ANTI-PSMA RADIOCONJUGATES AND USES THEREOF

20230122503 · 2023-04-20

    Inventors

    Cpc classification

    International classification

    Abstract

    Disclosed herein are antibodies or antigen binding fragments thereof that bind prostate specific membrane antigen (PSMA), polynucleotides, vectors, host cells, radioconjugates, antibody drug conjugates and methods of treating cancer using the same.

    Claims

    1. A radioimmunoconjugate of formula: ##STR00082## wherein: M.sup.+ is a radiometal ion, wherein M.sup.+ is selected from the group consisting of actinium-225(.sup.225Ac), indium-111 (111In), radium-223 (.sup.233Ra), bismuth-213 (.sup.213Bi), lead-212 (.sup.212Pb(II) and/or .sup.212Pb(IV)), terbium-149 (.sup.149Tb), terbium-152 (.sup.152Tb), terbium-155 (.sup.155Tb), fermium-255 (.sup.255Fm), thorium-227 (.sup.227Th), thorium-226 (.sup.226Th.sup.4+), astatine-211 (.sup.211At), cerium-134 (.sup.134Ce), neodymium-144 (.sup.144Nd), lanthanum-132 (.sup.132La), lanthanum-135 (.sup.135La) and uranium-230 (.sup.230U); and mAb is an antibody or antigen binding fragment that binds to PSMA.

    2. The radioimmunoconjugate of claim 1, wherein the antibody or antigen binding fragment comprises a heavy chain complementarity determining region 1 (HCDR1), a HCDR2, and a HCDR3, and a light chain complementarity determining region 1 (LCDR1), a LCDR2, and LCDR3, wherein the HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3 comprise the amino acid sequences selected from the group consisting of: TABLE-US-00045 a. (SEQ ID NO: 4) RYGMH, (SEQ ID NO: 5) LISYDGSNRYYADSVKG, (SEQ ID NO: 6) ERESSGWFEGYFDY, (SEQ ID NO: 7) GGNNIGSKSVH, (SEQ ID NO: 8) DNSDRPS, and (SEQ ID NO: 9) QVWDSSSDHVV, respectively; b. (SEQ ID NO: 10) SYYWN, (SEQ ID NO: 11) RIYSSGNTDYNPSLKS, (SEQ ID NO: 12) GRGANVGLFDY, (SEQ ID NO: 130 TGSNSNIGANYDVH, (SEQ ID NO: 14) GNINRPL, and (SEQ ID NO: 15) QSYDFSLSGSV, respectively; c. (SEQ ID NO: 16) GYGMH, (SEQ ID NO: 17) VISYDGSNRYYADSVKG, (SEQ ID NO: 18) DGNWGSLDLYFDL, (SEQ ID NO: 19) TGSSSNIGADYDVH, (SEQ ID NO: 20) VNNNRPS, and (SEQ ID NO: 21) QSYDNTLSGVV, respectively; d. (SEQ ID NO: 22) SYGMH, (SEQ ID NO: 23) VISYDGSNKYYADSVKG, (SEQ ID NO: 24) EHYDSSGYYHGYYGMDV, (SEQ ID NO: 25) SGSSSNIGSNYVY, (SEQ ID NO: 26) SNNQRPS,   (SEQ ID NO: 27) AARDDSLSGYV, respectively; e. (SEQ ID NO: 28) SYDMH, (SEQ ID NO: 29) VISFDGSNKYYVDSVKG, (SEQ ID NO: 30) TYYDILTGYSHYSYGMDV, (SEQ ID NO: 31) RASQGISNYLA, (SEQ ID NO: 32) ATSTLQS, and (SEQ ID NO: 33) QKYNSAPFT, respectively; f. (SEQ ID NO: 34) TYGMH, (SEQ ID NO: 35) FISYDGSNKYYADSVKG, (SEQ ID NO: 36) RDNLRFLEWFMDV, (SEQ ID NO: 37) RASQSVRSNLA, (SEQ ID NO: 38) GASTRAT, and (SEQ ID NO: 39) HQYNDWPPYT, respectively; g. (SEQ ID NO: 40) IYSMN, (SEQ ID NO: 41) SISSSSSYIFYADSVKG,   (SEQ ID NO: 42) SSYGADY, (SEQ ID NO: 43) RASQDITNFLA, (SEQ ID NO: 44) TASTLQS, and (SEQ ID NO: 45) QKYNSAPLT, respectively; h. (SEQ ID NO: 46) SYSLN, (SEQ ID NO: 47) SISSSSSYISYADAVKG, (SEQ ID NO: 48) DRGFLEDYYYYYGMDV,   (SEQ ID NO: 49) RASQGISNWLA, (SEQ ID NO: 50) VASSLQS, and (SEQ ID NO: 51 QQAYSFPLT, respectively; i. (SEQ ID NO: 272) SYYWS, (SEQ ID NO: 273) RIYSSGSTNYNPSLKS, (SEQ ID NO: 274) VGVWPGAFDI, (SEQ ID NO: 275) SGSSSNIGSNTVN, (SEQ ID NO: 276) SSNQRPS and (SEQ ID NO: 277) AAWDDSLNGVV, respectively; j. (SEQ ID NO: 124) GFTLSRY, (SEQ ID NO: 125) SYDGSN, (SEQ ID NO: 6) ERESSGWFEGYFDY, (SEQ ID NO: 7) GGNNIGSKSVH, (SEQ ID NO: 8) DNSDRPS and (SEQ ID NO: 9) QVWDSSSDHVV, respectively; k. (SEQ ID NO: 130) GGSISSY, (SEQ ID NO: 131) YSSGN, (SEQ ID NO: 12) GRGANVGLFDY, (SEQ ID NO: 13) TGSNSNIGANYDVH, (SEQ ID NO: 14) GNINRPL, and (SEQ ID NO: 15) QSYDFSLSGSV, respectively; l. (SEQ ID NO: 136) VRTFSGY, (SEQ ID NO: 125) SYDGSN, (SEQ ID NO: 18) DGNWGSLDLYFDL, (SEQ ID NO: 19) TGSSSNIGADYDVH, (SEQ ID NO: 20) VNNNRPS, and (SEQ ID NO: 21) QSYDNTLSGVV, respectively; m. (SEQ ID NO: 142) GFTFTSY, (SEQ ID NO: 125) SYDGSN, (SEQ ID NO: 24) EHYDSSGYYHGYYGMDV, (SEQ ID NO: 25) SGSSSNIGSNYVY, (SEQ ID NO: 26) SNNQRPS, and (SEQ ID NO: 27) AARDDSLSGYV, respectively; n. (SEQ ID NO: 148) GFTFSSY, (SEQ ID NO: 149) SFDGSN, (SEQ ID NO: 30) TYYDILTGYSHYSYGMDV, (SEQ ID NO: 31) RASQGISNYLA, (SEQ ID NO: 32) ATSTLQS, and (SEQ ID NO: 33) QKYNSAPFT, respectively; o. (SEQ ID NO: 154) GFTFSTY, (SEQ ID NO: 125) SYDGSN, (SEQ ID NO: 36) RDNLRFLEWFMDV, (SEQ ID NO: 37) RASQSVRSNLA, (SEQ ID NO: 38) GASTRAT, and (SEQ ID NO: 39) HQYNDWPPYT, respectively; p. (SEQ ID NO: 160) GFTLSIY, (SEQ ID NO: 161) SSSSSY, (SEQ ID NO: 42) SSYGADY, (SEQ ID NO: 43) RASQDITNFLA, (SEQ ID NO: 44) TASTLQS, and (SEQ ID NO: 45) QKYNSAPLT, respectively; q. (SEQ ID NO: 166) GFTFSSY, (SEQ ID NO: 167) SSSSSY, (SEQ ID NO; 48) DRGFLEDYYYYYGMDV, (SEQ ID NO: 49) RASQGISNWLA, (SEQ ID NO: 50) VASSLQS, and (SEQ ID NO: 51) QQAYSFPLT, respectively; r. (SEQ ID NO: 290) GGSIISY, (SEQ ID NO: 291) YSSGS, (SEQ ID NO: 274) VGVWPGAFDI, (SEQ ID NO: 275) SGSSSNIGSNTVN, (SEQ ID NO: 276) SSNQRPS, and (SEQ ID NO: 277) AAWDDSLNGVV, respectively; s. (SEQ ID NO: 172) GFTLSRYGMH, (SEQ ID NO: 173) LISYDGSNRY, (SEQ ID NO: 6) ERESSGWFEGYFDY, (SEQ ID NO: 7) GGNNIGSKSVH, (SEQ ID NO: 8) DNSDRPS, and (SEQ ID NO: 9) QVWDSSSDHVV, respectively; t. (SEQ ID NO: 178) GGSISSYYWN, (SEQ ID NO: 179) RIYSSGNTD, (SEQ ID NO: 12) GRGANVGLFDY, (SEQ ID NO: 13) TGSNSNIGANYDVH, (SEQ ID NO: 14) GNINRPL, and (SEQ ID NO: 15) QSYDFSLSGSV, respectively; u. (SEQ ID NO: 184) VRTFSGYGMH, (SEQ ID NO: 185) VISYDGSNRY, (SEQ ID NO: 18) DGNWGSLDLYFDL, (SEQ ID NO: 19) TGSSSNIGADYDVH, (SEQ ID NO: 20) VNNNRPS, and (SEQ ID NO: 21) QSYDNTLSGVV, respectively; v. (SEQ ID NO: 190) GFTFTSYGMH, (SEQ ID NO: 191) VISYDGSNKY, (SEQ ID NO: 24) EHYDSSGYYHGYYGMDV, (SEQ ID NO: 25) SGSSSNIGSNYVY, (SEQ ID NO: 26) SNNQRPS, and (SEQ ID NO: 27) AARDDSLSGYV, respectively; w. (SEQ ID NO: 196) GFTFSSYDMH, (SEQ ID NO: 197) VISFDGSNKY, (SEQ ID NO: 30) TYYDILTGYSHYSYGMDV, (SEQ ID NO: 31) RASQGISNYLA, (SEQ ID NO: 32) ATSTLQS, and (SEQ ID NO: 33) QKYNSAPFT, respectively; x. (SEQ ID NO: 202) GFTFSTYGMH, (SEQ ID NO: 203) FISYDGSNKY, (SEQ ID NO: 36) RDNLRFLEWFMDV, (SEQ ID NO: 37) RASQSVRSNLA, (SEQ ID NO: 38) GASTRAT, and (SEQ ID NO: 39) HQYNDWPPYT, respectively; y. (SEQ ID NO: 208) GFTLSIYSMN, (SEQ ID NO: 209) SISSSSSYIF, (SEQ ID NO: 42) SSYGADY, (SEQ ID NO: 43) RASQDITNFLA,, (SEQ ID NO: 44) TASTLQS, and (SEQ ID NO: 45) QKYNSAPLT, respectively; z. (SEQ ID NO: 214) GFTFSSYSLN, (SEQ ID NO: 215) SISSSSSYIS, (SEQ ID NO: 48) DRGFLEDYYYYYGMDV, (SEQ ID NO: 49) RASQGISNWL, (SEQ ID NO: 50) VASSLQS, and (SEQ ID NO: 51) QQAYSF, respectively; aa. (SEQ ID NO: 296) GGSIISYYWS, (SEQ ID NO: 297) RIYSSGSTN, (SEQ ID NO: 274) VGVWPGAFDI, (SEQ ID NO: 275) SGSSSNIGSNTVN, (SEQ ID NO: 276) SSNQRPS, and (SEQ ID NO: 277) AAWDDSLNGVV, respectively; bb. (SEQ ID NO: 220) GFTLSRYG, (SEQ ID NO: 221) ISYDGSNR, (SEQ ID NO: 222) ARERESSGWFEGYFDY, (SEQ ID NO: 223) NIGSKS, DNS, and (SEQ ID NO: 9) QVWDSSSDHVV, respectively; cc. (SEQ ID NO: 226) GGSISSYY, (SEQ ID NO: 227) IYSSGNT, (SEQ ID NO: 228) ARGRGANVGLFDY, (SEQ ID NO: 229) NSNIGANYD, GNI, and (SEQ ID NO: 15) QSYDFSLSGSV, respectively; dd. (SEQ ID NO: 232) VRTFSGYG, (SEQ ID NO: 233) ISYDGSNR, (SEQ ID NO: 234) ARDGNWGSLDLYFDL, (SEQ ID NO: 235) SSNIGADYD, VNN, and (SEQ ID NO: 21) QSYDNTLSGVV, respectively; ee. (SEQ ID NO: 238) GFTFTSYG, (SEQ ID NO: 239 ISYDGSNK, (SEQ ID NO: 240) AREHYDSSGYYHGYYGMDV, (SEQ ID NO: 241) SSNIGSNY, SNN, and (SEQ ID NO: 27) AARDDSLSGYV, respectively; ff. (SEQ ID NO: 244) GFTFSSYD, (SEQ ID NO: 245) ISFDGSNK, (SEQ ID NO: 246) ARTYYDILTGYSHYSYGMDV, (SEQ ID NO: 247) QGISNY, ATS, and (SEQ ID NO: 33) QKYNSAPFT, respectively; gg. (SEQ ID NO: 250) GFTFSTYG, (SEQ ID NO: 251) ISYDGSNK, (SEQ ID NO: 252) AGRDNLRFLEWFMDV, (SEQ ID NO: 253) QSVRSN, GAS, and (SEQ ID NO: 39) HQYNDWPPYT, respectively; hh. (SEQ ID NO: 256) GFTLSIYS, (SEQ ID NO: 257) ISSSSSYI, (SEQ ID NO: 258) ARSSYGADY, (SEQ ID NO: 259) QDITNF, TAS, and (SEQ ID NO: 45) QKYNSAPLT, respectively; ii. (SEQ ID NO: 262) GFTFSSYS, (SEQ ID NO: 263) ISSSSSYI, (SEQ ID NO: 264) ARDRGFLEDYYYYYGMDV, (SEQ ID NO: 265) QGISNW, VAS, and (SEQ ID NO: 51) QQAYSFPLT, respectively; and jj. (SEQ ID NO: 302) GGSIISYY, (SEQ ID NO: 303) IYSSGST,  (SEQ ID NO: 304) AKVGVWPGAFDI, (SEQ ID NO: 305) SSNIGSNT, SSN, and (SEQ ID NO: 277) AAWDDSLNGVV, respectively.

