG4 Antibodies Using GSH
[0260] IgG1-CD20, IgG4-CD20, IgG1-EGFr and IgG4-EGFr were mixed and incubated with GSH In a total volume of 1 mi. Final concentration of each antibody was 50 g/ml; the final concentration of GSH was 0.5 mM. The mixtures were incubated at 37 C. for 24 h and samples were drawn in PBS-AT, in which the (bi)specific IgG concentrations were measured.
[0261] Bispecific activity was determined using a sandwich ELISA. For this assay an ELISA plate (Greiner bio-one, Frickenhausen, Germany) was coated overnight with 1 g/ml (100 l/well) of recombinant extracellular domain of EGFR in PBS at 4 C. The plate was washed 3 times with PBS/0.05% Tween 20 (PBT). Samples were diluted in PBT/0.2% BSA (PBTB) and transferred to the ELISA plate (100 l/well). After incubation on a plate shaker (300 rpm) for 90 minutes at room temperature (RT), samples were discarded and the plate was washed 3 times with PBT. Next, 100 l of the mouse anti-idiotypic monoclonal antibody 2F2 SAB1.1 (directed against the anti-CD20 antibody 7D8; Genmab) at 2 g/ml in PBTB was added and incubated at RT for 90 minutes at a plate shaker (300 rpm). The anti-idiotypic antibody was discarded and the plate was washed 3 times with PBT, followed by the addition of 100 l/well of a HRP conjugated goat anti-mouse IgG (Jackson ImmunoResearch Laboratories, Westgrove, Pa., USA) at a 1000dilution in PBTB and incubation at RT for 90 minutes at a plate shaker (300 rpm). The detection antibody was discarded and the plate was washed 3 times with PBT. A 50 mg ABTS tablet (Roche Diagnostics GmbH, Mannheim, Germany) was dissolved in ABTS buffer (Roche) and added to the ELISA plate (100 l/well). The ELISA plate was incubated for 30 min (or longer if desired) at RT on a plate shaker (300 rpm) covered with aluminum foil and the reaction was stopped with 100 l oxalic acid (Riedel de Haen Seeize, Germany) per well. The ELISA plate was left at RT for 10 minutes before reading absorbance at 405 nm in an ELISA plate reader.
[0262]
[0263] To explore the dynamic range of GSH mediated exchange of IgG4 half molecules, a full concentration curve of GSH (0.5-1,000 M) was used to analyze exchange. IgG4-CD20 and IgG4-EGFr were mixed and incubated with GSH in a total volume of 1 ml. Final concentration of each antibody was 50 g/ml; the final concentration of GSH were as indicated in
[0264]
[0265] A mixture of IgG4-EGFr and IgG4-CD20 was incubated for 24 h in the absence or presence of GSH and evaluated by mass spectrometry (ESI-TOF MS). Fifty l samples containing 200 g/ml of each antibody were deglycosylated overnight with 1 l N-glycosidase F (Roche Diagnostics NL BV, Almere, The Netherlands). Samples were desalted on an Acquity UPLC (Waters, Milford, USA) with a BEH C8, 1.7 m, 2.150 mm column at 60 C. Five l was injected and eluted with a gradient from 5% to 95% eluent B. Eluent A was MilliQ water (Millipore Synthesis A10 apparatus) and eluent B was LC-MS grade acetonitrile (Biosolve, Valkenswaard, The Netherlands). Both eluents contained 0.05% formic acid as organic modifier (Fluka Riedel-de Han, Buchs, Germany). Time-of-flight electrospray ionization mass spectra were recorded on-line on a micrOTOF mass spectrometer (Bruker, Bremen, Germany) operating in the positive ion mode. In each analysis, a 500-5000 m/z scale was internally calibrated with ES tuning mix (Agilent Technologies, Santa Clara, USA). Mass spectra were deconvoluted by using the Maximum Entropy algorithm, which is provided with DataAnalysis software v. 3.3 (Bruker).
