FUSION PROTEINS FOR USE AS IMMUNOGENIC ENHANCERS FOR INDUCING ANTIGEN-SPECIFIC T CELL RESPONSES
20170029470 ยท 2017-02-02
Inventors
Cpc classification
A61P1/04
HUMAN NECESSITIES
A61P31/00
HUMAN NECESSITIES
C12N2760/18134
CHEMISTRY; METALLURGY
C07K2319/33
CHEMISTRY; METALLURGY
A61K39/21
HUMAN NECESSITIES
C12N2770/24334
CHEMISTRY; METALLURGY
C07K2319/55
CHEMISTRY; METALLURGY
C07K2319/40
CHEMISTRY; METALLURGY
C07K14/70596
CHEMISTRY; METALLURGY
C12N2770/24222
CHEMISTRY; METALLURGY
C12N2770/24234
CHEMISTRY; METALLURGY
C12N2750/10022
CHEMISTRY; METALLURGY
C12N2750/10034
CHEMISTRY; METALLURGY
A61P1/16
HUMAN NECESSITIES
C07K2319/04
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
C12N2730/10122
CHEMISTRY; METALLURGY
C12N2730/10134
CHEMISTRY; METALLURGY
A61K39/292
HUMAN NECESSITIES
Y02A50/30
GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
C12Y204/02036
CHEMISTRY; METALLURGY
C12N2710/20034
CHEMISTRY; METALLURGY
C12N2710/20022
CHEMISTRY; METALLURGY
A61P1/00
HUMAN NECESSITIES
A61K2039/57
HUMAN NECESSITIES
C12N2770/32134
CHEMISTRY; METALLURGY
A61P15/00
HUMAN NECESSITIES
International classification
Abstract
A fusion protein for use as an immunogen enhancer for enhancing antigen-specific T cell responses is disclosed. The fusion protein comprises: (a) an antigen-presenting cell (APC)-binding domain or a CD91 receptor-binding domain; (b) a protein transduction domain; and (c) an antigen of a pathogen, wherein the APC-binding domain or the CD91 receptor-binding domain is located at the N-terminus of the fusion protein, and the antigen of the pathogen is located at the C-terminus of the protein transduction domain. The protein transduction domain is selected from the group consisting of: (i) a fusion polypeptide, comprising a T cell sensitizing signal-transducing peptide, a linker, and a translocation peptide; (ii) a T cell-sensitizing signal-transducing peptide; and (iii) a translocation peptide of 34-112 amino acid residues in length.
Claims
1. A fusion protein comprising: (a) an antigen-presenting cell (APC)-binding domain or a CD91 receptor-binding domain, located at the N-terminus of the fusion protein; (b) a protein transduction domain, located at the C-terminus of the APC-binding domain or the CD91 receptor-binding domain, wherein the protein transduction domain is a fusion polypeptide consisting of: (1) a T cell sensitizing signal-transducing peptide consisting of 28-53 amino acid residues in length, comprising the amino acid sequence of SEQ ID NO: 31, in which Xaa.sup.8 is I; Xaa.sup.10 is V, F or A, Xaa.sup.11 is M or L, Xaa.sup.17 is L or I, being located at the N-terminus of the fusion polypeptide; (2) a translocation peptide consisting of 34-112 amino acid residues in length, comprising an amino acid sequence that is at least 90% identical to SEQ ID NO: 3, 20 or 4; and (3) a linker, comprising SEQ ID NO: 15 linking the T cell sensitizing signal-transducing peptide and the translocation peptide; and (c) an antigen of a pathogen or a cancer cell, located at the C-terminus of the protein transduction domain; wherein: the pathogen is at least one selected from the group consisting of human papillomavirus (HPV), PRRSV, HIV-1, flu virus, Dengue virus, hepatitis C virus (HCV), hepatitis B virus (HBV), and porcine circovirus 2 (PCV2); and further wherein: the cancer cell is at least one selected from the group consisting of non-small cell lung cancer, breast carcinoma, melanoma, lymphomas, colon carcinoma, and hepatocellular carcinoma.
2. The fusion protein of claim 1, wherein the pathogen is at least one selected from the group consisting of HPV, PRRSV, HCV, HBV, and PCV2.
3. The fusion protein of claim 2, wherein the antigen of the pathogen is at least one selected from the group consisting of HPV E7 protein, PRRSV protein, HCV core protein, HBV X protein, and PCV2 ORF2 protein.
4. The fusion protein of claim 3, wherein the antigen comprises an amino acid sequence that is at least 90% identical to SEQ ID NOs: 21, 22, 23, 24, 25, 26, 27, 28 or 29.
5. The fusion protein of claim 3, wherein the antigen comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 21, 22, 23, 24, 25, 26, 27, 28, and 29.
6. The fusion protein of claim 1, wherein the APC-binding domain or the CD91 receptor-binding domain is a polypeptide comprising an amino acid sequence that is at least 90% identical to the sequence selected from the group consisting of SEQ ID NOs: 5, 9, 6, 7, and 8.