    3. The radioimmunoconjugate of claim 1, wherein the antibody or the antigen binding fragment comprises a heavy chain variable region (VH) and a light chain variable region (VL) selected from: a. SEQ ID NOs: 52 and 53 respectively; b. SEQ ID NOs: 54 and 55 respectively; c. SEQ ID NOs: 56 and 57 respectively; d. SEQ ID NOs: 58 and 59 respectively; e. SEQ ID NOs: 60 and 61 respectively; f. SEQ ID NOs: 62 and 63 respectively; g. SEQ ID NOs: 64 and 65 respectively; h. SEQ ID NOs: 66 and 67 respectively; and i. SEQ ID NOs: 278 and 279 respectively.

    4. The radioimmunoconjugate of claim 1, wherein the antibody or the antigen binding fragment comprises a heavy chain amino acid sequence selected from SEQ ID NOs. 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 268, 282, 284, and 288; and a light chain amino acid sequence selected from SEQ ID NOs. 85, 89, 93, 95, 97, 99, 101, 103, and 269.

    5. The radioimmunoconjugate of claim 1, wherein the antibody or the antigen binding fragment is of an IgG1, an IgG2, an IgG3 or an IgG4 isotype.

    6. The radioimmunoconjugate of claim 5, wherein the antibody or antigen binding fragment is an IgG1 isotype.

    7. The radioimmunoconjugate of claim 1, wherein the antibody or the antigen binding fragment further comprises an Ig constant region, wherein the Ig constant region comprises at least one mutation that results in reduced binding of the antibody or antigen binding fragment thereof to a Fcγ receptor (FcγR).

    8. The radioimmunoconjugate of claim 7, wherein the at least one mutation that results in reduced binding of the protein to the FcγR is selected from the group consisting of F234A/L235A, L234A/L235A, L234A/L235A/D265S, V234A/G237A/P238S/H268A/V309L/A330S/P331S, F234A/L235A, S228P/F234A/L235A, N297A, V234A/G237A, K214T/E233P/L234V/L235A/G236-deleted/A327G/P331A/D365E/L358M, H268Q/V309L/A330S/P331S, S267E/L328F, L234F/L235E/D265A, L234A/L235A/G237A/P238S/H268A/A330S/P331S, S228P/F234A/L235A/G237A/P238S and S228P/F234A/L235A/G236-deleted/G237A/P238S, wherein residue numbering is according to the EU index.

    9. The radioimmunoconjugate of claim 8, wherein the mutations that results in reduced binding of the antibody or antigen binding fragment thereof to the FcγR are L234A, L235A, and D265S.

    10. The radioimmunoconjugate of claim 1, wherein the antibody or the antigen binding fragment further comprises an Ig constant region, wherein the IgG constant region comprises at least one mutation that modulates a half-life of the antibody.

    11. The radioimmunoconjugate of claim 10, wherein at least one mutation that modulates the half-life of the antibody is selected from the group consisting of H435A, P257I/N434H, D376V/N434H, M252Y/S254T/T256E, M252Y/S254T/T256E/H433K/N434F, T308P/N434A and H435R, wherein residue numbering is according to the EU index.

    12. The radioimmunoconjugate of claim 11, wherein the mutations that modulates the half-life of the antibody or antigen binding fragment thereof are M252Y, S254T, and T256E mutations.

    13. A radioimmunoconjugate of formula ##STR00083## wherein: M.sup.+ is .sup.225Ac or .sup.111In; and wherein mAb is an antibody or an antigen binding fragment that binds to PSMA and comprises: a. a heavy chain variable region (VH) comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:4, a VH CDR2 having an amino acid sequence of and SEQ ID NO:5 and a VH CDR3 having an amino acid sequence of SEQ ID NO:6; and a light chain variable region (VL) comprising a VL CDR1 having an amino acid sequence of SEQ ID NO:7, a VL CDR2 having an amino acid sequence of and SEQ ID NO:8 and a VL CDR3 having an amino acid sequence of SEQ ID NO:9; or b. a heavy chain variable region (VH) comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:10, a VH CDR2 having an amino acid sequence of and SEQ ID NO:11 and a VH CDR3 having an amino acid sequence of SEQ ID NO: 12; and a light chain variable region (VL) comprising a VL CDR1 having an amino acid sequence of SEQ ID NO: 13, a VL CDR2 having an amino acid sequence of and SEQ ID NO: 14 and a VL CDR3 having an amino acid sequence of SEQ ID NO: 15.

    14. A radioimmunoconjugate of formula ##STR00084## wherein: M.sup.+ is .sup.225Ac or .sup.111In; and wherein mAb is an antibody or an antigen binding fragment that binds to PSMA and comprises: a. a heavy chain variable region (VH) comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:4, a VH CDR2 having an amino acid sequence of and SEQ ID NO:5 and a VH CDR3 having an amino acid sequence of SEQ ID NO:6; and a light chain variable region (VL) comprising a VL CDR1 having an amino acid sequence of SEQ ID NO:7, a VL CDR2 having an amino acid sequence of and SEQ ID NO:8 and a VL CDR3 having an amino acid sequence of SEQ ID NO:9; or b. a heavy chain variable region (VH) comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:10, a VH CDR2 having an amino acid sequence of and SEQ ID NO:11 and a VH CDR3 having an amino acid sequence of SEQ ID NO: 12; and a light chain variable region (VL) comprising a VL CDR1 having an amino acid sequence of SEQ ID NO: 13, a VL CDR2 having an amino acid sequence of and SEQ ID NO: 14 and a VL CDR3 having an amino acid sequence of SEQ ID NO: 15.

    15. A pharmaceutical composition comprising a radioimmunoconjugate of claim 1, and a pharmaceutically acceptable carrier.

    16. A method of treating a PSMA expressing cancer in a subject in need thereof, comprising administering a therapeutically effective amount of the radioimmunoconjugate of claim 1.

    17. The method of claim 16, wherein the PSMA expressing cancer is prostate cancer.

    18. The method of claim 17, wherein the prostate cancer is a metastatic castration-resistant cancer (mCRPC).

    19. A method of detecting a PSMA expressing cancer in a subject comprises contacting subject's sample with a radioimmunoconjugate of claim 1.

    20. The method of claim 19, wherein the subject's sample is derived from urine, blood, serum, plasma, saliva, ascites, circulating cells, and circulating tumor cells.

    21. A kit comprising a radioimmunoconjugate of claim 1, reagents, and instructions for using the radioimmunoconjugate.

    Description

    DETAILED DESCRIPTION OF THE INVENTION

    [0119] Various publications, articles and patents are cited or described in the background and throughout the specification; each of these references in herein incorporated by reference in its entirety. Discussion of documents, acts, materials, devices, articles or the like which has been included in the present specification is for the purpose of providing context for the invention. Such discussion is not an admission that any or all of these matters form part of the prior art with respect to any inventions disclosed or claimed.

    [0120] The disclosed isolated anti-PSMA antibody, antigen binding fragment thereof, radioconjugates, antibody-drug conjugates, polynucleotides, vectors, cells, compositions, kits, and methods may be understood more readily by reference to the following detailed description taken in connection with the accompanying figures, which form a part of this disclosure. It is to be understood that the disclosed antibodies, antigen binding domains, antibody fragments, radioconjugates, antibody-drug conjugates, polynucleotides, vectors, cells, compositions, kits, and methods are not limited to those specifically described and/or shown herein, and that the terminology used herein is for the purpose of describing particular embodiments by way of example only and is not intended to be limiting of the claimed antibody, antigen binding domains, antibody fragments, radioconjugates, antibody-drug conjugates, polynucleotides, vectors, cells, compositions, kits, and methods.

    [0121] Unless specifically stated otherwise, any description as to a possible mechanism or mode of action or reason for improvement is meant to be illustrative only, and the disclosed antibodies, antigen binding fragments thereof, polynucleotides, vectors, cells, radioconjugates, antibody-drug conjugates, compositions, kits, and methods are not to be constrained by the correctness or incorrectness of any such suggested mechanism or mode of action or reason for improvement.

    [0122] Throughout this text, the descriptions refer to antibodies, antigen binding fragments thereof, radioconjugates, antibody drug conjugates and methods of using said antibodies, antigen binding fragments thereof, radioconjugates, and antibody drug conjugates. Where the disclosure describes or claims a feature or embodiment associated with an antigen binding domain, radioconjugate, and antibody-drug conjugate such a feature or embodiment is equally applicable to the methods of using said antigen binding domains, radioconjugate, and antibody-drug conjugate. Likewise, where the disclosure describes or claims a feature or embodiment associated with a method of using an antigen binding domains, radioconjugate, and antibody-drug conjugate such a feature or embodiment is equally applicable to the antigen binding domain, radioconjugate, and antibody-drug conjugate. Where a range of numerical values is recited or established herein, the range includes the endpoints thereof and all the individual integers and fractions within the range, and also includes each of the narrower ranges therein formed by all the various possible combinations of those endpoints and internal integers and fractions to form subgroups of the larger group of values within the stated range to the same extent as if each of those narrower ranges was explicitly recited. Where a range of numerical values is stated herein as being greater than a stated value, the range is nevertheless finite and is bounded on its upper end by a value that is operable within the context of the invention as described herein. Where a range of numerical values is stated herein as being less than a stated value, the range is nevertheless bounded on its lower end by a non-zero value. It is not intended that the scope of the invention be limited to the specific values recited when defining a range. All ranges are inclusive and combinable.

    [0123] When values are expressed as approximations, by use of the antecedent “about,” it will be understood that the particular value forms another embodiment. Reference to a particular numerical value includes at least that particular value, unless the context clearly dictates otherwise.

    [0124] It is to be appreciated that certain features of the invention which are, for clarity, described herein in the context of separate embodiments may also be provided in combination in a single embodiment. That is, unless obviously incompatible or specifically excluded, each individual embodiment is deemed to be combinable with any other embodiment(s) and such a combination is considered to be another embodiment. Conversely, various features of the invention that are, for brevity, described in the context of a single embodiment, may also be provided separately or in any sub-combination. Finally, although an embodiment may be described as part of a series of steps or part of a more general structure, each said step may also be considered an independent embodiment in itself, combinable with others.

    [0125] Unless specifically stated otherwise, any description as to a possible mechanism or mode of action or reason for improvement is meant to be illustrative only, and the disclosed methods are not to be constrained by the correctness or incorrectness of any such suggested mechanism or mode of action or reason for improvement.

    [0126] Various terms relating to aspects of the description are used throughout the specification and claims. Such terms are to be given their ordinary meaning in the art unless otherwise indicated. Other specifically defined terms are to be construed in a manner consistent with the definitions provided herein.

    [0127] As used in this specification and the appended claims, the singular forms “a,” “an,” and “the” include plural referents unless the content clearly dictates otherwise. Thus, for example, reference to “a cell” includes a combination of two or more cells, and the like.

    [0128] The transitional terms “comprising,” “consisting essentially of,” and “consisting of” are intended to connote their generally accepted meanings in the patent vernacular; that is, (i) “comprising,” which is synonymous with “including,” “containing,” or “characterized by,” is inclusive or open-ended and does not exclude additional, unrecited elements or method steps; (ii) “consisting of” excludes any element, step, or ingredient not specified in the claim; and (iii) “consisting essentially of” limits the scope of a claim to the specified materials or steps “and those that do not materially affect the basic and novel characteristic(s)” of the claimed disclosure. Embodiments described in terms of the phrase “comprising” (or its equivalents) also provide as embodiments those independently described in terms of “consisting of” and “consisting essentially of” Embodiments described in terms of the phrase “consisting essentially of” (or its equivalents) also provide as embodiments those independently described in terms of “consisting of.”

    [0129] As used in this specification and the appended claims, the phrase “and fragments thereof” when appended to a list includes fragments of one or more members of the associated list. The list may comprise a Markush group so that, as an example, the phrase “the group consisting of peptides A, B, and C, and fragments thereof” specifies or recites a Markush group including A, B, C, fragments of A, fragments of B, and/or fragments of C.

    [0130] Generally, reference to a certain element such as hydrogen or H is meant to include all isotopes of that element. For example, if an R group is defined to include hydrogen or H, it also includes deuterium and tritium. Compounds comprising radioisotopes such as tritium, C.sup.14, P.sup.32 and S.sup.35 are thus within the scope of the present technology. Procedures for inserting such labels into the compounds of the present technology will be readily apparent to those skilled in the art based on the disclosure herein.

    [0131] The term “substituted” means that at least one hydrogen atom is replaced with a non-hydrogen group, provided that all normal valencies are maintained and that the substitution results in a stable compound. When a particular group is “substituted,” that group can have one or more substituents, preferably from one to five substituents, more preferably from one to three substituents, most preferably from one to two substituents, independently selected from the list of substituents. For example, “substituted” refers to an organic group as defined below (e.g., an alkyl group) in which one or more bonds to a hydrogen atom contained therein are replaced by a bond to non-hydrogen or non-carbon atoms. Substituted groups also include groups in which one or more bonds to a carbon(s) or hydrogen(s) atom are replaced by one or more bonds, including double or triple bonds, to a heteroatom. Thus, a substituted group is substituted with one or more substituents, unless otherwise specified. In some embodiments, a substituted group is substituted with 1, 2, 3, 4, 5, or 6 substituents. Examples of substituent groups include: halogens (i.e., F, Cl, Br, and I); hydroxyls; alkoxy, alkenoxy, aryloxy, aralkyloxy, heterocyclyl, heterocyclylalkyl, heterocyclyloxy, and heterocyclylalkoxy groups; carbonyls (oxo); carboxylates; esters; urethanes; oximes; hydroxylamines; alkoxyamines; aralkoxyamines; thiols; sulfides; sulfoxides; sulfones; sulfonyls; pentafluorosulfanyl (i.e., SFs), sulfonamides; amines; N-oxides; hydrazines; hydrazides; hydrazones; azides; amides; ureas; amidines; guanidines; enamines; imides; isocyanates; isothiocyanates; cyanates; thiocyanates; imines; nitro groups; nitriles (i.e., CN); and the like. The term “independently” when used in reference to substituents, means that when more than one of such substituents is possible, such substituents can be the same or different from each other.

    [0132] Substituted ring groups such as substituted cycloalkyl, aryl, heterocyclyl and heteroaryl groups also include rings and ring systems in which a bond to a hydrogen atom is replaced with a bond to a carbon atom. Therefore, substituted cycloalkyl, aryl, heterocyclyl and heteroaryl groups may also be substituted with substituted or unsubstituted alkyl, alkenyl, and alkynyl groups as defined below.