[0266]
Example 34
Rhesus Monkey IVIg Participates in Fab Arm Exchange of Recombinant Human IgG4 Antibodies
[0267] Mixtures of two recombinant human IgG4 antibodies (IgG4-CD20 and IgG4-EGFr, as described above) were incubated with GSH for 24 h at 37 C., in the presence or absence of rhesus monkey or human IVIg. The formation of bispecific antibodies through Fab arm exchange was measured in a sandwich ELISA as described above.
[0268]
Example 35
Fab Arm Exchange of Hinge Region or CH3 Domain Mutants
[0269] Three IgG1 mutants were made: an IgG1 with an IgG4 core-hinge (IgG1-CPSC) and two CH3 domain swap mutants (IgG1-CH3(IgG4) and IgG1-CPSC-CH3(IgG4).
[0270] Site directed mutagenesis was used to introduce a P228S mutation in the hinge of IgG1 using pEE-G1-wt a Bet v 1 as a template. Mutagenic primers, forward and reverse, were designed with Vector NTI Advance 10:
[0271] P228S Mut primer-F: SEQ ID NO:19: cttgtgacaa aactcacacc tgcccatcgt gcccaggtaa gccag
[0272] P228S Mut primer-R: SEQ ID NO:20: ctggcttacc tgggcacgat gggcaggtgt gagttttgtc acaag
[0273] Quickchange site-directed mutagenesis kit (Stratagene) was used to create the pEE-G1-CPSC mutant. The polymerase chain reaction (PCR) mix consisted of 5 l pEE-G1 a Betv1 DNA template (35 ng), 1.5 l mutagenic primer-forward (150 ng), 1.5 l mutagenic primer-reverse (150 ng), 1 l dNTP mix, 5 l reaction buffer (10), 36 l H2O and finally 1 l Pfu Turbo DNA polymerase. Then the mix was applied to the PCR: 30 95 C., 30 95 C. (denaturating), 1 55 C. (annealing) and 17 minutes 68 C. (elongating). This cycle was repeated 20 times.
[0274] DNA digesting and ligation was used to create CH3 domain swap mutant constructs IgG1-CH3(IgG4) and IgG1-CPSC-CH3(IgG4). Digestion reactions to obtain CH3 domains and vectors without CH3 domains were as follows: 1500 ng DNA (pEE-G1-betv1, pEE-G1-CPSC and pEE-G4-betv1), 2 l BSA, 2 l Neb3 buffer, 1 l SalI and H2O added to a volume of 20 l. Incubation at 37 C. for 30. DNA was purified and eluted with 30 l H.sub.2O before 1 l SanDI and 3 l universal buffer was added and incubated at 37 C. for 30. Fragments were subjected to gel electrophoresis on 1% agarose gels with ethidium bromide. Fragments were cut from the gel under ultraviolet light and dissolved using a DNA purification kit (Amersham). The pEE-G4-wt SalI/SanDI (which contained IgG4 CH3 domain) fragment was ligated into pEE-G1-wt and pEE-G1-CPSC using following procedure: 1 l template DNA (SalI/SanDI digested pEE-G1-wt and pEE-G1-CPSC), 5 l SalI/SanDI insert, 4 l Ligate-it buffer, 9 l H2O and 1 l ligase in a total volume of 20 l. Ligation was stopped after 5.
[0275] DNA digestion (using ApaI and HindIII) and ligation was used to replace the VH domain of the bet v 1 mutant antibodies with that of pEE-G4-a-feld1 wt, following a similar procedure as above.