7. The fusion protein of claim 1, wherein the APC-binding domain or the CD91 receptor-binding domain is a polypeptide comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 5, 9, 6, 7, and 8.
8. The fusion protein of claim 1, further comprising an endoplasmic reticulum retention sequence located at the C-terminus of the fusion protein.
9. The fusion protein of claim 1, wherein the T cell sensitizing signal-transducing peptide comprises the amino acid sequence of SEQ ID NO: 1.
10. The fusion protein of claim 1, wherein the translocation peptide comprises the amino acid sequence of SEQ ID NO: 3.
11. The fusion protein of claim 1, wherein the protein transduction domain comprises the sequence of SEQ ID NO: 30.
12. A fusion protein consisting of: (a) an antigen-presenting cell (APC)-binding domain or a CD91 receptor-binding domain, located at the N-terminus of the fusion protein; (b) a protein transduction domain, located at the C-terminus of the APC-binding domain or the CD91 receptor-binding domain, wherein the protein transduction domain is selected from the group consisting of: (i) a T cell-sensitizing signal-transducing peptide consisting of 28-53 amino acid residues in length, comprising the amino acid sequence of SEQ ID NO: 31, in which Xaa.sup.8 is I; Xaa.sup.10 is V, F or A, Xaa.sup.11 is M or L, Xaa.sup.17 is L or I; and (ii) a translocation peptide of 34-46 amino acid residues in length, comprising an amino acid sequence that is at least 90% identifical to SEQ ID NO: 3 or 20; and (c) an antigen of a pathogen, located at the C-terminus of the protein transduction domain; wherein: the APC-binding domain or the CD91 receptor-binding domain is free of the amino acid sequence of Pseudomonas exotoxin A (PE) binding domain I if the protein transduction domain is the translocation peptide; and further wherein: the pathogen is at least one selected from the group consisting of human papillomavirus (HPV), PRRSV, HIV-1, flu virus, Dengue virus, hepatitis C virus (HCV), hepatitis B virus (HBV), and porcine circovirus 2 (PCV2), and the cancer cell is at least one selected from the group consisting of non-small cell lung cancer, breast carcinoma, melanoma, lymphomas, colon carcinoma, and hepatocellular carcinoma.
13. A fusion protein consisting of: (a) an antigen-presenting cell (APC)-binding domain or a CD91 receptor-binding domain, located at the N-terminus of the fusion protein; (b) a protein transduction domain, located at the C-terminus of the APC-binding domain or the CD91 receptor-binding domain, wherein the protein transduction domain is selected from the group consisting of: (i) a T cell-sensitizing signal-transducing peptide consisting of 28-53 amino acid residues in length, comprising the amino acid sequence of SEQ ID NO: 31, in which Xaa.sup.8 is I; Xaa.sup.10 is V, F or A, Xaa.sup.11 is M or L, Xaa.sup.17 is L or I; and (ii) a translocation peptide of 34-46 amino acid residues in length, comprising an amino acid sequence that is at least 90% identical to SEQ ID NO: 3 or 20; and; (c) an antigen of a pathogen, located at the C-terminus of the protein transduction domain; and (d) an endoplasmic reticulum retention sequence located at the C-terminus of the fusion protein; wherein: the pathogen is at least one selected from the group consisting of human papillomavirus (HPV), PRRSV, HIV-1, flu virus, Dengue virus, hepatitis C virus (HCV), hepatitis B virus (HBV), and porcine circovirus 2 (PCV2); and further wherein: the cancer cell is at least one selected from the group consisting of non-small cell lung cancer, breast carcinoma, melanoma, lymphomas, colon carcinoma, and hepatocellular carcinoma.
14. A fusion protein comprising: (a) an antigen-presenting cell (APC)-binding domain or a CD91 receptor-binding domain, located at the N-terminus of the fusion protein; (b) a protein transduction domain, located at the C-terminus of the APC-binding domain or the CD91 receptor-binding domain, wherein the protein transduction domain is a fusion polypeptide consisting of: (1) a T cell sensitizing signal-transducing peptide of 28 amino acid residues in length, consisting of the amino acid sequence of SEQ ID NO: 31, in which Xaa.sup.8 is I or L; Xaa.sup.10 is V, F or A, Xaa.sup.11 is M or L, Xaa.sup.17 is L or I, being located at the N-terminus of the fusion polypeptide; (2) a translocation peptide consisting of 34-112 amino acid residues in length, comprising an amino acid sequence that is at least 90% identical to SEQ ID NO: 3, 20 or 4; and (3) a linker, comprising SEQ ID NO: 15 linking the T cell sensitizing signal-transducing peptide and the translocation peptide; and (c) an antigen of a pathogen, located at the C-terminus of the protein transduction domain; wherein: the pathogen is at least one selected from the group consisting of human papillomavirus (HPV), PRRSV, HIV-1, flu virus, Dengue virus, hepatitis C virus (HCV), hepatitis B virus (HBV), and porcine circovirus 2 (PCV2); and further wherein: the cancer cell is at least one selected from the group consisting of non-small cell lung cancer, breast carcinoma, melanoma, lymphomas, colon carcinoma, and hepatocellular carcinoma.