    [0133] As used herein, Cm-Cn, such as C.sub.1-C.sub.11, C.sub.1-C.sub.8, or C.sub.1-C.sub.6 when used before a group refers to that group containing m to n carbon atoms.

    [0134] Alkyl groups include straight chain and branched chain alkyl groups having from 1 to 12 carbon atoms, and typically from 1 to 10 carbons or, in some embodiments, from 1 to 8, 1 to 6, or 1 to 4 carbon atoms. Examples of straight chain alkyl groups include groups such as methyl, ethyl, n-propyl, n-butyl, n-pentyl, n-hexyl, n-heptyl, and n-octyl groups. Examples of branched alkyl groups include, but are not limited to, isopropyl, iso-butyl, sec-butyl, tert-butyl, neopentyl, isopentyl, and 2,2-dimethylpropyl groups. Alkyl groups may be substituted or unsubstituted. Representative substituted alkyl groups may be substituted one or more times with substituents such as those listed above, and include without limitation haloalkyl (e.g., trifluoromethyl), hydroxyalkyl, thioalkyl, aminoalkyl, alkylaminoalkyl, dialkylaminoalkyl, alkoxyalkyl, carboxyalkyl, and the like.

    [0135] Cycloalkyl groups include mono-, bi- or tricyclic alkyl groups having from 3 to 12 carbon atoms in the ring(s), or, in some embodiments, 3 to 10, 3 to 8, or 3 to 4, 5, or 6 carbon atoms. Exemplary monocyclic cycloalkyl groups include, but not limited to, cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, and cyclooctyl groups. In some embodiments, the cycloalkyl group has 3 to 8 ring members, whereas in other embodiments the number of ring carbon atoms range from 3 to 5, 3 to 6, or 3 to 7. Bi- and tricyclic ring systems include both bridged cycloalkyl groups and fused rings, such as, but not limited to, bicyclo[2.1.1]hexane, 22damantly, decalinyl, and the like. Cycloalkyl groups may be substituted or unsubstituted. Substituted cycloalkyl groups may be substituted one or more times with, non-hydrogen and non-carbon groups as defined above. However, substituted cycloalkyl groups also include rings that are substituted with straight or branched chain alkyl groups as defined above. Representative substituted cycloalkyl groups may be mono-substituted or substituted more than once, such as, but not limited to, 2,2-, 2,3-, 2,4- 2,5- or 2,6-disubstituted cyclohexyl groups, which may be substituted with substituents such as those listed above.

    [0136] Cycloalkylalkyl groups are alkyl groups as defined above in which a hydrogen or carbon bond of an alkyl group is replaced with a bond to a cycloalkyl group as defined above. In some embodiments, cycloalkylalkyl groups have from 4 to 16 carbon atoms, 4 to 12 carbon atoms, and typically 4 to 10 carbon atoms. Cycloalkylalkyl groups may be substituted or unsubstituted. Substituted cycloalkylalkyl groups may be substituted at the alkyl, the cycloalkyl or both the alkyl and cycloalkyl portions of the group. Representative substituted cycloalkylalkyl groups may be mono-substituted or substituted more than once, such as, but not limited to, mono-, di- or tri-substituted with substituents such as those listed above.

    [0137] Alkenyl groups include straight and branched chain alkyl groups as defined above, except that at least one double bond exists between two carbon atoms. Alkenyl groups have from 2 to 12 carbon atoms, and typically from 2 to 10 carbons or, in some embodiments, from 2 to 8, 2 to 6, or 2 to 4 carbon atoms. In some embodiments, an alkenyl can have one carbon-carbon double bond, or multiple carbon-carbon double bonds, such as 2, 3, 4 or more carbon-carbon double bonds. Examples of alkenyl groups include, but are not limited to methenyl, ethenyl, propenyl, butenyl, etc. Alkenyl groups may be substituted or unsubstituted. Representative substituted alkenyl groups may be mono-substituted or substituted more than once, such as, but not limited to, mono-, di- or tri-substituted with substituents such as those listed above.

    [0138] Cycloalkenyl groups include cycloalkyl groups as defined above, having at least one double bond between two carbon atoms. Cycloalkenyl group can be a mono- or polycyclic alkyl group having from 3 to 12, more preferably from 3 to 8 carbon atoms in the ring(s) and comprising at least one double bond between two carbon atoms. Cycloalkenyl groups may be substituted or unsubstituted. In some embodiments the cycloalkenyl group may have one, two or three double bonds or multiple carbon-carbon double bonds, such as 2, 3, 4, or more carbon-carbon double bonds. but does not include aromatic compounds. Cycloalkenyl groups have from 3 to 14 carbon atoms, or, in some embodiments, 5 to 14 carbon atoms, 5 to 10 carbon atoms, or even 5, 6, 7, or 8 carbon atoms. Examples of cycloalkenyl groups include cyclohexenyl, cyclopentenyl, cyclohexadienyl, cyclobutadienyl, and cyclopentadienyl.

    [0139] Cycloalkenylalkyl groups are alkyl groups as defined above in which a hydrogen or carbon bond of the alkyl group is replaced with a bond to a cycloalkenyl group as defined above. Cycloalkenylalkyl groups may be substituted or unsubstituted. Substituted cycloalkenylalkyl groups may be substituted at the alkyl, the cycloalkenyl or both the alkyl and cycloalkenyl portions of the group. Representative substituted cycloalkenylalkyl groups may be substituted one or more times with substituents such as those listed above.

    [0140] Alkynyl groups include straight and branched chain alkyl groups as defined above, except that at least one triple bond exists between two carbon atoms. Alkynyl groups have from 2 to 12 carbon atoms, and typically from 2 to 10 carbons or, in some embodiments, from 2 to 8, 2 to 6, or 2 to 4 carbon atoms. In some embodiments, the alkynyl group has one, two, or three carbon-carbon triple bonds. Examples include, but are not limited to —C═CH, —C═CCH.sub.3, —CH.sub.2C═CCH.sub.3, —C═CCH.sub.2CH(CH.sub.2CH.sub.3).sub.2, among others. Alkynyl groups may be substituted or unsubstituted. A terminal alkyne has at least one hydrogen atom bonded to a triply bonded carbon atom. Representative substituted alkynyl groups may be mono-substituted or substituted more than once, such as, but not limited to, mono-, di- or trisubstituted with substituents such as those listed above. A “cyclic alkyne” or “cycloalkynyl” is a cycloalkyl ring comprising at least one triple bond between two carbon atoms. Examples of cyclic alkynes or cycloalkynyl groups include, but are not limited to, cyclooctyne, bicyclononyne (BCN), difluorinated cyclooctyne (DIFO), dibenzocyclooctyne (DIBO), keto-DIBO, biarylazacyclooctynone (BARAC), dibenzoazacyclooctyne (DIBAC), dimethoxyazacyclooctyne (DIMAC), difluorobenzocyclooctyne (DIFBO), monobenzocyclooctyne (MOBO), and tetramethoxy DIBO (TMDIBO).

    [0141] Aryl groups are cyclic aromatic hydrocarbons that do not contain heteroatoms. Aryl groups herein include monocyclic, bicyclic and tricyclic ring systems. Thus, aryl groups include, but are not limited to, phenyl, azulenyl, heptalenyl, biphenyl, fluorenyl, phenanthrenyl, anthracenyl, indenyl, indanyl, pentalenyl, and naphthyl groups. In some embodiments, aryl groups contain 6-14 carbons, and in others from 6 to 12 or even 6-10 carbon atoms in the ring portions of the groups. In some embodiments, the aryl groups are phenyl or naphthyl. Aryl groups may be substituted or unsubstituted. The phrase “aryl groups” includes groups containing fused rings, such as fused aromatic-aliphatic ring systems (e.g., indanyl, tetrahydronaphthyl, and the like). Representative substituted aryl groups may be monosubstituted or substituted more than once. For example, monosubstituted aryl groups include, but are not limited to, 2-, 3-, 4-, 5-, or 6-substituted phenyl or naphthyl groups, which may be substituted with substituents such as those listed above. Aryl moieties are well known and described, for example, in Lewis, R. J., ed., Hawley's Condensed Chemical Dictionary, 13.sup.th Edition, John Wiley & Sons, Inc., New York (1997). An aryl group can be a single ring structure (i.e., monocyclic) or comprise multiple ring structures (i.e., polycyclic) that are fused ring structures. Preferably, an aryl group is a monocyclic aryl group.

    [0142] Alkoxy groups are hydroxyl groups (—OH) in which the bond to the hydrogen atom is replaced by a bond to a carbon atom of a substituted or unsubstituted alkyl group as defined above. Examples of linear alkoxy groups include but are not limited to methoxy, ethoxy, propoxy, butoxy, pentoxy, hexoxy, and the like. Examples of branched alkoxy groups include but are not limited to isopropoxy, sec-butoxy, tert-butoxy, isopentoxy, isohexoxy, and the like. Examples of cycloalkoxy groups include but are not limited to cyclopropyloxy, cyclobutyloxy, cyclopentyloxy, cyclohexyloxy, and the like. Alkoxy groups may be substituted or unsubstituted. Representative substituted alkoxy groups may be substituted one or more times with substituents such as those listed above.

    [0143] Similarly, alkylthio or thioalkoxy refers to an —SR group in which R is an alkyl attached to the parent molecule through a sulfur bridge, for example, —S-methyl, —S-ethyl, etc. Representative examples of alkylthio include, but are not limited to, —SCH.sub.3, —SCH.sub.2CH.sub.3, etc.

    [0144] The term “halogen” as used herein refers to bromine, chlorine, fluorine, or iodine. Correspondingly, the term “halo” means fluoro, chloro, bromo, or iodo. In some embodiments, the halogen is fluorine. In other embodiments, the halogen is chlorine or bromine.

    [0145] The terms “hydroxy” and “hydroxyl” can be used interchangeably and refer to —OH.

    [0146] The term “carboxy” refers to —COOH.

    [0147] The term “cyano” refers to —CN.

    [0148] The term “nitro” refers to —NO.sub.2.

    [0149] The term “isothiocyanate” refers to —N═C═S.

    [0150] The term “isocyanate” refers to —N═C═O.

    [0151] The term “azido” refers to —N.sub.3.

    [0152] The term “amino” refers to —NH.sub.2. The term “alkylamino” refers to an amino group in which one or both of the hydrogen atoms attached to nitrogen is substituted with an alkyl group. An alkylamine group can be represented as —NR.sub.2 in which each R is independently a hydrogen or alkyl group. For example, alkylamine includes methylamine (—NHCH.sub.3), dimethylamine (—N(CH.sub.3).sub.2), —NHCH.sub.2CH.sub.3, etc. The term “aminoalkyl” as used herein is intended to include both branched and straight-chain saturated aliphatic hydrocarbon groups substituted with one or more amino groups. Representative examples of aminoalkyl groups include, but are not limited to, —CH.sub.2NH.sub.2, —CH.sub.2CH.sub.2NH.sub.2, and —CH.sub.2CH(NH.sub.2)CH.sub.3.

    [0153] As used herein, “amide” refers to —C(O)NI.sub.2, wherein each R is independently an alkyl group or a hydrogen. Examples of amides include, but are not limited to, —C(O)NH.sub.2, —C(O)NHCH.sub.3, and —C(O)N(CH.sub.3).sub.2.

    [0154] The terms “hydroxylalkyl” and “hydroxyalkyl” are used interchangeably, and refer to an alkyl group substituted with one or more hydroxyl groups. The alkyl can be a branched or straight-chain aliphatic hydrocarbon. Examples of hydroxylalkyl include, but are not limited to, hydroxylmethyl (—CH.sub.2OH), hydroxylethyl (—CH.sub.2CH.sub.2OH), etc.

    [0155] As used herein, the term “heterocyclyl” includes stable monocyclic and polycyclic hydrocarbons that contain at least one heteroatom ring member, such as sulfur, oxygen, or nitrogen. As used herein, the term “heteroaryl” includes stable monocyclic and polycyclic aromatic hydrocarbons that contain at least one heteroatom ring member such as sulfur, oxygen, or nitrogen. Heteroaryl can be monocyclic or polycyclic, e.g., bicyclic or tricyclic. Each ring of a heterocyclyl or heteroaryl group containing a heteroatom can contain one or two oxygen or sulfur atoms and/or from one to four nitrogen atoms provided that the total number of heteroatoms in each ring is four or less and each ring has at least one carbon atom. Heteroaryl groups which are polycyclic, e.g., bicyclic or tricyclic must include at least one fully aromatic ring but the other fused ring or rings can be aromatic or non-aromatic. The heterocyclyl or heteroaryl group can be attached at any available nitrogen or carbon atom of any ring of the heterocyclyl or heteroaryl group. Preferably, the term “heteroaryl” refers to 5- or 6-membered monocyclic groups and 9- or 10-membered bicyclic groups which have at least one heteroatom (O, S, or N) in at least one of the rings, wherein the heteroatom-containing ring preferably has 1, 2, or 3 heteroatoms, more preferably 1 or 2 heteroatoms, selected from O, S, and/or N. The nitrogen heteroatom(s) of a heteroaryl can be substituted or unsubstituted. Additionally, the nitrogen and sulfur heteroatom(s) of a heteroaryl can optionally be oxidized (i.e., N.fwdarw.O and S(O).sub.r, wherein r is 0, 1 or 2).

    [0156] The term “ester” refers to —C(O).sub.2R, wherein R is alkyl.

    [0157] The term “carbamate” refers to —OC(O)NR.sub.2, wherein each R is independently alkyl or hydrogen.

    [0158] The term “aldehyde” refers to —C(O)H.

    [0159] The term “carbonate” refers to —OC(O)OR, wherein R is alkyl.

    [0160] The term “maleimide” refers to a group with the chemical formula H.sub.2C.sub.2(CO).sub.2NH. The term “maleimido” refers to a maleimide group covalently linked to another group or molecule. Preferably, a maleimido group is N-linked, for example:

    ##STR00003##

    [0161] The term “acyl halide” refers to —C(O)X, wherein X is halo (e.g., Br, Cl). Exemplary acyl halides include acyl chloride (—C(O)Cl) and acyl bromide (—C(O)Br).

    [0162] In accordance with convention used in the art:

    ##STR00004##

    is used in structural formulas herein to depict the bond that is the point of attachment of the moiety, functional group, or substituent to the core, parent, or backbone structure, such as a compound of the invention or targeting ligand.