[0276] Also, one IgG4 mutant was made: IgG4-S228Pnew. In this mutant, the hinge is stabilized by replacing serine at position 228 for a proline (IgG1 core hinge). Site-directed mutagenesis was performed using the QuickChange II XL Site-Directed Mutagenesis Kit (Stratagene, Amsterdam, The Netherlands) according to the manufacturer's instructions. This method included the introduction of a silent extra XmaI site to screen for successful mutagenesis. Briefly, 5 l 10reaction buffer, 1 l oligonudeotide S228Pfcorrect (100 pmol/l), 1 l oligonucleotide S228Prcorrect (100 pmol/l), 1 l dNTP mix, 3 l Quicksolution, 1 l plasmid pTomG42F8HG (50 ng/pi) (described in PCT application entitled Recombinant monovalent antibodies and methods for production thereof, filed on 28 Nov. 2006 (RO/DK (Genmab)) and 1 l PfuUltra HF DNA polymerase were mixed in a total volume of 50 l and amplified with a TGradient Thermocycler 96 (Whatman Biometra, Goettingen, Germany; product#050-801) using an 18-cycle program: denaturing at 95 C. for 1 min; 18 cycles of 95 C. for 50 sec, 60 C. for 50 sec, and 68 C. for 10 min. PCR mixtures were stored at 4 C. until further processing. Next, PCR mixtures were incubated with 1 l DpnI for 60 min at 37 C. to digest the pTomG42F8HG vector and stored at 4 C. until further processing. The reaction mixture was precipitated with 5 l 3 M NaAc and 125 l Ethanol, incubated for 20 minutes at 20 C. and spun down for 20 minutes at 4 C. at 14000g. The DNA pellet was washed with 70% ethanol, dried and dissolved in 4 l water. The total 4 l reaction volume was transformed in One Shot DNH5 T1.sup.R competent E. coli cells (Invitrogen, Breda, The Netherlands) according to the manufacturer's instructions (Invitrogen). Next, cells were plated on Luria-Bertani (LB) agar plates containing 50 g/ml ampicillin. Plates were incubated for 16-18 hours at 37 C. until bacterial colonies became evident.
[0277] After screening by colony PCR and XmaI (mutagenesis will result in the loss of a XmaI site) digestion, plasmid was isolated from the bacteria and the mutation was confirmed by DNA sequencing. To check if no unwanted extra mutations were introduced the whole HC coding region was sequenced and did not contain any additional mutations. The final construct was named pTomG42F8S228PNew.
TABLE-US-00004 Name OligonucleotideSequence S228Pfcorrect CCCCCATGCCCACCATGCCCAGGTAAGCCAACCC (SEQIDNO:21) AGGCCTCGC S228Prcorrect GCGAGGCCTGGGTTGGCTTACCTGGGCATGGTGG (SEQIDNO:22) GCATGGGGG
[0278] Recombinant antibodies from these constructs were transiently expressed in HEK 293 cells in 3 ml, 6-wells plates (NUNC) or in 125 ml erlenmeyers (Corning) with 293 Fectin (Invitrogen) as transfection reagent.
[0279] The following mixtures of unpurified antibodies (FreeStyle 293 expression medium, GIBCO/Invitrogen Corporation) were incubated with 0.1 mM GSH at 37 C. for 24 h and samples were drawn in PBS-AT, in which the (bi)specific IgG concentrations were measured as described in previous examples: [0280] IgG4 anti-feld1 wt with IgG4 anti-betv1 wt [0281] IgG1 anti-feld1 wt with IgG4 anti-betv1 wt [0282] IgG1 anti-feld1 CPSC with IgG1 atni-betv1 CPSC (Indicated as IgG1 CPSC-IgG1 CPSC below) [0283] IgG1 anti-feld1 CPSC with IgG1 anti-betv1 CH3(IgG4) (IgG1 CPSC-IgG1 CH3(IgG4)) [0284] IgG1 anti-feld1 CPSC with IgG1 anti-betv1 CPSC/CH3(IgG4) (IgG1 CPSC-IgG1 CPSC/CH3(IgG4)) [0285] IgG1 anti-feld1 CH3(IgG4) with IgG1 anti-betv1 CH3(IgG4) (IgG1 CH3(IgG4)-IgG1 CH3(IgG4)) [0286] IgG1 anti-feld1 CH3(IgG4) with IgG1 anti-betv1 CPSC/CH3(IgG4) (IgG1 CH3(IgG4)-IgG1 CPSC/CH3(IgG4)) [0287] IgG1 anti-feld1 CPSC/CH3(IgG4) with anti-betv1 IgG1 CPSC/CH3(IgG4) (IgG1 CPSC/CH3(IgG4)-IgG1 CPSC/CH3(IgG4)) [0288] IgG1 anti-feld1 CPSC/CH3(IgG4) with IgG4 a-ntibetv1 wt (IgG1 CPSC/CH3(IgG4)-IgG4 wt) [0289] IgG4 anti-bet1 S228Pnew with IgG4 wt