15. The fusion protein of claim 12, wherein the antigen comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 21, 22, 23, 24, 25, 26, 27, 28, and 29.
16. The fusion protein of claim 13, wherein the antigen comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 21, 22, 23, 24, 25, 26, 27, 28, and 29.
17. The fusion protein of claim 14, wherein the antigen comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 21, 22, 23, 24, 25, 26, 27, 28, and 29.
18. A method for inducing enhanced pathogen antigen-specific T cell responses, comprising: administering a vaccine composition comprising a therapeutically effective amount of the fusion protein of claim 1 to a subject in need thereof, and thereby inducing enhanced pathogen antigen-specific T cell responses.
19. A method for inducing enhanced pathogen antigen-specific T cell responses, comprising: administering a vaccine composition comprising a therapeutically effective amount of the fusion protein of claim 13 to a subject in need thereof, and thereby inducing enhanced pathogen antigen-specific T cell responses.
20. A method for inducing enhanced pathogen antigen-specific T cell responses, comprising: administering a vaccine composition comprising a therapeutically effective amount of the fusion protein of claim 14 to a subject in need thereof, and thereby inducing enhanced pathogen antigen-specific T cell responses.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0059]
[0060]
[0061]
[0062]
[0063]
[0064]
[0065]
[0066]
[0067]
[0068]
[0069]
[0070]
[0071]
[0072]
[0073]
[0074]
[0075]
[0076]
[0077]
DETAILED DESCRIPTION OF THE INVENTION
[0078] The present invention is more particularly described in the following examples that are intended as illustrative only since numerous modifications and variations therein will be apparent to those skilled in the art. Various embodiments of the invention are now described in detail. Referring to the drawings, like numbers indicate like components throughout the views. As use din the description herein and throughout the claims that follow, the meaning of a, an, and the includes plural reference unless the context clearly dictates otherwise. Also, as used in the description herein and throughout the claims that follow, the meaning of in includes in and on unless the context clearly dictates otherwise. Moreover, titles or subtitles may be used in the specification for the convenience of a reader, which shall have in influence on the scope of the present invention. Additionally, some terms used in this specification are more specifically defined below.
Definitions
[0079] The terms used in this specification generally have their ordinary meanings in the art, within the context of the invention, and in the specific context where each term is used. Certain terms that are used to describe the invention are discussed below, or elsewhere in the specification, to provide additional guidance to the practitioner regarding the description of the invention. For convenience, certain terms may be highlighted, for example using italics and/or quotation marks. The use of highlighting has no influence on the scope and meaning of a term; the scope and meaning of a term is the same, in the same context, whether or not it is highlighted. It will be appreciated that same thing can be said in more than one way. Consequently, alternative language and synonyms may be used for any one or more of the terms discussed herein, nor is any special significance to be placed upon whether or not a term is elaborated or discussed herein. Synonyms for certain terms are provided. A recital of one or more synonyms does not exclude the use of other synonyms. The use of examples anywhere in this specification including examples of any terms discussed herein is illustrative only, and in no way limits the scope and meaning of the invention or of any exemplified term. Likewise, the invention is not limited to various embodiments given in this specification.
[0080] Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention pertains. In the case of conflict, the present document, including definitions, will control.
[0081] As used herein, around, about or approximately shall generally mean within 20 percent, preferably within 10 percent, and more preferably within 5 percent of a given value or range. Numerical quantities given herein are approximate, meaning that the term around, about or approximately can be inferred if not expressly stated.
[0082] The term an antigen-presenting cell (APC) or accessory cell refers to a cell that displays foreign antigens complexed with major histocompatiblity complexes (MHC's) on their surfaces. T-cells may recognize these complexes using their T-cell receptors (TCRs). These cells process antigens and present them to T-cells. Main types of professional antigen-presenting cell: dendritic cells (DCs), macrophages, monocytes, and certain B-cells.
[0083] The term an antigen-presenting cell (APC)-binding domain refers to a domain that can bind to an antigen-presenting cell (APC). The APC-binding domain may be a polypeptide comprising an amino acid sequence that is at least 90% identical to the sequence selected from the group consisting of SEQ ID NOs: 5, 6, 7, 8, and 9. An APC-binding domain is a ligand that recognizes and binds to a receptor on APC.
[0084] Cluster of differentiation 91 (CD91) is a protein that forms a receptor in the membrane of cells and is involved in receptor-mediated endocytosis.
[0085] The term a protein transduction domain refers to a polypeptide or a fusion polypeptide having a function to sensitize T-cells and thus enhance antigen-specific T cell responses, and/or to guide or direct an antigen toward (i.e., to target to) class I major histocompatibility complex (MHC-I) pathway (i.e., a cytotoxic T cell pathway) of antigen presentation.