    [0163] When any variable occurs more than one time in any constituent or formula for a compound, its definition at each occurrence is independent of its definition at every other occurrence. Thus, for example, if a group is shown to be substituted with 0-3 R groups, then said group can be optionally substituted with up to three R groups, and at each occurrence, R is selected independently from the definition of R.

    [0164] When a bond to a substituent is shown to cross a bond connecting two atoms in a ring, then such substituent can be bonded to any atom on the ring.

    [0165] All publications, including but not limited to patents and patent applications, cited in this specification are herein incorporated by reference as though fully set forth.

    Antibodies that Bind PSMA

    [0166] The disclosure relates to isolated antibodies and antigen binding fragments thereof that specifically bind PSMA.

    [0167] As used herein the term “Antibody” is meant in a broad sense and includes immunoglobulin molecules including monoclonal antibodies including murine, human, humanized and chimeric monoclonal antibodies, antigen binding fragments, multispecific antibodies, such as bispecific, trispecific, tetraspecific, dimeric, tetrameric, multimeric or biparatopic antibodies, single chain antibodies, domain antibodies and any other modified configuration of the immunoglobulin molecule that comprises an antigen binding site of the required specificity. The term antibody includes full length antibodies, whole antibodies, intact antibodies, antibody fragments, antigen binding fragment and antigen binding domains.

    [0168] In general, antibodies are proteins or peptide chains that exhibit binding specificity to a specific antigen. Antibody structures are well known. Imunoglobulins can be assigned to five major classes (i.e., IgA, IgD, IgE, IgG and IgM), depending on the heavy chain constant domain amino acid sequence. IgA and IgG are further sub-classified as the isotypes IgA1, IgA2, IgG1, IgG2, IgG3 and IgG4. Accordingly, the antibodies of the invention can be of any of the five major classes or corresponding sub-classes. Preferably, the antibodies of the invention are IgG1, IgG2, IgG3 or IgG4. Antibody light chains of vertebrate species can be assigned to one of two clearly distinct types, namely kappa and lambda, based on the amino acid sequences of their constant domains. Accordingly, the antibodies of the invention can contain a kappa or lambda light chain constant domain. According to some embodiments, the antibodies of the invention include heavy and/or light chain constant regions from rat or human antibodies. In addition to the heavy and light constant domains, antibodies contain an antigen-binding region that is made up of a light chain variable region and a heavy chain variable region, each of which contains three domains (i.e., complementarity determining regions 1-3; CDR1, CDR2, and CDR3). The light chain variable region domains are alternatively referred to as LCDR1, LCDR2, and LCDR3, and the heavy chain variable region domains are alternatively referred to as HCDR1, HCDR2, and HCDR3.

    [0169] “Complementarity determining regions” (CDR) are antibody regions that bind an antigen. There are three CDRs in the VH (HCDR1, HCDR2, HCDR3) and three CDRs in the VL (LCDR1, LCDR2, LCDR3). CDRs may be defined using various delineations such as Kabat (Wu et al. (1970) J Exp Med 132: 211-50; Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md., 1991), Chothia (Chothia et al. (1987) J Mol Biol 196: 901-17), IMGT (Lefranc et al. (2003) Dev Comp Immunol 27: 55-77) and AbM (Martin and Thornton J Bmol Biol 263: 800-15, 1996). The correspondence between the various delineations and variable region numbering is described (see e.g., Lefranc et al. (2003) Dev Comp Immunol 27: 55-77; Honegger and Pluckthun (2001), J Mol Biol 309:657-70; International ImMunoGeneTics (IMGT) database; Web resources, http://www_imgt_org). Available programs such as abYsis by UCL Business PLC may be used to delineate CDRs. The terms “CDR”, “HCDR1”, “HCDR2”, “HCDR3”, “LCDR1”, “LCDR2” and “LCDR3” as used herein include CDRs defined by any of the methods described supra, Kabat, Chothia, IMGT or AbM, unless otherwise explicitly stated in the specification. Correspondence between the numbering system, including, for example, the Kabat numbering and the IMGT unique numbering system, is well known to one skilled in the art (see, e.g., Kabat, supra; Chothia, supra; Martin, supra; Lefranc et al., supra).

    TABLE-US-00002 TABLE 1 IMGT Kabat AbM Chothia V.sub.H CDR1 27-38 31-35 26-35 26-32 V.sub.H CDR2 56-65 50-65 50-58 53-55 V.sub.H CDR3 105-117  95-102  95-102  96-101 V.sub.L CDR1 27-38 24-34 24-34 26-32 V.sub.L CDR2 56-65 50-56 50-56 50-52 V.sub.L CDR3 105-117 89-97 89-97 91-96

    [0170] The term “variable region” or “variable domain” refers to the heavy or light chain domain that is involved in the binding of the antibody to the antigen. The variable domains of the heavy or light chain (VH and VL, respectively) comprise four framework regions (FR) and three complementarity determining regions (CDRs).

    [0171] As used herein, the term “isolated” refers to a homogenous population of molecules (such as synthetic polynucleotides or polypeptides) which have been substantially separated and/or purified away from other components of the system the molecules are produced in, such as a recombinant cell, as well as a protein that has been subjected to at least one purification or isolation step. “Isolated” refers to a molecule that is substantially free of other cellular material and/or chemicals and encompasses molecules that are isolated to a higher purity, such as to 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% purity.

    [0172] As used herein, the term an “isolated antibody” refers to an antibody which is substantially free of other antibodies having different antigenic specificities (e.g., an isolated antibody that specifically binds to PSMA is substantially free of antibodies that do not bind to PSMA). In addition, an isolated antibody is substantially free of other cellular material and/or chemicals. “Isolated antibody” encompasses antibodies that are isolated to a higher purity, such as antibodies that are 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% pure.

    [0173] As used herein, the term “monoclonal antibody” refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts. The monoclonal antibodies of the invention can be made by the hybridoma method, phage display technology, single lymphocyte gene cloning technology, or by recombinant DNA methods. For example, the monoclonal antibodies can be produced by a hybridoma which includes a B cell obtained from a transgenic nonhuman animal, such as a transgenic mouse or rat, having a genome comprising a human heavy chain transgene and a light chain transgene.

    [0174] As used herein, the term “prostate-specific membrane antigen” or “PSMA” refers to a type II membrane protein expressed on certain cells. The amino acid sequence of the human PSMA is encoded by the FOLH1 gene. Unless specified, as used herein, PSMA refers to human PSMA. The amino acid sequence of human PSMA is retrievable from Uniprot (Accession #Q04609). The amino acid sequence of full length human PSMA is shown in SEQ ID NO: 336. The extracellular domain spans residues −4-750, the transmembrane domain spans residues −0-43 and the cytoplasmic domain spans residues-1-19 of SEQ ID NO:336.

    TABLE-US-00003 SEQ ID NO: 336 (full-length human PSMA) MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEAT NITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQW KEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPG YENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKI VIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPG GGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYY DAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTN EVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVR SFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYI NADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKK SPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYP LYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDY AVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERL QDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKY AGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA

    [0175] The term “PSMA” includes any PSMA variant, isoform, and species homolog, which is naturally expressed by cells (including prostate cells) or can be expressed on cells transfected with genes or cDNA encoding the polypeptide. In specific embodiments, the PSMA is a human PSMA.

    [0176] “Specifically binds,” “specific binding,” “specifically binding” or “binds” refer to a proteinaceous molecule binding to an antigen or an epitope within the antigen with greater affinity than for other antigens.

    [0177] “Epitope” refers to a portion of an antigen to which an antibody specifically binds. Epitopes typically consist of chemically active (such as polar, non-polar or hydrophobic) surface groupings of moieties such as amino acids or polysaccharide side chains and can have specific three-dimensional structural characteristics, as well as specific charge characteristics. An epitope can be composed of contiguous and/or discontiguous amino acids that form a conformational spatial unit. For a discontiguous epitope, amino acids from differing portions of the linear sequence of the antigen come in close proximity in 3-dimensional space through the folding of the protein molecule.

    [0178] Typically, the proteinaceous molecule binds to the antigen or the epitope within the antigen with an equilibrium dissociation constant (K.sub.D) of about 1×10.sup.−7 M or less, for example about 5×10.sup.−8 M or less, about 1×10.sup.−8 M or less, about 1×10.sup.−9 M or less, about 1×10.sup.−10 M or less, about 1×10.sup.−11 M or less, or about 1×10.sup.−12 M or less, typically with the K.sub.D that is at least one hundred fold less than its K.sub.D for binding to a non-specific antigen (e.g., BSA, casein).

    [0179] The term “KD” refers to the dissociation constant, which is obtained from the ratio of K.sub.D to Ka (i.e., Kd/Ka) and is expressed as a molar concentration (M). K.sub.D values for antibodies can be determined using methods in the art in view of the present disclosure. For example, the K.sub.D of an antibody can be determined by using surface plasmon resonance, such as by using a biosensor system, e.g., a Biacore® system, or by using bio-layer interferometry technology, such as an Octet RED96 system. The smaller the value of the K.sub.D of an antibody, the higher affinity that the antibody binds to a target antigen.

    [0180] As used herein, an antibody that “binds to PSMA” or that “specifically binds to PSMA” refers to an antibody that binds to PSMA, preferably human PSMA, with a K.sub.D of 1×10.sup.−7 M or less, preferably 1×10.sup.−8 M or less, more preferably 5×10.sup.−9 M or less, 1×10.sup.−9 M or less, 5×10.sup.−10 M or less, or 1×10.sup.−10 M or less.

    [0181] The term “isolated antibody”, “antigen binding fragment thereof” and “anti-PSMA antibody” and the like are used interchangeably and refer to an antibody that binds PSMA and that comprises at least one binding domain specifically binding PSMA.

    [0182] The term “biparatopic antibody” as used herein, refers to an antibody that specifically binds to two different epitopes on the same target protein, e.g. PSMA.

    [0183] In some embodiments, the anti-PSMA antibody or antigen binding fragment of the disclosure is a biparatopic antibody that binds to PSMA.

    [0184] In some embodiments, the biparatopic antibody of the disclosure comprises at least one receptor binding domain for a first epitope on PSMA target protein and a second receptor binding domain for a second epitope on the same PSMA target protein. In some embodiments the K.sub.D for the first epitope and the K.sub.D for the second epitope are the same. In some embodiments the K.sub.D for the first epitope and the K.sub.D for the second epitope are the different. In some embodiments the K.sub.D for the first epitope and the K.sub.D for the second epitope are about 1×10.sup.−7 M or less, preferably 1×10.sup.−8 M or less, more preferably 5×10.sup.−9 M or less, 1×10.sup.−9 M or less, 5×10.sup.−10 M or less, or 1×10.sup.−10 M or less.

    [0185] The anti-PSMA antibody of the disclosure include whole antibodies, antibody fragments that specifically bind to PSMA, and antigen binding fragments thereof that specifically binds to PSMA.

    [0186] In some embodiments, the anti-PSMA antibody of the disclosure include whole antibodies or fill-length antibodies, Fv fragments, single chain scFv fragments (scFv), Fab, F(ab).sub.2, or single chain antibodies. In some embodiments, the anti-PSMA antibody of the disclosure is a whole antibody or a full-length antibody.

    [0187] In some embodiments, the anti-PSMA antibody of the disclosure is a full-length antibodies, whole antibodies and intact antibodies.

    [0188] The terms “Full length antibodies”, “whole antibodies” and “intact antibodies” are used herein interchangeably to refer to an antibody having a structure similar to a native antibody. “Intact antibodies” are comprised of two heavy chains (HC) and two light chains (LC) inter-connected by disulfide bonds as well as multimers thereof (e.g. IgM). Each heavy chain is comprised of a heavy chain variable region (VH) and a heavy chain constant region (comprised of domains CH1, hinge, CH2 and CH3). Each light chain is comprised of a light chain variable region (VL) and a light chain constant region (CL). The VII and the VL regions may be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with framework regions (FR). Each VII and VL is composed of three CDRs and four FR segments, arranged from amino-to-carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4. Imunoglobulins may be assigned to five major classes, IgA, IgD, IgE, IgG and IgM, depending on the heavy chain constant domain amino acid sequence. IgA and IgG are further sub-classified as the isotypes IgA1, IgA2, IgG1, IgG2, IgG3 and IgG4. Antibody light chains of any vertebrate species may be assigned to one of two clearly distinct types, namely kappa (κ) and lambda (λ), based on the amino acid sequences of their constant domains.

    [0189] In some embodiments, the anti-PSMA antibody of the disclosure is an antibody fragment or an antigen binding domain that specifically binds to PSMA.

    [0190] As used herein, the term “Antibody fragment”, and “antigen binding fragment” refers to a molecule other than an intact antibody. Antigen binding fragments may be synthetic, enzymatically obtainable or genetically engineered polypeptides and include portions of an immunoglobulin that bind an antigen, such as a VH, a VL, a VH and aVL, a Fab, a Fab′, a F(ab′).sub.2, a Ed and a Fv fragments, a disulfide stabilized Fv fragment (dsFv), a (dsFv).sub.2, a bispecific dsFv (dsFv-dsFv′), a disulfide stabilized diabody (ds diabody), a single-chain antibody molecule (scFv), a single domain antibody (sdab) an scFv dimer (bivalent diabody), a multispecific antibody formed from a portion of an antibody comprising one or more CDRs, a camelized single domain antibody, a nanobody, a domain antibody, a domain antibody (dAb) consisting of one VH domain or one VL domain, a shark variable IgNAR domain, a camelized VH domain, a VHH domain, a minimal recognition unit consisting of the amino acid residues that mimic the CDRs of an antibody, such as a FR3-CDR3-FR4 portion, the HCDR1, the HCDR2 and/or the HCDR3 and the LCDR1, the LCDR2 and/or the LCDR3, an alternative scaffold that bind an antigen, a bivalent domain antibody, a multispecific protein comprising the antigen binding fragment or any other antibody fragment that binds to an antigen but does not comprise a complete antibody structure.”

    [0191] “dAb” or “dAb fragment” refers to an antibody fragment composed of a VH domain (Ward et al., Nature 341:544 546 (1989)).

    [0192] “Fab” or “Fab fragment” refers to an antibody fragment composed of VH, CH1, VL and CL domains.

    [0193] “F(ab′)2” or “F(ab′)2 fragment” refers to an antibody fragment containing two Fab fragments connected by a disulfide bridge in the hinge region.