[0290] The results showed that under these in vitro conditions (0.1 mM GSH), half molecule exchange occurs when one of the antibodies contains the CPSC hinge and both antibodies contain an IgG4-like CH3. Also, half molecule exchange occurs between an IgG4 molecule containing an IgG1 hinge and IgG4 wt molecules:
TABLE-US-00005 IgG1 IgG1 IgG1 IgG1 CPSC/ wt IgG4 wt CH3(IgG4) CPSC CH3(IgG4) IgG1 wt IgG4 wt + + + IgG1 CH3(IgG4) + IgG1 CPSC IgG1 + + CPSC/CH3(IgG4) IgG4 S228Pnew + = no exchange + = exchange occurs = limited exchange (~5%) Blank square = not tested
[0291] The effect of GSH concentration on the half molecule exchange from the different mutants was tested using 0, 0.1, 1 and 10 mM GSH. Exchange was tested using the following mixtures: [0292] IgG4 a-feld1 wt with IgG4 a-betv1 wt [0293] IgG1 a-feld1 wt with IgG4 a-betv1 wt [0294] IgG1 a-feld1 CPSC with IgG1 a-betv1 CPSC [0295] IgG1 a-feld1 CH3(IgG4) with IgG1 a-betv1 CH3(IgG4) [0296] IgG1 a-feld1 CPSC/CH3(IgG4) with a-betv1 IgG1 CPSC/CH3(IgG4))
[0297] For GSH concentrations up to 1 mM, the results (
[0298] Size-exclusion chromatography was performed to exclude the possibility that bispecific activity observed after GSH mediated exchange of the appropriate IgG1 mutants was the result of IgG aggregation as described in previous examples. The heterologous Fel d 1-Bet v 1 cross-linking activity was detected in the fractions corresponding to the retention volume of monomeric IgG.
Example 36
Generation of IgG1 and IgG4 Antibodies with Hinge Region and/or CH3 Domain Mutations
[0299] Five IgG1 mutants were made: an IgG1 with an IgG4 core-hinge (IgG1-P228S), two CH3 domain swap mutants (IgG1-CH3(4) and IgG1-P228S-CH3(4)), one CH3 point mutant in which lysine present at position 409 of IgG1 (within the CH3 domain) is replaced for arginine (IgG1-K409R), and one IgG1 with an IgG4 core hinge and K409R mutation (IgG1-P228S-K409R) (
[0300] Two IgG4 mutants were made: one CH3 point mutant in which arginine present at position 409 of IgG4 (within the CH3 domain) is replaced for lysine (IgG4-R409K), and one CH3 swap mutant (IgG4-CH3(1)) (
[0301] Site directed mutagenesis was used to introduce a P228S mutation in the hinge of IgG1 using pEE-G1-wt a Bet v 1 as a template. Mutagenic primers, forward and reverse, were designed with Vector NTI Advance 10:
TABLE-US-00006 P228SMutprimer-F:SEQIDNO:23: cttgtgacaaaactcacacctgcccatcgtgcccaggtaagccag P228SMutprimer-R:SEQIDNO:24: ctggcttacctgggcacgatgggcaggtgtgagttttgtcacaag
[0302] Quickchange site-directed mutagenesis kit (Stratagene) was used to create the pEE-G1-CPSC mutant. The polymerase chain reaction (PCR) mix consisted of 5 l pEE-G1 a Betv1 DNA template (35 ng), 1.5 l mutagenic primer-forward (150 ng), 1.5 l mutagenic primer-reverse (150 ng), 1 l dNTP mix, 5 l reaction buffer (10), 36 l H2O and finally 1 l Pfu Turbo DNA polymerase. Then the mix was applied to the PCR: 30 95 C., 30 95 C. (denaturating), 1 55 C. (annealing) and 17 minutes 68 C. (elongating). This cycle was repeated 20 times.