[0086] The term to sensitize T cells generally means that CD8+ and CD4+ T cells are sensitized and as a result, CD8+ (CTL) and CD4+ T cell responses to an antigen challenge are enhanced. An antigen-specific cell mediated immune response is measured by quantifying the production of antigen-specific induced -interferon in response to an antigen. For example, without a sensitization signal (i.e., without the protein transduction domain), an antigen alone may induce weak or no cell mediated immune response at all, i.e., weak or no production of antigen-specific -interferon from CD8+ and CD4+ T cells, while in the presence of a sensitization signal (the protein transduction domain), the antigen may induce an enhanced cell mediated immune response. Thus, the function of a sensitization signal (the protein transduction domain) is to sensitize CD4+ and CD8+ T cells in a host so that when the host is later challenged by an antigen, the antigen can induce an enhanced antigen-specific cell mediated immune response due to prior CD4+ and CD8+ T cell sensitization.
[0087] A protein transduction domain may be a peptide and/or polypeptide selected from the group consisting of: [0088] (i) a fusion polypeptide, comprising a T cell sensitizing signal-transducing peptide, a linker, and a translocation peptide, wherein: [0089] (1) the T cell sensitizing signal-transducing peptide is located at the N-terminus of the fusion polypeptide; [0090] (2) the linker comprises SEQ ID NO: 15, linking the T cell sensitizing signal-transducing peptide and the translocation peptide; and [0091] (3) the translocation peptide has 34-112 amino acid residues in length and comprises the amino acid sequence that is at least 90% identical to SEQ ID NO: 3, 20 or 4; [0092] (ii) a T cell-sensitizing signal-transducing peptide; and [0093] (iii) a translocation peptide of 34-112 amino acid residues in length, comprising the amino acid sequence that is at least 90% identical to SEQ ID NO: 3, 20 or 4.
[0094] A protein transduction domain may be a fusion polypeptide, in which the fusion polypeptide comprises a T cell sensitizing signal-transducing peptide, a linker, and a translocation peptide. For example, the fusion polypeptide may be the polypeptide CD28convPE.sub.t.
[0095] The term CD28conv refers to a CD28 conserved region, which is a T cell sensitizing signal-transducing peptide. It's an epitope for inducing CD28 agonist antibody.
[0096] The term PE.sub.t refers to a translocation peptide with 34-112 amino acid residues in length.
[0097] A linker is present between the CD28conv and the PE.sub.t. The orientation or arrangement of the fusion polypeptide CD28convPE.sub.t is important in that CD28conv (or the T cell sensitizing signal-transducing peptide) must be at the upstream to the PE.sub.t (or the translocation peptide), i.e., PE.sub.t must be at the C-terminus of the CD28conv to obtain enhanced T-cell responses. The CD28convPE.sub.t can raise much higher IgG titer (called CD28-specific agonist antibody) specific to CD28conv than the reversed orientation fusion peptide PE.sub.tCD28conv. The CD28-specific agonist antibody can sensitize both CD4+ and CD8+ T cells. The correct orientation fusion polypeptide CD28convPE.sub.t contains a linker (RXRXKR) between CD28conv and PE.sub.t domains. The linker contains an antigen presenting cell (APC)-specific protease (cathepsin L) cutting site Lys-Arg (KR). Therefore, the fusion protein RAP1-CD28convPE.sub.t-Antigen-K3 can be digested into the two fragments: RAP1-CD28conv and PE.sub.t-Antigen-K3. The RAP1-CD28conv fragment can be further digested in the lysosome and the epitope of CD28conv is then presented to the APC cell surface via MHC II pathway, which in turn elicits a humoral immune response producing CD28 agonist antibody. Thus, CD28 agonist antibody is produced by B cells. This CD28 agonist antibody can bind to CD28 on the T cell surface and pre-activate the T cells (CD4+ and CD8+ T cells).
[0098] A T cell-sensitizing signal-transducing peptide has 28-53 amino acid residues in length and comprises an amino acid sequence that is at least 90% identicial to SEQ ID NO: 31, in which Xaa.sup.8 is I or L; Xaa.sup.10 is V, F or A, Xaa.sup.11 is M or L, Xaa.sup.17 is L or I.
[0099] The T cell-sensitizing signal-transducing peptide comprises the critical region K.sup.1(I/L).sup.2E.sup.3(V/F/A).sup.4(M/L).sup.5Y.sup.6P.sup.7P.sup.8P.sup.9Y.sup.10 (SEQ ID NO: 32), wherein (X).sup.2 is I or L; (X).sup.4 is V, F or A, (X).sup.5 is M or L.
[0100] A T cell sensitizing signal-transducing peptide (TDIYFCKIEFMYPPPYLDNEKSNGTIIH; SEQ ID NO: 31, wherein X.sup.8 is I, X.sup.10 is F, X.sup.11 is M) specific for mice was used in the following examples.
[0101]
[0102]
[0103] PE.sub.t may comprise the amino acid sequence that is at least 90% identical to SEQ ID NO: 3 or 20. For example, the amino acid sequence of PE.sub.t may be a.a. 280-a.a. 313 (SEQ ID NO: 3), a.a. 268-a.a. 313 (SEQ ID NO: 20), a.a. 253-a.a. 313, or a.a. 253-a.a. 364 (SEQ. ID NO: 4) of PE. That is, the amino acid sequence of PE.sub.t may contain any region of the PE domain II (a.a. 253 to a.a. 364; SEQ ID NO: 4) as long as it comprises a.a. 280-a.a. 313 (SEQ ID NO: 3) essential fragment.