    [0194] “Fd” or “Ed fragment” refers to an antibody fragment composed of VH and CH1 domains.

    [0195] “Fv” or “Fv fragment” refers to an antibody fragment composed of the VH and the VL domains from a single arm of the antibody. Fv fragments lack the constant regions of Fab (CH1 and CL) regions. The VH and VL in Fv fragments are held together by non-covalent interactions.

    [0196] Antigen binding fragments (such as VH and VL) may be linked together via a synthetic linker to form various types of single antibody designs where the VH/VL domains may be paired intramolecularly, or intermolecularly to form a monovalent antigen binding domain, such as single chain Fv (scFv) or diabody. In recombinant expression systems, the linker is a peptide linker and may include any naturally occurring amino acid. Exemplary amino acids that may be included into the linker are Gly, Ser Pro, Thr, Glu, Lys, Arg, Ile, Leu, His and The. The linker should have a length that is adequate to link the VH and the VL in such a way that they form the correct conformation relative to one another so that they retain the desired activity, such as binding to PSMA. The linker may be about 5-50 amino acids long.

    [0197] “Single chain Fv” or “scFv” are fusion proteins comprising at least one antibody fragment comprising a light chain variable region (VL) and at least one antibody fragment comprising a heavy chain variable region (VH), wherein the VL and the VH are contiguously linked via a polypeptide linker, and capable of being expressed as a single chain polypeptide. A scFv may have the VL and VH variable regions in either order, e.g., with respect to the N-terminal and C-terminal ends of the polypeptide, the scFv may comprise VL-linker-VH or may comprise VH-linker-VL.

    [0198] In recombinant expression systems, the linker is a peptide linker and may include any naturally occurring amino acid. Exemplary amino acids that may be included into the linker are Gly, Ser Pro, Thr, Glu, Lys, Arg, Ile, Leu, His and The. The linker should have a length that is adequate to link the VH and the VL in such a way that they form the correct conformation relative to one another so that they retain the desired activity, such as binding to PSMA.

    [0199] The linker may be about 5-50 amino acids long. In some embodiments, the linker is about 10-40 amino acids long. In some embodiments, the linker is about 10-35 amino acids long. In some embodiments, the linker is about 10-30 amino acids long. In some embodiments, the linker is about 10-25 amino acids long. In some embodiments, the linker is about 10-20 amino acids long. In some embodiments, the linker is about 15-20 amino acids long. In some embodiments, the linker is 6 amino acids long. In some embodiments, the linker is 7 amino acids long. In some embodiments, the linker is 8 amino acids long. In some embodiments, the linker is 9 amino acids long. In some embodiments, the linker is 10 amino acids long. In some embodiments, the linker is 11 amino acids long. In some embodiments, the linker is 12 amino acids long. In some embodiments, the linker is 13 amino acids long. In some embodiments, the linker is 14 amino acids long. In some embodiments, the linker is 15 amino acids long. In some embodiments, the linker is 16 amino acids long. In some embodiments, the linker is 17 amino acids long. In some embodiments, the linker is 18 amino acids long. In some embodiments, the linker is 19 amino acids long. In some embodiments, the linker is 20 amino acids long. In some embodiments, the linker is 21 amino acids long. In some embodiments, the linker is 22 amino acids long. In some embodiments, the linker is 23 amino acids long. In some embodiments, the linker is 24 amino acids long. In some embodiments, the linker is 25 amino acids long. In some embodiments, the linker is 26 amino acids long. In some embodiments, the linker is 27 amino acids long. In some embodiments, the linker is 28 amino acids long. In some embodiments, the linker is 29 amino acids long. In some embodiments, the linker is 30 amino acids long. In some embodiments, the linker is 31 amino acids long. In some embodiments, the linker is 32 amino acids long. In some embodiments, the linker is 33 amino acids long. In some embodiments, the linker is 34 amino acids long. In some embodiments, the linker is 35 amino acids long. In some embodiments, the linker is 36 amino acids long. In some embodiments, the linker is 37 amino acids long. In some embodiments, the linker is 38 amino acids long. In some embodiments, the linker is 39 amino acids long. In some embodiments, the linker is 40 amino acids long. Exemplary linkers that may be used are Gly rich linkers, Gly and Ser containing linkers, Gly and Ala containing linkers, Ala and Ser containing linkers, and other flexible linkers.

    [0200] Other linker sequences may include portions of immunoglobulin hinge area, CL or CH1 derived from any immunoglobulin heavy or light chain isotype. Alternatively, a variety of non-proteinaceous polymers, including polyethylene glycol (PEG), polypropylene glycol, polyoxyalkylenes, or copolymers of polyethylene glycol and polypropylene glycol, may find use as linkers. Exemplary linkers that may be used are shown in Table 2.

    [0201] In some embodiments, the scFv comprises, from the N- to C-terminus, a VH, a first linker (L1) and a VL (VH-L1-VL).

    [0202] In some embodiments, the scFv comprises, from the N- to C-terminus, the VL, the L1 and the VH (VL-L1-VH).

    [0203] In some embodiments, the L1 comprises the amino acid sequence of SEQ ID NO: 308.

    [0204] In some embodiments, the L1 comprises the amino acid sequence of SEQ ID NO: 309.

    [0205] In some embodiments, the L1 comprises the amino acid sequence of SEQ ID NO: 310.

    [0206] In some embodiments, the L1 comprises the amino acid sequence of SEQ ID NO: 311.

    [0207] In some embodiments, the L1 comprises the amino acid sequence of SEQ ID NO: 312.

    [0208] In some embodiments, the L1 comprises the amino acid sequence of SEQ ID NO: 313.

    [0209] In some embodiments, the L1 comprises the amino acid sequence of SEQ ID NO: 314.

    [0210] In some embodiments, the L1 comprises the amino acid sequence of SEQ ID NO: 315.

    [0211] In some embodiments, the L1 comprises the amino acid sequence of SEQ ID NO: 316.

    [0212] In some embodiments, the L1 comprises the amino acid sequence of SEQ ID NO: 317.

    [0213] In some embodiments, the L1 comprises the amino acid sequence of SEQ ID NO: 318.

    [0214] In some embodiments, the L1 comprises the amino acid sequence of SEQ ID NO: 319.

    [0215] In some embodiments, the L1 comprises the amino acid sequence of SEQ ID NO: 320.

    [0216] In some embodiments, the L1 comprises the amino acid sequence of SEQ ID NO: 321.

    [0217] In some embodiments, the L1 comprises the amino acid sequence of SEQ ID NO: 322.

    [0218] In some embodiments, the L1 comprises the amino acid sequence of SEQ ID NO: 323.

    [0219] In some embodiments, the L1 comprises the amino acid sequence of SEQ ID NO: 324.

    [0220] In some embodiments, the L1 comprises the amino acid sequence of SEQ ID NO: 325.

    [0221] In some embodiments, the L1 comprises the amino acid sequence of SEQ ID NO: 326.

    [0222] In some embodiments, the L1 comprises the amino acid sequence of SEQ ID NO: 327.

    [0223] In some embodiments, the L1 comprises the amino acid sequence of SEQ ID NO: 328.

    [0224] In some embodiments, the L1 comprises the amino acid sequence of SEQ ID NO: 329.

    [0225] In some embodiments, the L1 comprises the amino acid sequence of SEQ ID NO: 330.

    [0226] In some embodiments, the L1 comprises the amino acid sequence of SEQ ID NO: 331.

    [0227] In some embodiments, the L1 comprises the amino acid sequence of SEQ ID NO: 332.

    [0228] In some embodiments, the L1 comprises the amino acid sequence of SEQ ID NO: 333.

    [0229] In some embodiments, the L1 comprises the amino acid sequence of SEQ ID NO: 334.

    [0230] In some embodiments, the L1 comprises the amino acid sequence of SEQ ID NO: 335.

    [0231] In some embodiments, the L1 comprises the amino acid sequence of SEQ ID NO: 87.

    [0232] In some embodiments, the L1 comprises the amino acid sequence of SEQ ID NO: 107.

    [0233] In some embodiments, the L1 comprises the amino acid sequence of SEQ ID NO: 91.

    [0234] In some embodiments, the L1 comprises the amino acid sequence of SEQ ID NO: 111.

    [0235] In some embodiments, the L1 comprises the amino acid sequence of SEQ ID NO: 285.

    [0236] In some embodiments, the L1 comprises the amino acid sequence of SEQ ID NO: 287.

    TABLE-US-00004 TABLE 2 The amino acid sequences of linkers. Linker SEQ ID name Amino acid sequence NO: Linker 1 GGSEGKSSGSGSESKSTGGS 308 Linker 2 GGGSGGGS 309 Linker 3 GGGSGGGSGGGS 310 Linker 4 GGGSGGGSGGGSGGGS 311 Linker 5 GGGSGGGSGGGSGGGSGGGS 312 Linker 6 GGGGSGGGGSGGGGS 313 Linker 7 GGGGSGGGGSGGGGSGGGGS 314 Linker 8 GGGGSGGGGSGGGGSGGGGSGGGGS 315 Linker 9 GSTSGSGKPGSGEGSTKG 316 Linker 10 IRPRAIGGSKPRVA 317 Linker 11 GKGGSGKGGSGKGGS 318 Linker 12 GGKGSGGKGSGGKGS 319 Linker 13 GGGKSGGGKSGGGKS 320 Linker 14 GKGKSGKGKSGKGKS 321 Linker 15 GGGKSGGKGSGKGGS 322 Linker 16 GKPGSGKPGSGKPGS 323 Linker 17 GKPGSGKPGSGKPGSGKPGS 324 Linker 18 GKGKSGKGKSGKGKSGKGKS 325 Linker 19 STAGDTHLGGEDFD 326 Linker 20 GEGGSGEGGSGEGGS 327 Linker 21 GGEGSGGEGSGGEGS 328 Linker 22 GEGESGEGESGEGES 329 Linker 23 GGGESGGEGSGEGGS 330 Linker 24 GEGESGEGESGEGESGEGES 331 Linker 25 GSTSGSGKPGSGEGSTKG 332 Linker 26 PRGASKSGSASQTGSAPGS 333 Linker 27 GTAAAGAGAAGGAAAGAAG 334 Linker 28 GTSGSSGSGSGGSGSGGGG 335 Linker 29 GKPGSGKPGSGKPGSGKPGS 87 Linker 30 GSGS 107 Linker 31 APAPAPAPAP 91 Linker 32 APAPAPAPAPAPAPAPAPAP 111 Linker 33 AEAAAKEAAAKEAAAAKEAAAAKEAAAAKAAA 285 Linker 34 GTEGKSSGSGSESKST 287

    [0237] Divalent or bivalent single chain variable fragments (di-scFv, bi-scFvs) can be engineered by linking two scFvs “(scFv).sub.2” or “tandem scFv” or “bis-scFv” fragments refers to a fusion protein comprising two light chain variable regions (VL) and two heavy chain variable regions (VH), wherein the two VL and the two VH regions are contiguously linked via polypeptide linkers, and capable of being expressed as a single chain polypeptide. The two VL and two VH regions fused by peptide linkers form a bivalent molecule VL.sub.A-linker-VH.sub.A-linker-VL.sub.B-linker-VH.sub.B to form two binding sites, capable of binding two different antigens or epitopes concurrently. (ScFv).sub.2 can be expressed as a single chain polypeptide.

    [0238] Any of the VH and the VL domains identified herein that bind PSMA may be engineered into scFv format in either VH-linker-VL or VL-linker-VH orientation. Any of the VH and the VL domains identified herein may also be used to generate sc(Fv).sub.2 structures, such as VH-linker-VL-linker-VL-linker-VH, VH-linker-VL-linker-VH-linker-VL, VH-linker-VH-linker-VL-linker-VL,VL-linker-VH-linker-VH-linker-VL,VL-linker-VH-linker-VL-linker-VH or VL-linker-VL-linker-VH-linker-VH.

    [0239] “Diabodies” are bivalent dimers formed from two chains, each containing a VH and a VL domain. The two domains within a chain are separated by a linker that is too short to facilitate intrachain dimerization leading to two chains dimerizing in a head-to-tail arrangement. The linker may be a pentameric glycine-rich linker (G4S (SEQ ID NO: 337)).

    [0240] “VHH” refers to a single-domain antibody or nanobody, exclusively composed of the antigen binding domain of a heavy chain. A VHH single domain antibody lacks the light chain and the CH1 domain of the heavy chain of conventional Fab region. In some embodiments, the anti-PSMA antibodies of the disclosure include Fv fragments, single chain scFv fragments (scFv), (scFv).sub.2, Fab, F(ab).sub.2, diabodies, VHH, dAb, Fd, Fv, or other single chain antibodies.

    [0241] The anti-PSMA antibody of the disclosure include chimeric, humanized or fully human antibodies that specifically bind to PSMA.

    [0242] “Human antibody” refers to an antibody that is optimized to have minimal immune response when administered to a human subject. Variable regions of human antibody are derived from human immunoglobulin sequences. If human antibody contains a constant region or a portion of the constant region, the constant region is also derived from human immunoglobulin sequences. Human antibody comprises heavy and light chain variable regions that are “derived from” sequences of human origin if the variable regions of the human antibody are obtained from a system that uses human germline immunoglobulin or rearranged immunoglobulin genes. Such exemplary systems are human immunoglobulin gene libraries displayed on phage, and transgenic non-human animals such as mice or rats carrying human immunoglobulin loci. “Human antibody” typically contains amino acid differences when compared to the immunoglobulins expressed in humans due to differences between the systems used to obtain the human antibody and human immunoglobulin loci, introduction of somatic mutations or intentional introduction of substitutions into the frameworks or CDRs, or both.

    [0243] Typically, a “human antibody” is at least about 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical in amino acid sequence to an amino acid sequence encoded by human germline immunoglobulin or rearranged immunoglobulin genes. In some cases, “human antibody” may contain consensus framework sequences derived from human framework sequence analyses, for example as described in Knappik et al., (2000) J Mol Biol 296:57-86, or a synthetic HCDR3 incorporated into human immunoglobulin gene libraries displayed on phage, for example as described in Shi et al., (2010) J Mol Biol 397:385-96, and in Int. Patent Publ. No. WO2009/085462. Antibodies in which at least one CDR is derived from a non-human species are not included in the definition of “human antibody”.