[0303] DNA digesting and ligation was used to create CH3 domain swap mutant constructs IgG1-CH3(4) and IgG1-P228S-CH3(4). Digestion reactions to obtain CH3 domains and vectors without CH3 domains were as follows: N1500 ng DNA (pEE-G1-betv1, pEE-G1-CPSC and pEE-G4-betv1), 2 l BSA, 2 l Neb3 buffer, 1 l Sail and H.sub.2O added to a volume of 20 l. Incubation at 37 C. for 30. DNA was purified and eluted with 30 l H.sub.2O before 1 l SanDI and 3 l universal buffer was added and incubated at 37 C. for 30. Fragments were subjected to gel electrophoresis on 1% agarose gels with ethidium bromide. Fragments were cut from the gel under ultraviolet light and dissolved using a DNA purification kit (Amersham). The pEE-G4-wt SalI/SanDI (which contained IgG4 CH3 domain) fragment was ligated into pEE-G1-wt and pEE-G1-CPSC using following procedure: 1 l template DNA (SalI/SanDI digested pEE-G1-wt and pEE-G1-CPSC), 5 l SalI/SanDI insert, 4 l Ligate-it buffer, 9 l H2O and 1 l ligase in a total volume of 20 l. Ligation was stopped after 5.
[0304] DNA digestion (using ApaI and HindIII) and ligation was used to replace the VH domain of the bet v 1 mutant antibodies with that of pEE-G4-a-feld1 wt, following a similar procedure as above.
[0305] Site-directed mutagenesis was used to introduce point mutations (K409R or R409K) into the pEE-4 wt, pEE-1 and PEE-1-P228S constructs. Mutagenic primers, forward and reverse, were designed with Vector NTI Advance 10:
[0306] G1-K409R Mut-F: SEQ ID NO: 25
[0307] G1-K409R Mut-R: SEQ ID NO: 26
[0308] G4-R409K Mut-F: SEQ ID NO: 27
[0309] G4-R409K Mut-R: SEQ ID NO: 28
TABLE-US-00007 Mutagenic Restriction Primer Sequence5-3 Mutation site G1-K409RMut-F CCTTCTTCCTCTATAGCAGGCTCACCGTAGACAAGAGCAG Lys> Arg AccI GTGGC G1-K409RMut-R GCCACCTGCTCTTGTCTACGGTGAGCCTGCTATAGAGGAA Lys> Arg AccI GAAGG G4-R409KMut-F GGCTCCTTCTTCCTCTACAGCAAGCTAACCGTAGCACAAG Arg> Lys AccI AGCAGG G4-R409KMut-R CCTGCTCTTGTCTACGGTTAGCTTGCTGTAGAGGAAGAAG Arg> Lys AccI GAGCC
[0310] Site-directed mutagenesis was performed using the QuickChange II XL Site-Directed Mutagenesis Kit (Stratagene, Amsterdam, The Netherlands) according to the manufacturer's instructions, with changes as indicated below to increase mutagenic efficiency. This method included the introduction of a silent extra AccI site to screen for successful mutagenesis. First, a prePCR mix was used containing 3 l 10pfu reaction buffer, 1 l dNTP mix (10 mM), 275 ng forward or reverse primer, 50 ng template DNA and 0.75 l Pfu turbo hotstart polymerase. A prePCR was run using a GeneAmp PCR system 9700 (Applied Biosystems): initial denaturation at 94 C. for 5 min; 4 cycles of 94 C. for 30 sec, 50 C. for 1 min and 68 C. for 14 min. 25 l of forward primer containing prePCR mix was added to 25 l of reverse primer containing prePCR mix. 0.5 l Pfu turbo hotstart was added and amplification was performed: denaturing at 94 C. for 1 min; 14 cycles of 94 C. for 1 min, 50 C. for 1 min and 68 C. for 8 min; 12 cycles of 94 C. for 30 sec, 55 C. for 1 min and 68 C. for 8 min.