[0104] An antigen may be a pathogenic protein, polypeptide or peptide that is responsible for a disease caused by the pathogen, or is capable of inducing an immunological response in a host infected by the pathogen, or tumor-associated antigen (TAA) which is a polypeptide specifically expressed in tumor cells. The antigen may be selected from a pathogen or cancer cells including, but not limited to, Human Papillomavirus (HPV), PRRSV, HIV-1, flu virus. Dangue virus, Hepatitis C virus (HCV). Hepatitis B virus (HBV), Porcine Circovirus 2 (PCV2), non-small cell lung cancer, breast carcinoma, melanoma, lymphomas, colon carcinoma, hepatocellular carcinoma and any combination thereof. For example, HPV E7 protein (E7), HCV core protein (HCV core), HBV X protein (HBx) were selected as antigens for vaccine development. The antigen may be a fusion antigen from a fusion of two or more antigens selected from one or more pathogenic proteins. For example, a fusion antigen of PRRSV ORF6 and ORF5 fragments, or a fusion of antigenic proteins from PRRSV and PCV2 pathogens.
[0105] The function of an endoplasmic reticulum retention sequence is to assist translocation of an antigen from an endocytotic compartment into ER and retains it in the lumen. It comprises the sequence Lys Asp Glu Leu (KDEL) or RDEL. An ER sequence may comprise, or consists essentially of, or consist of, the sequence of KKDLRDELKDEL (SEQ ID NO: 16), KKDELRDELKDEL (SEQ ID NO: 17), KKDELRVELKDEL (SEQ ID NO: 18).
[0106] Receptor-associated protein (RAP1) with a molecular weight of 39 kDa is an ER resident protein and molecular chaperone for LDL receptor-related protein. It has a high binding affinity to CD91 (Kd 3 nM) and is composed by three functional-similar domains.
[0107] The invention relates to the discovery of induction and enhancement of T cell mediated immune responses by fusion proteins according to the invention. Using RAP1-CD28convPE.sub.t-E7-K3 an example, the strategy of RAP1-CD28convPE.sub.tE7-K3 vaccine is focused primarily on stimulating the production and activation of T cells that can recognize HPV16 infected cells expressing the target antigen E7. By delivering antigens to dendritic cells, it can generate antigen-specific CD8+T cells and CD4+ T cells. Type 1-helper CD4+ cells particularly are able to efficiently stimulate and augment the immune response of cytotoxic CD8+ T cells. Together, these two arms of the adaptive immune system have the specificity and potency to kill HPV16-infected cells or HPV16-associated tumor cells at multiple sites in the body without inflicting significant damage on normal tissues.
[0108] The term subject refers to a human or a non-human animal.
[0109] The term treating or treatment refers to administration of an effective amount of the fusion protein to a subject in need thereof, who has cancer or infection, or a symptom or predisposition toward such a disease, with the purpose of cure, alleviate, relieve, remedy, ameliorate, or prevent the disease, the symptoms of it, or the predisposition towards it. Such a subject can be identified by a health care professional based on results from any suitable diagnostic method.
[0110] The term an effective amount refers to the amount of an active compound that is required to confer a therapeutic effect on the treated subject. Effective doses will vary, as recognized by those skilled in the art, depending on rout of administration, excipient usage, and the possibility of co-usage with other therapeutic treatment.
[0111] Abbreviations: CD 28, Cluster of Differentiation 28.
EXAMPLES
[0112] Without intent to limit the scope of the invention, exemplary instruments, apparatus, methods and their related results according to the embodiments of the present invention are given below. Note that titles or subtitles may be used in the examples for convenience of a reader, which in no way should limit the scope of the invention. Moreover, certain theories are proposed and disclosed herein; however, in no way they, whether they are right or wrong, should limit the scope of the invention so long as the invention is practiced according to the invention without regard for any particular theory or scheme of action.
Example 1
Constructions of Expression Vectors
[0113]
[0114] This expression vector was constructed by using the plasmid RAP1-K3 shown in
[0115] The fragment CD28convPE.sub.t contains cathepsin L and furin protease cutting sites.
[0116] The sequence of PE.sub.268-313 is: pletftrhrqprgweqleqcgypvqrlvalylaarswnqvdqvir (SEQ ID NO: 20). The whole sequence of CD28convPE.sub.t is as follows: tdiyfckiefmypppyldneksngtiihrarykrgweqleqcgypvqrlvalylaarlswnqvdqvirgs (SEQ ID NO: 30), the sequence underlined represents a linker sequence containing Cathepsin L and furin protease cutting sites.