    [0244] Transgenic animals, such as mice, rat or chicken carrying human immunoglobulin (Ig) loci in their genome may be used to generate antigen binding fragments that bind PSMA, and are described in for example U.S. Pat. No. 6,150,584, Int. Patent Publ. No. WO1999/45962, Int. Patent Publ. Nos. WO2002/066630, WO2002/043478 and WO1990/04036. The endogenous immunoglobulin loci in such animal may be disrupted or deleted, and at least one complete or partial human immunoglobulin locus may be inserted into the genome of the animal using homologous or non-homologous recombination, using transchromosomes, or using minigenes. Companies such as Regeneron (http://_www regeneron_com), Harbour Antibodies (http://_www_harbourantibodies_com), Open Monoclonal Technology, Inc. (OMT) (http://_www_omtinc_net), KyMab (http://_www_kymab_com), Trianni (http://_www.trianni_com) and Ablexis (http://_www_ablexis_com) may be engaged to provide human antibodies directed against a selected antigen.

    [0245] The antibody or antigen binding fragment thereof that bind PSMA generated by immunizing non-human animals may be humanized. Exemplary humanization techniques including selection of human acceptor frameworks include CDR grafting (U.S. Pat. No. 5,225,539), SDR grafting (U.S. Pat. No. 6,818,749), Resurfacing (Padlan, (1991) Mol Immunol 28:489-499), Specificity Determining Residues Resurfacing (U.S. Patent Publ. No. 2010/0261620), human framework adaptation (U.S. Pat. No. 8,748,356) or superhumanization (U.S. Pat. No. 7,709,226). In these methods, CDRs or a subset of CDR residues of parental antibodies are transferred onto human frameworks that may be selected based on their overall homology to the parental frameworks, based on similarity in CDR length, or canonical structure identity, or a combination thereof.

    [0246] Humanized antigen binding domains may be further optimized to improve their selectivity or affinity to a desired antigen by incorporating altered framework support residues to preserve binding affinity (backmutations) by techniques such as those described in Int. Patent Publ. Nos. WO1090/007861 and WO1992/22653, or by introducing variation at any of the CDRs for example to improve affinity of the antigen binding domain.

    [0247] In some embodiments, the disclosure provides an isolated antibody or antigen binding fragment thereof that binds to PSMA comprising a heavy chain complementarity determining region 1 (HCDR1), a HCDR2, and a HCDR3, and a light chain complementarity determining region 1 (LCDR1), a LCDR2, and LCDR3, wherein the HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3 comprise the amino acid sequences:

    TABLE-US-00005 a. (SEQ ID NO: 4) RYGMH, (SEQ ID NO: 5) LISYDGSNRYYADSVKG, (SEQ ID NO: 6) ERESSGWFEGYFDY, (SEQ ID NO: 7) GGNNIGSKSVH, (SEQ ID NO: 8) DNSDRPS, and (SEQ ID NO: 9) QVWDSSSDHVV, respectively; b. (SEQ ID NO: 10) SYYWN, (SEQ ID NO: 11) RIYSSGNTDYNPSLKS, (SEQ ID NO: 12) GRGANVGLFDY, (SEQ ID NO: 13) TGSNSNIGANYDVH, (SEQ ID NO: 14) GNINRPL, and (SEQ ID NO: 15) QSYDFSLSGSV, respectively; c. (SEQ ID NO: 16) GYGMH, (SEQ ID NO: 17) VISYDGSNRYYADSVKG, (SEQ ID NO: 18) DGNWGSLDLYFDL, (SEQ ID NO: 19) TGSSSNIGADYDVH, (SEQ ID NO: 20) VNNNRPS, and (SEQ ID NO: 21) QSYDNTLSGVV, respectively; d. (SEQ ID NO: 22) SYGMH, (SEQ ID NO: 23) VISYDGSNKYYADSVKG, (SEQ ID NO: 24) EHYDSSGYYHGYYGMDV, (SEQ ID NO: 25) SGSSSNIGSNYVY, (SEQ ID NO: 26) SNNQRPS, (SEQ ID NO: 27) AARDDSLSGYV, respectively; e. (SEQ ID NO: 28) SYDMH, (SEQ ID NO: 29) VISFDGSNKYYVDSVKG, (SEQ ID NO: 30) TYYDILTGYSHYSYGMDV, (SEQ ID NO: 31) RASQGISNYLA, (SEQ ID NO: 32) ATSTLQS, and (SEQ ID NO: 33) QKYNSAPFT, respectively; f. (SEQ ID NO: 34) TYGMH, (SEQ ID NO: 35) FISYDGSNKYYADSVKG, (SEQ ID NO: 36) RDNLRFLEWFMDV, (SEQ ID NO: 37) RASQSVRSNLA, (SEQ ID NO: 38) GASTRAT, and (SEQ ID NO: 39) HQYNDWPPYT, respectively; g. (SEQ ID NO: 40) IYSMN, (SEQ ID NO: 41) SISSSSSYIFYADSVKG, (SEQ ID NO: 42) SSYGADY, (SEQ ID NO: 43) RASQDITNFLA, (SEQ ID NO: 44) TASTLQS, and (SEQ ID NO: 45) QKYNSAPLT, respectively; h. (SEQ ID NO: 46) SYSLN, (SEQ ID NO: 47) SISSSSSYISYADAVKG, (SEQ ID NO: 48) DRGFLEDYYYYYGMDV, (SEQ ID NO: 49) RASQGISNWLA, (SEQ ID NO: 50) VASSLQS, and (SEQ ID NO: 51) QQAYSFPLT, respectively; i. (SEQ ID NO: 272) SYYWS, (SEQ ID NO: 273) RIYSSGSTNYNPSLKS, (SEQ ID NO: 274) VGVWPGAFDI, (SEQ ID NO: 275) SGSSSNIGSNTVN, (SEQ ID NO: 276) SSNQRPS and (SEQ ID NO: 277) AAWDDSLNGVV, respectively; j. (SEQ ID NO: 124) GFTLSRY, (SEQ ID NO: 125) SYDGSN, (SEQ ID NO: 6) ERESSGWFEGYFDY, (SEQ ID NO: 7) GGNNIGSKSVH, (SEQ ID NO: 8) DNSDRPS and (SEQ ID NO: 9) QVWDSSSDHVV, respectively; k. (SEQ ID NO: 130) GGSISSY, (SEQ ID NO: 131) YSSGN, (SEQ ID NO: 12) GRGANVGLFDY, (SEQ ID NO: 13) TGSNSNIGANYDVH, (SEQ ID NO: 14) GNINRPL, and (SEQ ID NO: 15) QSYDFSLSGSV, respectively; l. (SEQ ID NO: 136) VRTFSGY, (SEQ ID NO: 125) SYDGSN, (SEQ ID NO: 18) DGNWGSLDLYFDL, (SEQ ID NO: 19) TGSSSNIGADYDVH, (SEQ ID NO: 20) VNNNRPS, and (SEQ ID NO: 21) QSYDNTLSGVV, respectively; m. (SEQ ID NO: 142) GFTFTSY, (SEQ ID NO: 125) SYDGSN, (SEQ ID NO: 24) EHYDSSGYYHGYYGMDV, (SEQ ID NO: 25) SGSSSNIGSNYVY, (SEQ ID NO: 26) SNNQRPS, and (SEQ ID NO: 27) AARDDSLSGYV, respectively; n. (SEQ ID NO: 148) GFTFSSY, (SEQ ID NO: 149) SFDGSN, (SEQ ID NO: 30) TYYDILTGYSHYSYGMDV, (SEQ ID NO: 31) RASQGISNYLA, (SEQ ID NO: 32) ATSTLQS, and (SEQ ID NO: 33) QKYNSAPFT, respectively; o. (SEQ ID NO: 154) GFTFSTY, (SEQ ID NO: 125) SYDGSN, (SEQ ID NO: 36) RDNLRFLEWFMDV, (SEQ ID NO: 37) RASQSVRSNLA, (SEQ ID NO: 38) GASTRAT, and (SEQ ID NO: 39) HQYNDWPPYT, respectively; p. (SEQ ID NO: 160) GFTLSIY, (SEQ ID NO: 161) SSSSSY, (SEQ ID NO: 42) SSYGADY, (SEQ ID NO: 43) RASQDITNFLA, (SEQ ID NO: 44) TASTLQS, and (SEQ ID NO: 45) QKYNSAPLT, respectively; q. (SEQ ID NO: 166) GFTFSSY, (SEQ ID NO: 167) SSSSSY, (SEQ ID NO: 48) DRGFLEDYYYYYGMDV, (SEQ ID NO: 49) RASQGISNWLA, (SEQ ID NO: 50) VASSLQS, and (SEQ ID NO: 51) QQAYSFPLT, respectively; r. (SEQ ID NO: 290) GGSIISY, (SEQ ID NO: 291) YSSGS, (SEQ ID NO: 274) VGVWPGAFDI, (SEQ ID NO: 275) SGSSSNIGSNTVN, (SEQ ID NO: 276) SSNQRPS, and (SEQ ID NO: 277) AAWDDSLNGVV, respectively; s. (SEQ ID NO: 172) GFTLSRYGMH, (SEQ ID NO: 173) LISYDGSNRY, (SEQ ID NO: 6) ERESSGWFEGYFDY, (SEQ ID NO: 7) GGNNIGSKSVH, (SEQ ID NO: 8) DNSDRPS, and (SEQ ID NO: 9) QVWDSSSDHVV, respectively; t. (SEQ ID NO: 178) GGSISSYYWN, (SEQ ID NO: 179) RIYSSGNTD, (SEQ ID NO: 12) GRGANVGLFDY, (SEQ ID NO: 13) TGSNSNIGANYDVH, (SEQ ID NO: 14) GNINRPL, and (SEQ ID NO: 15) QSYDFSLSGSV, respectively; u. (SEQ ID NO: 184) VRTFSGYGMH, (SEQ ID NO: 185) VISYDGSNRY, (SEQ ID NO: 18) DGNWGSLDLYFDL, (SEQ ID NO: 19) TGSSSNIGADYDVH, (SEQ ID NO: 20) VNNNRPS, and (SEQ ID NO: 21) QSYDNTLSGVV, respectively; v. (SEQ ID NO: 190) GFTFTSYGMH, (SEQ ID NO: 191) VISYDGSNKY, (SEQ ID NO: 24) EHYDSSGYYHGYYGMDV, (SEQ ID NO: 25) SGSSSNIGSNYVY, (SEQ ID NO: 26) SNNQRPS, and (SEQ ID NO: 27) AARDDSLSGYV, respectively; w. (SEQ ID NO: 196) GFTFSSYDMH, (SEQ ID NO: 197) VISFDGSNKY, (SEQ ID NO: 30) TYYDILTGYSHYSYGMDV, (SEQ ID NO: 31) RASQGISNYLA, (SEQ ID NO: 32) ATSTLQS, and (SEQ ID NO: 33) QKYNSAPFT, respectively; x. (SEQ ID NO: 202) GFTFSTYGMH, (SEQ ID NO: 203) FISYDGSNKY, (SEQ ID NO: 36) RDNLRFLEWFMDV, (SEQ ID NO: 37) RASQSVRSNLA, (SEQ ID NO: 38) GASTRAT, and (SEQ ID NO: 39) HQYNDWPPYT, respectively; y. (SEQ ID NO: 208) GFTLSIYSMN, (SEQ ID NO: 209) SISSSSSYIF, (SEQ ID NO: 42) SSYGADY, (SEQ ID NO: 43) RASQDITNFLA,, (SEQ ID NO: 44) TASTLQS, and (SEQ ID NO: 45) QKYNSAPLT, respectively; z. (SEQ ID NO: 214) GFTFSSYSLN, (SEQ ID NO: 215) SISSSSSYIS, (SEQ ID NO: 48) DRGFLEDYYYYYGMDV, (SEQ ID NO: 49) RASQGISNWL, (SEQ ID NO: 50) VASSLQS, and (SEQ ID NO: 51) QQAYSF, respectively; aa. (SEQ ID NO: 296) GGSIISYYWS, (SEQ ID NO: 297) RIYSSGSTN, (SEQ ID NO: 274) VGVWPGAFDI, (SEQ ID NO: 275) SGSSSNIGSNTVN, (SEQ ID NO: 276) SSNQRPS, and (SEQ ID NO: 277) AAWDDSLNGVV, respectively; bb. (SEQ ID NO: 220) GFTLSRYG, (SEQ ID NO: 221) ISYDGSNR, (SEQ ID NO: 222) ARERESSGWFEGYFDY, (SEQ ID NO: 223) NIGSKS, DNS, and (SEQ ID NO: 9) QVWDSSSDHVV, respectively; cc. (SEQ ID NO: 226) GGSISSYY, (SEQ ID NO: 227) IYSSGNT, (SEQ ID NO: 228) ARGRGANVGLFDY, (SEQ ID NO: 229) NSNIGANYD, GNI, and (SEQ ID NO: 15) QSYDFSLSGSV, respectively; dd. (SEQ ID NO: 232) VRTFSGYG, (SEQ ID NO: 233) ISYDGSNR, (SEQ ID NO: 234) ARDGNWGSLDLYFDL, (SEQ ID NO: 235) SSNIGADYD, VNN, and (SEQ ID NO: 21) QSYDNTLSGVV, respectively; ee. (SEQ ID NO: 238) GFTFTSYG, (SEQ ID NO: 239) ISYDGSNK, (SEQ ID NO: 240) AREHYDSSGYYHGYYGMDV, (SEQ ID NO: 241) SSNIGSNY, SNN, and (SEQ ID NO: 27) AARDDSLSGYV, respectively; ff. (SEQ ID NO: 244) GFTFSSYD, (SEQ ID NO: 245) ISFDGSNK, (SEQ ID NO: 246) ARTYYDILTGYSHYSYGMDV, (SEQ ID NO: 247) QGISNY, ATS, and (SEQ ID NO: 33) QKYNSAPFT, respectively; gg. (SEQ ID NO: 250) GFTFSTYG, (SEQ ID NO: 251) ISYDGSNK, (SEQ ID NO: 252) AGRDNLRFLEWFMDV, (SEQ ID NO: 253) QSVRSN, GAS, and (SEQ ID NO: 39) HQYNDWPPYT, respectively; hh. (SEQ ID NO: 256) GFTLSIYS, (SEQ ID NO: 257) ISSSSSYI, (SEQ ID NO: 258) ARSSYGADY, (SEQ ID NO: 259) QDITNF, TAS, and (SEQ ID NO: 45) QKYNSAPLT, respectively; ii. (SEQ ID NO: 262) GFTFSSYS, (SEQ ID NO: 263) ISSSSSYI, (SEQ ID NO: 264) ARDRGFLEDYYYYYGMDV, (SEQ ID NO: 265) QGISNW, VAS, and (SEQ ID NO: 51) QQAYSFPLT, respectively; or jj. (SEQ ID NO: 302) GGSIISYY, (SEQ ID NO: 303) IYSSGST, (SEQ ID NO: 304) AKVGVWPGAFDI, (SEQ ID NO: 305) SSNIGSNT, SSN, and (SEQ ID NO: 277) AAWDDSLNGVV, respectively.