[0311] PCR mixtures were stored at 4 C. until further processing. Next, PCR mixtures were incubated with 1 l DpnI for 60 min at 37 C. and stored at 4 C. until further processing. 2 l of the digested PCR products was transformed in One Shot DNH5a T1 competent E. coli cells (Invitrogen, Breda, The Netherlands) according to the manufacturer's instructions (Invitrogen). Next, cells were plated on Luria-Bertani (LB) agar plates containing 50 g/ml ampicillin. Plates were incubated for 16-18 hours at 37 C. until bacterial colonies became evident.
[0312] After screening by colony PCR and AccI digestion to check for successful mutagenesis, plasmid was isolated from the bacteria and the mutation was confirmed by DNA sequencing. To check if no unwanted extra mutations were introduced the whole HC coding region was sequenced and did not contain any additional mutations.
TABLE-US-00008 SequencePrimer sequence(5-3) CH1-Betv1-F:SEQIDNO:29 TCTCCTCAGCCAGCACCAAG CH1-Feld1-F:SEQIDNO:30 GTTTGTCTGCAGCCAGCACCAAG CH2-F:SEQIDNO:31 CATCTCCAAAGCCAAAGGTGGGA CC CH2-R:SEQIDNO:32 GGTCCCACCTTTGGCTTTGGAGA TG CH3-F:SEQIDNO:33 CGACGGCTCCTTCTTCCTCTACA G CH3-R:SEQIDNO:34 CTGTAGAGGAAGAAGGAGCCGTC G Intron2-F:SEQIDNO:35 CAAGAGCCATATCCGGGAGGACC Intron2-R:SEQIDNO:36 GGTCCTCCCGGATATGGCTCTTG pEE-F:SEQIDNO:37 GTCAGAGGTAACTCCCGTTG pEE-R:SEQIDNO:38 GTTGTGGTTTGTCCAAACTC
[0313] Recombinant antibodies from these constructs were transiently expressed in HEK 293 cells in 3 ml, 6-wells plates (NUNC) or in 125 or 250 erlenmeyers (Corning) with 293 Fectin (Invitrogen) as transfection reagent.
Example 37
Fab Arm Exchange of IgG1 and IgG4 Hinge Region or CH3 Domain Mutants
[0314] Antibodies were mixed and subsequently incubated with reduced glutathione (GSH) to investigate the exchange of half molecules. GSH (Sigma-Aldrich, St. Louis, Mo.) was dissolved in water before use.
[0315] The exchange of half molecules was evaluated by incubating an antibody mixture consisting of Bet v 1 specific antibody (200 ng) and Fel d 1 specific antibody (200 ng) In PBS/Azide containing GSH (1 or 10 mM) at 37 C. Total incubation volume was 50 l. After 24 hours samples were drawn from the incubation mixture in PBS-AT (PBS supplemented with 0.3% bovine serum albumin, 0.1% Tween-20 and 0.05% (w/v) NaN.sub.3). For samples containing 10 mM GSH an equimolar amount of iodine-acetamide, a strongly alkylating agent that inhibits the GSH activity, was added. Samples were stored at 4 C. for measuring of antigen binding and bispecific activity
[0316] Levels of Bet v 1 binding antibodies were measured in the antigen binding test. Samples were incubated with 0.75 mg of protein G Sepharose (Amersham Biosciences, Uppsala, Sweden) in 750 l PBS-IAT (PBS-AT supplemented with 1 g/ml Mg) in the presence of .sup.125I-labeled Bet v 1 for 24 h. Next, the Sepharose was washed with PBS-T (PBS supplemented with 0.1% Tween-20 and 0.05% (w/v) NaN.sub.3) and the amount of radioactivity bound relative to the amount of radioactivity added was measured. The concentration of Bet v 1 specific IgG was calculated using purified Bet v 1 specific antibodies as a standard (range 0-200 ng per test as determined by nephelometer).