Example 2
Protein Expression
[0117] E. coli BL21 cells harboring a protein expression vector were cultured in Luria Bertani broth containing 25 g/ml kanamycin at 37 C. When the culture reached an early log phase, (A600=0.1 to 0.4), isopropyl-1-thio--D-galactopyranoside (IPTG) was added at a final concentration of 0.5 to 2 mM for induction. Cells were harvested after 4 hours IPTG induction and disrupted by sonication. The overexpressed protein-containing inclusion bodies were isolated and solubilized in 8M urea/TN buffer (8M urea, 50 mM Tris, 50 mM NaCl, pH 8.0).
[0118] The refolding of the fusion protein RAP1-PE.sub.268-313-E7-K3 was per formed by dialysis against 50X volume of TNZ buffer (50 mM Tris, 50 mM NaCl and 0.01 mM ZnCl.sub.2, pH 8.0) at 4 C. overnight. The refolded proteins were subject to SDS-PAGE analyses under reduced (with dithiothreitol; +DTT) and non-reduced (without dithiothreitol; DTT) conditions (
[0119]
[0120]
Example 3
RAP1-PE.SUB.268-313.-E7-K3 Inhibits Growth of Tumors Induced by Human Papilloma Virus (HPV) Type 16 E7 Protein
[0121] The fusion proteins PE.sub.407-E7-K3 and RAP1-PE.sub.268-313-E7-K3 were expressed as described above and protein refolding examined by SDS-PAGE (
Example 4
RAP1-CD28convPE.SUB.t.-E7-K3 Inhibits Growth of Tumors Induced by Human Papilloma Virus (HPV) Type 16 E7 Protein and Increases Survival Rate
[0122] The effects of the fusion proteins PE.sub.407-E7-K3 and RAP1-CD28convPE.sub.t-E7-K3 with or without an immune potentiator on tumor size and survival rate were examined. Mice were challenged with a higher dose of TC-01 cells (310.sup.4) via s.c. injection. Seven days after the challenge, mice were vaccinated via s.c. with placebo, PE.sub.407-E7-K3 (100 g/dose) or RAP1-CD28convPE.sub.t-E7-K3 (100 g/dose) with the immune potentiator GPI-0100 or the protein absorbent aluminum phosphate once per week for 3 weeks (
[0123] In contrast, the potency of PE.sub.407-E7-K3 in suppressing the tumor growth depended on the adjuvant. When combined with the absorbent aluminum phosphate, PE.sub.407-E7-K3 became less potent than that when combined with the immune potentiator GPI-0100 (
[0124] On the other hand, mice administrated with RAP1-CD28convPE.sub.t-E7-K3 in combination with the immune potentiator GPI-0100 or the absorbent aluminum phosphate had a better survival rate than the groups vaccinated with PE.sub.407-E7-K3 in combination with GPI-0100 or aluminum phosphate (
Example 5
Immunogenicity Assays
[0125] The immunogenicities of various vaccines were tested. Briefly, mice were divided into the following groups: HPV16 E7, HPV 18 E7, HCV core, HBV HBx, PCV2ORF2 and PRRSV (
[0126] The immunization schedule, vaccines and does are illustrated in
[0127] The stimulated splenocytes were washed with FACScan buffer and the cell surface markers CD8a, CD4, and CD3 were stained with phycoerythrin-conjugated monoclonal rat anti-mouse CD8a, AF700-conjugated monoclonal rat anti-mouse CD4 and AF647-conjugated monoclonal rat anti-mouse CD3 antibodies. The cells were then permeabilized and fixed by Cytofix/Cytoperm kit according to the manufacturer's instructions (BD Pharmingen). Intracellular IFN- was stained with AF488-conjugated rat anti-mouse IFN-65 to measure the immune response and cytokine levels. Flow cytometry analyses were performed using Gallios flow cytometry with Kaluza analysis software (Beckman Coulter).
[0128] The following PRRSV vaccines were tested for immunogenicities: PE.sub.407-PRRSV-K3, RAP1-PE.sub.268-313PRRSV-K3 or RAP1-CD28convPE.sub.t-PRRSV-K3 vaccine. Each vaccine contained a mixture of four different fusion proteins, and each fusion protein contained a different antigen that is selected from the group consisting of DGD, M12, PQAB and RSAB (
[0129] The amino acid sequence of DGD (SEQ ID NO: 26) is as follows:
TABLE-US-00001 RHHFTPSERQLCLSSIQTAFNQGAGTCILSDSGRISYTVEFSLPTHHTVR LIRVTAPPSALDQVIRNALASPGSGGDLGEAIREQPEQARLALTLAAAES ERFVRQGTGNDEAGAANADVVSLTCPVAAGECAGPADSGDALLERNYPTG AEFLGDGGDVRHHFTPSERQLCLSSIQTAFNQGAGTCILSDSGRISYTVE FSLPTHHTVRLIRVTAPPSA,
DGD represents a fusion antigen of PRRSV ORF7 a.a. 64-a.a. 123 (boldface), linker (underlined) and ORF7 a. a. 64-a.a. 123 (boldface).