    [0248] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises the HCDR1, the HCDR2, the HCDR3, the LCDR1, the LCDR2 and the LCDR3 of SEQ ID NO: 4, 5, 6, 7, 8, and 9, respectively.

    [0249] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises the HCDR1, the HCDR2, the HCDR3, the LCDR1, the LCDR2 and the LCDR3 of SEQ ID NO: 10, 11, 12, 13, 14, and 15, respectively.

    [0250] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises the HCDR1, the HCDR2, the HCDR3, the LCDR1, the LCDR2 and the LCDR3 of SEQ ID NO: 16, 17, 18, 29, 20 and 21, respectively.

    [0251] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises the HCDR1, the HCDR2, the HCDR3, the LCDR1, the LCDR2 and the LCDR3 of SEQ ID NO: 22, 23, 24, 25, 26 and 27, respectively.

    [0252] In some embodiments, the disclosure provides an isolated antibody or antigen binding fragment thereof that binds PSMA comprising the HCDR1, the HCDR1, the HCDR3, the LCDR1, the LCDR2 and the LCDR3 of SEQ ID NOs: 28, 29, 30, 31, 32, and 33, respectively.

    [0253] In some embodiments, the disclosure provides an isolated antibody or antigen binding fragment thereof that binds PSMA comprising the HCDR1, the HCDR1, the HCDR3, the LCDR1, the LCDR2 and the LCDR3 of SEQ ID NOs: 34, 35, 36, 37, 38 and 39, respectively.

    [0254] In some embodiments, the disclosure provides an isolated antibody or antigen binding fragment thereof that binds PSMA comprising the HCDR1, the HCDR1, the HCDR3, the LCDR1, the LCDR2 and the LCDR3 of SEQ ID NOs: 40, 41, 42, 43, 44, and 45, respectively.

    [0255] In some embodiments, the disclosure provides an isolated antibody or antigen binding fragment thereof that binds PSMA comprising the HCDR1, the HCDR1, the HCDR3, the LCDR1, the LCDR2 and the LCDR3 of SEQ ID NOs: 46, 47, 48, 49, 50, and 51, respectively.

    [0256] In some embodiments, the disclosure provides an isolated antibody or antigen binding fragment thereof that binds PSMA comprising the HCDR1, the HCDR1, the HCDR3, the LCDR1, the LCDR2 and the LCDR3 of SEQ ID NOs: 272, 273, 274, 275, 276, and 277, respectively.

    [0257] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising:

    [0258] a heavy chain complementarity determining region (HCDR) 1, a HCDR2 and a HCDR3 of a heavy chain variable region (VH) of SEQ ID NO: 52 and a light chain complementarity determining region (LCDR) 1, a LCDR2 and a LCDR3 of a light chain variable region (VL) of SEQ ID NO: 53; or

    [0259] the HCDR1, the HCDR2 and the HCDR3 of the VH of SEQ ID NO: 54 and the LCDR1, the LCDR2 and the LCDR3 of the VL of SEQ ID NO: 55; or

    the HCDR1, the HCDR2 and the HCDR3 of the VH of SEQ ID NO: 56 and the LCDR1, the LCDR2 and the LCDR3 of the VL of SEQ ID NO: 57; or

    [0260] the HCDR1, the HCDR2 and the HCDR3 of the VH of SEQ ID NO: 58 and the LCDR1, the LCDR2 and the LCDR3 of the VL of SEQ ID NO: 59; or

    [0261] the HCDR1, the HCDR2 and the HCDR3 of the VH of SEQ ID NO: 60 and the LCDR1, the LCDR2 and the LCDR3 of the VL of SEQ ID NO: 61; or

    [0262] the HCDR1, the HCDR2 and the HCDR3 of the VH of SEQ ID NO: 62 and the LCDR1, the LCDR2 and the LCDR3 of the VL of SEQ ID NO: 63; or

    [0263] the HCDR1, the HCDR2 and the HCDR3 of the VH of SEQ ID NO: 64 and the LCDR1, the LCDR2 and the LCDR3 of the VL of SEQ ID NO: 65; or

    [0264] the HCDR1, the HCDR2 and the HCDR3 of the VH of SEQ ID NO: 66 and the LCDR1, the LCDR2 and the LCDR3 of the VL of SEQ ID NO: 67; or

    [0265] the HCDR1, the HCDR2 and the HCDR3 of the VH of SEQ ID NO: 278 and the LCDR1, the LCDR2 and the LCDR3 of the VL of SEQ ID NO: 279.

    [0266] In some embodiments, the isolated protein comprising an antigen binding domain, comprises the HCDR1, the HCDR2 and the HCDR3 of the VH of SEQ ID NO: 52 and the LCDR1, the LCDR2 and the LCDR3 of the VL of SEQ ID NO: 53 and wherein the antibody or antigen binding fragment thereof binds PSMA.

    [0267] In some embodiments, the isolated protein comprising an antigen binding domain, comprises the HCDR1, the HCDR2 and the HCDR3 of the VH of SEQ ID NO: 54 and the LCDR1, the LCDR2 and the LCDR3 of the VL of SEQ ID NO: 55 and wherein the antibody or antigen binding fragment thereof binds PSMA.

    [0268] In some embodiments, the disclosure provides an isolated antibody or antigen binding fragment thereof comprising:

    the VH of SEQ ID NO: 52 and the VL of SEQ ID NO: 53; or

    the VH of SEQ ID NO: 54 and the VL of SEQ ID NO: 55; or

    the VH of SEQ ID NO: 56 and the VL of SEQ ID NO: 57; or

    the VH of SEQ ID NO: 58 and the VL of SEQ ID NO: 59; or

    the VH of SEQ ID NO: 60 and the VL of SEQ ID NO: 61; or

    the VH of SEQ ID NO: 62 and the VL of SEQ ID NO: 63; or

    the VH of SEQ ID NO: 64 and the VL of SEQ ID NO: 65; or

    the VH of SEQ ID NO: 66 and the VL of SEQ ID NO: 67; or

    [0269] the VH of SEQ ID NO: 278 and the VL of SEQ ID NO: 279; and wherein the antibody or antigen binding fragment thereof binds PSMA.

    [0270] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises the VH of SEQ ID NO: 52 and the VL of SEQ ID NO: 53.

    [0271] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises the VH of SEQ ID NO: 54 and the VL of SEQ ID NO: 55.

    [0272] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises the VH of SEQ ID NO: 56 and the VL of SEQ ID NO: 57.

    [0273] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises the VH of SEQ ID NO: 58 and the VL of SEQ ID NO: 59.

    [0274] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises the VH of SEQ ID NO: 60 and the VL of SEQ ID NO: 61.

    [0275] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises the VH of SEQ ID NO: 62 and the VL of SEQ ID NO: 63.

    [0276] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises the VH of SEQ ID NO: 64 and the VL of SEQ ID NO: 65.

    [0277] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises the VH of SEQ ID NO: 66 and the VL of SEQ ID NO: 67.

    [0278] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises the VH of SEQ ID NO: 278 and the VL of SEQ ID NO: 279.

    [0279] In some embodiment, the disclosure also provides an isolated antibody or antigen binding fragment thereof comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 84, 85, 86, 88, 89, 90, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 268, 269, 282, 284, and 288.

    [0280] In some embodiments, the disclosure provides an isolated antibody or antigen binding fragment thereof comprising an amino acid sequence of SEQ ID NO: 84.

    [0281] In some embodiments, the disclosure also provides an isolated antibody or antigen binding fragment thereof comprising an amino acid sequence of SEQ ID NO: 85.

    [0282] In some embodiments, the disclosure provides an isolated antibody or antigen binding fragment thereof comprising an amino acid sequence of SEQ ID NO: 86.

    [0283] In some embodiments, the disclosure provides an isolated antibody or antigen binding fragment thereof comprising an amino acid sequence of SEQ ID NO: 88.

    [0284] In some embodiments, the disclosure provides an isolated antibody or antigen binding fragment thereof comprising an amino acid sequence of SEQ ID NO: 89.

    [0285] In some embodiments, the disclosure provides an isolated antibody or antigen binding fragment thereof comprising an amino acid sequence of SEQ ID NO: 90.

    [0286] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises the heavy chain of SEQ ID NO: 84 and the light chain of SEQ ID NO: 85.

    [0287] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises the heavy chain of SEQ ID NO: 86 and the light chain of SEQ ID NO: 85.

    [0288] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises the heavy chain of SEQ ID NO: 88 and the light chain of SEQ ID NO: 89.

    [0289] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises the heavy chain of SEQ ID NO: 90 and the light chain of SEQ ID NO: 89.

    [0290] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises the heavy chain of SEQ ID NO: 92 and the light chain of SEQ ID NO: 93.

    [0291] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises the heavy chain of SEQ ID NO: 94 and the light chain of SEQ ID NO: 95.

    [0292] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises the heavy chain of SEQ ID NO: 96 and the light chain of SEQ ID NO: 97.

    [0293] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises the heavy chain of SEQ ID NO: 98 and the light chain of SEQ ID NO: 99.

    [0294] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises the heavy chain of SEQ ID NO: 100 and the light chain of SEQ ID NO: 101.

    [0295] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises the heavy chain of SEQ ID NO: 102 and the light chain of SEQ ID NO: 103.

    [0296] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a first heavy chain of SEQ ID NO: 268, a second heavy chain of SEQ ID NO: 282 and the light chain of SEQ ID NO: 269.

    [0297] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a first heavy chain of SEQ ID NO: 284, a second heavy chain of SEQ ID NO: 288 and the light chain of SEQ ID NO: 269.

    [0298] In some embodiments, the disclosure provides an isolated antibody or antigen binding fragment thereof comprising:

    [0299] a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 4, 5, 6, 7, 8, and 9, respectively;

    [0300] a VH of SEQ ID NO: 52 and a VL of SEQ ID NO: 53; and/or

    [0301] a HC of SEQ ID NO: 84 and a LC of SEQ ID NO: 85; and wherein the antibody or antigen binding fragment thereof binds PSMA.

    [0302] In some embodiments, the disclosure provides an isolated antibody or antigen binding fragment thereof comprising:

    [0303] a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 4, 5, 6, 7, 8, and 9, respectively;

    [0304] a VH of SEQ ID NO: 52 and a VL of SEQ ID NO: 53; and/or

    [0305] a HC of SEQ ID NO: 86 and a LC of SEQ ID NO: 85; and wherein the antibody or antigen binding fragment thereof binds PSMA.

    [0306] In some embodiments, the disclosure provides an isolated antibody or antigen binding fragment thereof comprising:

    [0307] a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 10, 11, 12, 13, 14 and 15, respectively;

    [0308] a VH of SEQ ID NO: 54 and a VL of SEQ ID NO: 55; and/or

    [0309] a HC of SEQ ID NO: 88 and a LC of SEQ ID NO: 89; and wherein the antibody or antigen binding fragment thereof binds PSMA.

    [0310] In some embodiments, the disclosure provides an isolated antibody or antigen binding fragment thereof comprising:

    [0311] a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 10, 11, 12, 13, 14 and 15, respectively;

    [0312] a VH of SEQ ID NO: 54 and a VL of SEQ ID NO: 55; and/or

    [0313] a HC of SEQ ID NO: 90 and a LC of SEQ ID NO: 89; and wherein the antibody or antigen binding fragment thereof binds PSMA.

    [0314] In some embodiments, the disclosure provides an isolated antibody or antigen binding fragment thereof comprising:

    [0315] a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 16, 17, 18, 19, 20, and 21, respectively;

    [0316] a VH of SEQ ID NO: 56 and a VL of SEQ ID NO: 57; and/or

    [0317] a HC of SEQ ID NO: 92 and a LC of SEQ ID NO: 93; and wherein the antibody or antigen binding fragment thereof binds PSMA.

    [0318] In some embodiments, the disclosure provides an isolated antibody or antigen binding fragment thereof comprising:

    [0319] a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 22, 23, 24, 25, 26, and 27, respectively;

    [0320] a VH of SEQ ID NO: 58 and a VL of SEQ ID NO: 59; and/or

    [0321] a HC of SEQ ID NO: 94 and a LC of SEQ ID NO: 95; and wherein the antibody or antigen binding fragment thereof binds PSMA.

    [0322] In some embodiments, the disclosure provides an isolated antibody or antigen binding fragment thereof comprising:

    [0323] a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 28, 29, 30, 31, 32, and 33, respectively;

    [0324] a VH of SEQ ID NO: 60 and a VL of SEQ ID NO: 61; and/or

    [0325] a HC of SEQ ID NO: 96 and a LC of SEQ ID NO: 97; and wherein the antibody or antigen binding fragment thereof binds PSMA.

    [0326] In some embodiments, the disclosure provides an isolated antibody or antigen binding fragment thereof comprising

    [0327] a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 34, 35, 36, 37, 38, and 39, respectively;

    [0328] a VH of SEQ ID NO: 62 and a VL of SEQ ID NO: 63; and/or

    [0329] a HC of SEQ ID NO: 98 and a LC of SEQ ID NO: 99; and wherein the antibody or antigen binding fragment thereof binds PSMA.

    [0330] In some embodiments, the disclosure provides an isolated antibody or antigen binding fragment thereof comprising:

    [0331] a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 40, 41, 42, 43, 44, and 45, respectively;

    [0332] a VH of SEQ ID NO: 64 and a VL of SEQ ID NO: 65; and/or

    [0333] a HC of SEQ ID NO: 100 and a LC of SEQ ID NO: 101; and wherein the antibody or antigen binding fragment thereof binds PSMA.

    [0334] In some embodiments, the disclosure provides an isolated antibody or antigen binding fragment thereof comprising:

    [0335] a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 46, 47, 48, 49, 50, and 51, respectively;

    [0336] a VH of SEQ ID NO: 66 and a VL of SEQ ID NO: 67; and/or

    [0337] a HC of SEQ ID NO: 102 and a LC of SEQ ID NO: 103; and wherein the antibody or antigen binding fragment thereof binds PSMA.