[0317] The concentration of bispecific IgG (i.e. Fel d 1-Bet v 1 cross-linking activity) was measured in the heterologous cross-linking assay. In this assay, a sample was incubated for 24 h with 0.5 mg Sepharose-coupled cat extract, in which Fel d 1 antigen is present, in a total volume of 300 l in PBS-IAT. Subsequently, the Sepharose was washed with PBS-T and incubated for 24 h with .sup.125I-labeled Bet v 1, after which the Sepharose was washed with PBS-T and the amount of radioactivity bound relative to the amount of radioactivity added was measured. The concentration of bispecific IgG (Fel d 1-Bet v 1) was calculated using the same calibration curve as used in the Bet v 1 binding test, which was obtained from purified Bet v 1 binding IgG. Tests were performed using antibody-containing supernatants in FreeStyle 293 expression medium, GIBCO/Invitrogen Corporation.
[0318] The following antibody mixtures were used: [0319] Betv1-IgG1 wt with Feld1-IgG1 wt (indicated as IgG1 wt in
[0328] The results (
Example 38
Additional CH3 Mutations to Stabilize Dimerization of Hingeless IgG4 Antibody Molecules in the Absence of IVIG
[0329] Hingeless IgG4 antibody (HG) molecules form dimers by low affinity non-covalent interactions. WO/2007/059782 describes that this dimerization process can be inhibited by using HG IgG4 molecules in the presence of an excess of irrelevant antibodies. WO/2007/059782 describes a hingeless IgG4 anti-EGFR antibody 2F8-HG.
[0330] Construction of pHG-2F8: A vector for the expression of the heavy chain of 2F8-HG: The heavy chain cDNA encoding region of 2F8-HG was codon optimized and cloned in the pEE6.4 vector (Lonza Biologics, Slough, UK). The resulting vector was named pHG-2F8.
[0331] Construction of pKappa2F8: A vector for the production of the light chain of 2F8 antibodies: The VL region encoding antibody 2F8 was codon optimized and cloned in the pKappa2F2 vector (a vector encoding the codon optimized cDNA region of antibody 2F2 (described in WO2004035607) in vector pEE12.4 (Lonza)), replacing the 2F2 VL region with the 2F8 VL region. The resulting vector was named pKappa-2F8.
[0332] Hingeless IgG4 anti-EGFR antibody 2F8-HG has been described in WO/2007/059782. The additional mutations given in the Table below were introduced into the CH3 region of hingeless IgG4 antibody 2F8-HG by site-directed mutagenesis.
[0333] KABAT Indicates amino add numbering according to Kabat (Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991)
EU index indicates amino acid numbering according to EU index as outlined in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991))
SEQ ID NO:39, 40, 41 Indicates amino acid numbering as indicated in SEQ ID NO:39, 40 and 41 of this document.
[0334] See also
TABLE-US-00009 Numbering of CH3 mutations KABAT EU index G4 SEQ ID NO: 39, 40, 41 436 F405A F285A 436 F405L F285L 440 R409A R289A 440 R409K R289K
[0335] To make the constructs for the expression of the CH3 mutants, the mutations were introduced into pHG2F8 using site-directed mutagenesis, using the following primers:
TABLE-US-00010 Name nt Sequence HGF417Af 48 CCAGTGCTGGACAGCGACGGAAGCTTCGCCCTGTAC AGCAGGCTGACC(SEQIDNO:42) HGF417Ar 48 GGTCAGCCTGCTGTACAGGGCGAAGCTTCCGTCGCT GTCCAGCACTGG(SEQIDNO:43) HGF417Lf 51 CCAGTGCTGGACAGCGACGGATCCTTCTTACTGTAC AGCAGGCTGACCGTG(SEQIDNO:44) HGF417Lr 51 CACGGTCAGCCTGCTGTACAGTAAGAAGGATCCGTC GCTGTCCAGCACTGG(SEQIDNO:45) HGF421Af 46 GCTCCTTCTTCCTGTACAGCGCGTTAACCGTGGACA AGTCCAGGTG(SEQIDNO:46) HGF421Ar 46 CACCTGGACTTGTCCACGGTTAACGCGCTGTACAGG AAGAAGGAGC(SEQIDNO:47) HGF421Kf 45 CTCCTTCTTCCTGTACAGCAAGCTTACCGTGGACAA GTCCAGGTG(SEQIDNO:48) HGF421Kr 45 CACCTGGACTTGTCCACGGTAAGCTTGCTGTACAGG AAGAAGGAG(SEQIDNO:49)
[0336] The constructs were expressed transiently in HEK-293F cells by cotransfecting the heavy-chain- and light-chain-encoding plasmids and binding to purified EGFr was determined in the absence and presence of 200 g/ml polyclonal human IgG (Intravenous Immunoglobulin, IVIG, Sanquin Netherlands).