[0130] The term M12 represents a antigen of PRRSV ORF1b a.a. 1046-a.a. 1210. Its amino acid sequence (SEQ ID NO: 27) is as follows:
TABLE-US-00002 NNKECTVAQALGNGDKFRATDKRVVDSLRAICADLEGSSSPLPKVAHNLG FYFSPDLTQFAKLPIELAPHWPVVSTQNNEKWPDRLVASLRPLDKNSRAC IGAGYMVGPSVFLGTPGVVSYYLTKFVKGEAQVLPETVFSTGRIEVDCRE YLDDREREVAASLPH,
[0131] The amino acid sequence of PQAB (SEQ ID NO: 28) is as follows:
TABLE-US-00003 GSSLDDFCYDSTAPQKVLLAFSITYASNDSSSHLQLIYNLTLCELNGTDW LANKFDWA,
PQAB represents a fusion antigen of PRRSV American strain ORF6 a.a. 2-a.a. 26 and ORF5 a.a. 31-a.a. 63 (underlined).
[0132] The amino acid sequence of RSAB is
TABLE-US-00004 (SEQIDNO:29) MGSLDDFCNDSTAAQKLVLAFSITYTPIFVAGGSSSTYQYIYNLTICELN GTDWLSNHFDWA,
The term RSAB represents a fusion antigen of PRRSV European strain ORF6 a.a. 2-28 and ORF5 a.a. 31-64 (underlined).
Example 6
[0133] The fragment of RAP1 domain 3 of the fusion protein RAP1-CD28convPE.sub.t-E7-K3 is replaced by A2M minimum (SEQ ID NO: 6), HIV-Tat minimum (SEQ ID NO: 7) or HSPs minimum (SEQ ID NO: 8) to generate the fusion proteins A2M-CD28convPE.sub.t-E7-K3, Tat-CD28convPE.sub.t-E7-K3 and HSP-CD28convPE.sub.t-E7-K3 vaccines, respectively. The TC-1 tumor suppression activity and cell mediated immune responses enhanced by these vaccines are examined using similar methods as described above. Table 1 shows SEQ ID NOs. of the components of various fusion proteins. Table 2 shows the fusion proteins tested for the effects on T cell-mediated immune responses in animals and the sequences of antigens.
TABLE-US-00005 TABLE1 SEQ Length ID (resi- Component NO: dues) hCD28Core 1 28 TDIYFCKIEVMYPPPYLDNEKSNGTIIH hCD28Maximum 2 53 NCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDN EKSNGTIIHVKG PE.sub.tCore(PEtranslocationdomaincore; 3 34 a.a.280-a.a.313ofPE) PE.sub.tMaximum(translocationdomainmaxi, 4 112 a.a.253-a.a.364ofPE) RAP1Minimum(domainIIIofRAP1) 5 104 A2MMinimum 6 153 HIV-TatMinimum 7 24 HSPsMinimum,Heatshock70kDaprotein 8 641 (HSPs;Homosapiens) MinimumPseudomonasexotoxinA(PE) 9 252 bindingdomainIa(anAPC-binding domain,a.a.1-a.a.252ofPE) LinkerRXRXKR,),inwhichX isany 15 6 aminoacidresidue. FulllengthPE(ExotoxinAmature 10 613 form,Pseudomonasaeruginosa) FulllengthRAP1(Homosapienslow 11 323 densitylipoproteinreceptor-related proteinassociatedprotein1, LRPAP1);Domain1:a.a.1-a.a.112; domain2:a.a.113-a.a.218; domain3:a.a.219-a.a.323. FulllengthA2M(Homosapiensalpha2 12 357 macroglobulinreceptor-associated proteinprecursor) HIV-Tat(Humanimmunodeficiencyvirus1) 13 101 KDEL 14 4 KKDLRDELKDEL 16 12 KKDELRDELKDEL 17 13 KKDELRVELKDEL 18 13 KDELKDELKDEL 19 12 PE.sub.268-313 20 46 PLETFTRHRQPRGWEQLEQCGYPVQRLVALYLAARLSWNQV DQVIR CD28convPE.sub.t 30 68 T.sup.1D.sup.2I.sup.3Y.sup.4F.sup.5C.sup.6K.sup.7X.sup.8E.sup.9X.sup.10X.sup.11Y.sup.12P.sup.13P.sup.14P.sup.15Y.sup.16 X.sup.17D.sup.18N.sup.19E.sup.20K.sup.21S.sup.22N.sup.23G.sup.24T.sup.25I.sup.26I.sup.27H.sup.28R.sup.29 X.sup.30R.sup.31X.sup.32K.sup.33R.sup.34G.sup.35W.sup.36E.sup.37Q.sup.38L.sup.39E.sup.40Q.sup.41C.sup.42 G.sup.43Y.sup.44P.sup.45V.sup.46Q.sup.47R.sup.48L.sup.49V.sup.50A.sup.51L.sup.52Y.sup.53L.sup.54A.sup.55 A.sup.56R.sup.57L.sup.58S.sup.59W.sup.60N.sup.61Q.sup.62V.sup.63D.sup.64Q.sup.65V.sup.66I.sup.67R.sup.68, wherein(X).sup.8isIorL;(X).sup.10isV,For A,(X).sup.11isMorL,X.sup.17isLorI, (X).sup.30,32isanyaminoacidresidue. CD28consensussequence 31 28 T.sup.1D.sup.2I.sup.3Y.sup.4F.sup.5C.sup.6K.sup.7(X).sup.8E.sup.9(X).sup.10(X).sup.11Y.sup.12P.sup.13P.sup.14 P.sup.15Y.sup.16X.sup.17D.sup.18N.sup.18E.sup.20K.sup.21S.sup.22N.sup.23G.sup.24T.sup.25I.sup.26I.sup.27 H.sup.28, wherein(X).sup.8isIorL;(X).sup.10isV,For A,(X).sup.11isMorL,X.sup.17isLorI. CD28criticalregion 32 10 K.sup.1(X).sup.2E.sup.3(X).sup.4(X).sup.5Y.sup.6P.sup.7P.sup.8P.sup.9Y.sup.10,wherein(X).sup.2 isIorL;(X).sup.4isV,ForA,(X).sup.5is MorL.