[0337] Binding affinities were determined using an ELISA in which purified EGFr (Sigma, St Louis, Mo.) was coated to 96-well Microlon ELISA plates (Greiner, Germany), 50 ng/well. Plates were blocked with PBS supplemented with 0.05% Tween 20 and 2% chicken serum. Subsequently, samples, serially diluted in a buffer containing 100 g/ml polyclonal human IgG (Intravenous Immunoglobulin, IVIG, Sanquin Netherlands) were added and incubated for 1 h at room temperature (RT). Plates were subsequently incubated with peroxidase-conjugated rabbit-anti-human kappa light chain (DAKO, Glostrup, Denmark) as detecting antibody and developed with 2,2-azino-bis (3-ethylbenzothiazoline-6-sulfonic acid) (ABTS; Roche, Mannheim, Germany). Absorbance was measured in a microplate reader (Biotek, Winooski, Vt.) at 405 nm.
[0338]
Example 39
Additional CH3 Domain Mutations to Stabilize Dimerization of Human IgG4 Antibodies
[0339] Mutations as given in the Table below were introduced into the CH3 domains of IgG4-CD20 and IgG4-EGFr by site-directed mutagenesis.
[0340] KABAT indicates amino add numbering according to Kabat (Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991)
EU index indicates amino acid numbering according to EU index as outlined in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991))
SEQ ID NO:39, 40, 41 indicates amino acid numbering as indicated in SEQ ID NO:39, 40 and 41 of this document.
[0341] See also
TABLE-US-00011 Numbering of CH3 mutations KABAT EU index G4 SEQ ID NO: 39, 40, 41 376 Q355R Q235R 393 K370T K250T 436 F405A F285A 436 F405L F285L 440 R409A R289A 440 R409K R289K 440 R409L R289L 440 R409M R289M 440 R409T R289T 450 E419Q E299Q 476 L445P L325P
[0342] IgG1-CD20 and IgG1-EGFr, IgG4-CD20 and IgG4-EGFr, or IgG4-CH3mutant-CD20 and IgG4-CH3mutant-EGFr were mixed and incubated with 0.5 mM GSH as described above. Bispecific activity was determined as described in Example 33.
[0343]
TABLE-US-00012 SEQUENCELISTING SEQIDNO:39:AminoaicdsequenceofthewildtypeC.sub.HregionofhumanIgG4 1 ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGV 51 HTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVES 101 KYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQED 151 PEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYK 201 CKVSNKGLPSSIEKTISKAKGQPREPQVYTPLLSQEEMTKNQVSLTCLVK 251 GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEG 301 NVFSCSVMHEALHNHYTQKSLSLSLGK SEQIDNO:40:AminoacidsequenceofthewildtypeC.sub.HregionofhumanIgG4 1 ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGV 51 HTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVES 101 KYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQED 151 PEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYK 201 CKVSNKGLPSSIEKTISKAKGQPREPQVYTPLLSQEEMTKNQVSLTCLVK 251 GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQEG 301 NVFSCSVMHEALHNHYTQKSLSLSLGK SEQIDNO:41:AminoacidsequenceofthewildtypeC.sub.HregionofhumanIgG4 1 ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGV 51 HTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVES 101 KYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQED 151 PEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVVHQDWLNGKEYK 201 CKVSNKGLPSSIEKTISKAKGQPREPQVYTPLLSQEEMTKNQVSLTCLVK 251 GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEG 301 NVFSCSVMHEALHNHYTQKSLSLSLGK