TABLE-US-00006 TABLE 2 Antigen SEQ ID Fusion protein name Antigen Name NO: RAP1-CD28convPE.sub.t-E7-K3 HPV16 E7 (full length) 21 RAP1-CD28convPE.sub.t-E7.sub.18-K3 HPV18 E7 (full length) 22 RAP1-CD28convPE.sub.t-HCVc-K3 HCV core protein (full length) 23 RAP1-CD28convPE.sub.t-HBx-K3 HBV X protein (full length) 24 RAP1-CD28convPE.sub.t-PCV2-K3 PCV2 ORF2 (a fragment 25 of ORF2) RAP1-CD28convPE.sub.t-DGD-K3 PRRSV nucleocapsid 26 (a fusion antigen: ORF7 a.a. 64-a.a. 123, linker and ORF7 a.a. 64-a.a. 123) RAP1-CD28convPE.sub.t-M12-K3 PRRSV RNA-dependent 27 RNA polymerase (ORF1b a.a. 1046-a.a. 1210) RAP1-CD28convPE.sub.t-PQAB-K3 PRRSV American strain: 28 a fusion antigen of ORF6 (a.a. 2-a.a. 26) and ORF5 (a.a. 31-a.a. 63) RAP1-CD28convPE.sub.t-RSAB-K3 PRRSV European strain: 29 a fusion antigen of ORF6 (a.a. 2-a.a. 28) and ORF5 (a.a. 31-a.a. 64)
[0134] In the immunogenicity assays, antigen-specific cell-mediated immune responses induced by various vaccines were evaluated by measuring the numbers of CD3+/CD4+/IFN+ and CD3+/CD8+/IFN+ T cells in the splenocytes. The results indicated that the vaccine RAP1-CD28convPE.sub.t-antigen-K3 can induce strong T cell responses.
[0135] The vaccine RAP1-CD28convPE.sub.t-antigen-K3 is superior to PE.sub.407-antigen-K3 in eliciting T cell-mediated immunogenicity. For example,
[0136] A fusion protein comprising RAP1 domain III, the sensitizing signal CD28conv alone without the translocation peptide PE.sub.t, antigen and an ER retention signal is sufficient in eliciting a strong antigen-specific T cell mediated immune responses when the antigen chosen comprises ten or greater than 10 epitopes.
[0137] It was unexpected that the ER retention signal is not essential for the fusion protein of the invention to elicit a strong cell-mediated immunogenicity. In other words, without the ER retention sequence, the fusion protein of the invention can still elicit strong T-cell responses.
[0138] In contrast, U.S. Pat. Nos. 7,378,100B2 and 7,335,361 show that the ER retention signal K3 is indispensable for PE-related fusion proteins (PE.sub.407-antigen-K3) to elicit T cell responses.
[0139] It was also discovered that a fusion protein comprising RAP1 domain III, the translocation peptide PE.sub.218-313 (without the sensitizing signal CD28conv), antigen and an ER retention signal is superior to a PE-related fusion protein without containing the RAP1 domain III.
[0140] The foregoing description of the exemplary embodiments of the invention has been presented only for the purposes of illustration and description and is not intended to be exhaustive or to limit the invention to the precise forms disclosed. Many modifications and variations are possible in light of the above teaching. The embodiments and examples were chosen and described in order to explain the principles of the invention and their practical application so as to enable others skilled in the art to utilize the invention and various embodiments and with various modifications as are suited to the particular use contemplated. Alternative embodiments will become apparent to those skilled in the art to which the present invention pertains without departing from its spirit and scope. Accordingly, the scope of the present invention is defined by the appended claims rather than the foregoing description and the exemplary embodiments described therein.
[0141] Some references, which may include patents, patent applications and various publications, are cited and discussed in the description of this invention. The citation and/or discussion of such references is provided merely to clarify the description of the present invention and is not an admission that any such reference is prior art to the invention described herein. All references cited and discussed in this specification are incorporated herein by reference in their entireties and to the same extent as if each reference was individually incorporated by reference.