    [0338] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising two antigen-binding domains, wherein the first antigen binding domain binds to an epitope of PSMA and the second binding domain binds to a different epitope on PSMA.

    [0339] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a heavy chain variable region comprising a CDR1 sequence having an amino acid sequence of SEQ ID NO: 4, a CDR2 sequence having an amino acid sequence of SEQ ID NO: 5, a CDR3 sequences having an amino acid sequence of SEQ ID NO: 6; a light chain a light chain variable region comprising a CDR1 sequence having an amino acid sequence of SEQ ID NO: 7, a CDR2 sequence having an amino acid sequence of SEQ ID NO: 8, a CDR3 sequence having an amino acid sequence of SEQ ID NO: 9; combined with a heavy chain variable region comprising a CDR1 sequence having an amino acid sequence of SEQ ID NO: 272, a CDR2 sequence having an amino acid sequence of SEQ ID NO: 273, a CDR3 sequence having an amino acid sequence of SEQ ID NO: 274; a light chain a light chain variable region comprising a CDR1 sequence having an amino acid sequence of SEQ ID NO: 275, a CDR2 sequence having an amino acid sequence of SEQ ID NO 276, a CDR3 sequence having an amino acid sequence of SEQ ID NO: 277; and wherein the antibody or antigen binding fragment thereof binds to PSMA, optionally to two different epitopes on PSMA.

    [0340] In some embodiments, the disclosure provides an isolated antibody or antigen binding fragment thereof comprising two antigen-binding domains, wherein the first antigen binding domain binds to an epitope of PSMA and the second binding domain binds to a different epitope on PSMA and wherein:

    [0341] the first antigen binding domain is a Fab or a Fab fragment comprising a HCDR1 of SEQ ID NO: 4, a HCDR2 of SEQ ID NO: 5, a HCDR3 of SEQ ID NO: 6, a LCDR1 of SEQ ID NO: 7, a LCDR2 of SEQ ID NO: 8, a LCDR3 of SEQ ID NO: 9, a VH of SEQ ID NO: 52, a VL of SEQ ID NO: 53, a HC of SEQ ID NO: 268 and a LC of SEQ ID NO: 269; and

    [0342] the second antigen binding domain is in a scFv format comprising a HCDR1 of SEQ ID NO: 272, a HCDR2 of SEQ ID NO: 273, a HCDR3 of SEQ ID NO: 274 a LCDR1 of SEQ ID NO: 275, a LCDR2 of SEQ ID NO: 276, a LCDR3 of SEQ ID NO: 277, a VH of SEQ ID NO: 278, a VL of SEQ ID NO: 279, a HC of SEQ ID NO: 282.

    [0343] In some embodiments the disclosure provides an isolated antibody or antigen binding fragment thereof comprising two antigen-binding domains, wherein the first antigen binding domain binds to an epitope of PSMA and the second binding domain binds to a different epitope on PSMA and wherein:

    [0344] the first antigen binding domain is a Fab or a Fab fragment comprising a HCDR1 of SEQ ID NO: 4, a HCDR2 of SEQ ID NO: 5, a HCDR3 of SEQ ID NO: 6, a LCDR1 of SEQ ID NO: 7, a LCDR2 of SEQ ID NO: 8, a LCDR3 of SEQ ID NO: 9, a VH of SEQ ID NO: 52, a VL of SEQ ID NO: 53, a HC of SEQ ID NO: 284 and a LC of SEQ ID NO: 269; and

    [0345] the second antigen binding domain is in a scFv format comprising a HCDR1 of SEQ ID NO: 272, a HCDR2 of SEQ ID NO: 273, a HCDR3 of SEQ ID NO: 274 a LCDR1 of SEQ ID NO: 275, a LCDR2 of SEQ ID NO: 276, a LCDR3 of SEQ ID NO: 277, a VH of SEQ ID NO: 278, a VL of SEQ ID NO: 279, a HC of SEQ ID NO: 288.

    [0346] In some embodiments the disclosure provides an isolated antibody or antigen binding fragment thereof comprising two antigen-binding domains, wherein the first antigen binding domain binds to an epitope of PSMA and comprises a heavy chain of SEQ ID NO: 268 and a light chain of SEQ ID NO: 269 and the second binding domain binds to a different epitope on PSMA and comprises a heavy chain of SEQ ID NO 282.

    [0347] In some embodiments the disclosure provides an isolated antibody or antigen binding fragment thereof comprising two antigen-binding domains, wherein the first antigen binding domain binds to an epitope of PSMA and comprises a heavy chain of SEQ ID NO: 284 and a light chain of SEQ ID NO: 269 and the second binding domain binds to a different epitope on PSMA and comprises a heavy chain of SEQ ID NO 288.

    [0348] In some embodiments, the disclosure provides an isolated antibody or antigen binding fragment thereof comprising:

    [0349] a first binding domain that binds to a first epitope on PSMA and wherein the first binding domain comprises

    [0350] a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 4, 5, 6, 7, 8, and 9, respectively;

    [0351] a VH of SEQ ID NO: 52 and a VL of SEQ ID NO: 53; and/or

    [0352] a HC of SEQ ID NO: 268 and a LC of SEQ ID NO: 269;

    [0353] a second binding domain that binds to a second epitope on PSMA and wherein the second binding domain comprises

    [0354] a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 272, 273, 274, 275, 276 and 277, respectively;

    [0355] a VH of SEQ ID NO: 278 and a VL of SEQ ID NO: 279; and/or

    [0356] a HC of SEQ ID NO: 282.

    [0357] In some embodiments, the disclosure provides an isolated antibody or antigen binding fragment thereof comprising:

    [0358] a first binding domain that binds to a first epitope on PSMA and wherein the first binding domain comprises

    [0359] a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 4, 5, 6, 7, 8, and 9, respectively;

    [0360] a VH of SEQ ID NO: 52 and a VL of SEQ ID NO: 53; and/or

    [0361] a HC of SEQ ID NO: 284 and a LC of SEQ ID NO: 269;

    [0362] a second binding domain that binds to a second epitope on PSMA and wherein the second binding domain comprises

    [0363] a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 272, 273, 274, 275, 276 and 277, respectively;

    [0364] a VH of SEQ ID NO: 278 and a VL of SEQ ID NO: 279; and/or

    [0365] a HC of SEQ ID NO: 288.

    Homologous Antibodies and Antigen Binding Fragment Thereof

    [0366] Derivatives, homologous antigen binding domains, functional equivalents or variants of said antibody or antigen binding fragment thereof are also object of the disclosure. The antibodies of the present disclosure include homologous antibodies, homologous antigen binding domains, functional equivalents or variants of the disclosed antibody or antigen binding fragment thereof that bind PSMA, that include polypeptides with amino acid sequences substantially identical to the amino acid sequence of the variable domain or hypervariable domain of the antibodies of the present disclosure or polypeptides with conservative substitutions. The homologous antibodies and antigen binding domain, functional equivalents or variants of the disclosure have sufficient homology with the sequences of said antibody or antigen binding fragment thereof that binds PSMA and are functionally similar to the unmodified anti-PSMA antibody to retain binding to PSMA or retain at least one of the activities of the unmodified antibody.

    [0367] The term “antibody derivative”, “homologous antigen binding domain”, “functional equivalents” or “variants” refer to antibodies comprising one or more mutations, substitutions, deletions and/or additions of one or more amino acid residues. Such an addition, substitution or deletion can be located at any position in the molecule. In the case where several amino acids have been added, substituted or deleted, any combination of addition, substitution or deletion can be considered, on condition that the resulting antibody still has at least the advantageous properties of the antibody of the disclosure.

    [0368] In some embodiments, the disclosure provides amino acid sequence modification(s) of the antibodies or antigen binding fragment thereof described herein. For example, it may be desirable to improve the binding affinity and/or other biological properties of the antibody, including but not limited to specificity, thermostability, expression level, effector functions, glycosylation (e.g., fucosylation), reduced immunogenicity, or solubility. Thus, in addition to the antibodies and antigen binding fragment described herein, antibody variants can be prepared by introducing appropriate nucleotide changes into the encoding DNA, and/or by adding mutations, substitutions, deletions and/or additions of one or more amino acid residues to the antibodies and antigen binding fragment described herein.

    [0369] In some embodiments, the antibodies and antigen binding fragments thereof provided herein are chemically modified, for example, by the covalent attachment of any type of molecule to the antibody. The antibody derivatives may include antibodies that have been chemically modified, for example, by glycosylation, acetylation, pegylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, linkage to a cellular ligand or other protein, etc. Any of numerous chemical modifications may be carried out by known techniques, including, but not limited to, specific chemical cleavage, acetylation, formulation, metabolic synthesis of tunicamycin, etc. Additionally, the antibody may contain one or more non-classical amino acids.

    [0370] Variations may also include a substitution, deletion, or insertion of one or more codons encoding the antibody or polypeptide that results in a change in the amino acid sequence as compared with the native sequence antibody or polypeptide. Amino acid substitutions can be the result of replacing one amino acid with another amino acid having similar structural and/or chemical properties.

    [0371] Sequences of the disclosure may comprise amino acid sequences with at least 80% identity or homology to the sequences of the antibody or antigen binding fragment thereof, described above. In some embodiments, the sequence identity may be about 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% to the antigen binding domains that bind PSMA of the disclosure. Variants of the antigen binding domains that bind PSMA comprising 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28 or 29 amino acid substitutions in the antigen binding domain that bind PSMA are within the scope of the disclosure, as long as they retain or have improved functional properties when compared to the parent antigen binding domains. Functional equivalents or variants of the antigen binding domains that bind PSMA include one or more deletions and/or additions of one or more amino acid residues. Such an addition, substitution or deletion can be located at any position in the molecule. In the case where several amino acids have been added, substituted or deleted, any combination of addition, substitution or deletion can be considered, on condition that the resulting antibody still has at least the advantageous properties of the antibody of the disclosure.

    [0372] The terms “identical” or percent “identity” in the context of two or more nucleic acids or polypeptide sequences (e.g., anti-PSMA antibodies and polynucleotides that encode them), refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same, when compared and aligned for maximum correspondence, as measured using one of the following sequence comparison algorithms or by visual inspection. The percent (%) amino acid sequence identity with respect to a reference polypeptide is defined as the percentage of amino acid residues in a given sequence that are identical to the amino acid residues in the reference polypeptide sequence. The percent (%) identity between the two sequences is a function of the number of identical positions shared by the sequences (i.e., % identity=number of identical positions/total number of positions×100), taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences. The percent identity between two amino acid sequences may be determined using various the algorithms that are within the skill in the art, using publicly available software such as BLAS, BLAST-2, ALIGN. Megalin (DNASTAR) or the GAP program available in the GCG software package.

    [0373] A polypeptide is typically substantially identical to a second polypeptide, for example, where the two peptides differ only by conservative substitutions. The antibodies of the present disclosure also include those for which binding characteristics, functional or physical properties have been improved by direct mutations. In some embodiments, variant antigen binding domains that bind PSMA comprise one or two conservative substitutions in any of the CDR regions, while retaining desired functional properties of the parent antigen binding fragments that bind PSMA.

    [0374] In a specific embodiment, the substitution is a conservative amino acid substitution made at one or more predicted non-essential amino acid residues. “Conservative modifications” or “conservative substitution” refer to amino acid modifications that do not significantly affect or alter the binding characteristics of the antibody containing the amino acid modifications. Conservative modifications include amino acid substitutions, additions and deletions. Conservative amino acid substitutions are those in which the amino acid is replaced with an amino acid residue having a similar side chain. The families of amino acid residues having similar side chains are well defined and include amino acids with acidic side chains (e.g., aspartic acid, glutamic acid), basic side chains (e.g., lysine, arginine, histidine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine), uncharged polar side chains (e.g., glycine, asparagine, glutamine, cysteine, serine, threonine, tyrosine, tryptophan), aromatic side chains (e.g., phenylalanine, tryptophan, histidine, tyrosine), aliphatic side chains (e.g., glycine, alanine, valine, leucine, isoleucine, serine, threonine), amide (e.g., asparagine, glutamine), beta-branched side chains (e.g., threonine, valine, isoleucine) and sulfur-containing side chains (cysteine, methionine). Furthermore, any native residue in the polypeptide may also be substituted with alanine, as has been previously described for alanine scanning mutagenesis (MacLennan et al., (1988) Acta Physiol Scand Suppl 643:55-67; Sasaki et al., (1988) Adv Biophys 35:1-24).

    [0375] Standard techniques known to those of skill in the art can be used to introduce mutations in the nucleotide sequence encoding a molecule provided herein, including, for example, site-directed mutagenesis and PCR-mediated mutagenesis which results in amino acid substitutions.

    [0376] Alternatively, mutations can be introduced randomly along all or part of the coding sequence, such as by saturation mutagenesis, and the resultant mutants can be screened for biological activity to identify mutants that retain activity. Following mutagenesis, the encoded protein can be expressed and the activity of the protein can be determined.

    [0377] Amino acid sequence insertions include amino- and/or carboxyl-terminal fusions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues. Examples of terminal insertions include an antibody with an N-terminal methionyl residue. Other insertional variants of the antibody molecule include the fusion to the N- or C-terminus of the antibody to an enzyme (e.g., for antibody-directed enzyme prodrug therapy) or a polypeptide which increases the serum half-life of the antibody.

    [0378] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, or at least 99%) identical to the VH of SEQ ID NO: 52 and a VL of at least 80% (e.g. at least 85%, at least 90%, at least 95%, or at least 99%) identical to the VL of SEQ ID NO: 53.

    [0379] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, or at least 99%) identical to the VH of SEQ ID NO: 54 and a VL of at least 80% (e.g. at least 85%, at least 90%, at least 95%, or at least 99%) identical to the VL of SEQ ID NO: 55.

    [0380] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, or at least 99%) identical to the VH of SEQ ID NO: 56 and a VL of at least 80% (e.g. at least 85%, at least 90%, at least 95%, or at least 99%) identical to the VL of SEQ ID NO: 57.

    [0381] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, or at least 99%) identical to the VH of SEQ ID NO: 58 and a VL of at least 80% (e.g. at least 85%, at least 90%, at least 95%, or at least 99%) identical to the VL of SEQ ID NO: 59.

    [0382] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, or at least 99%) identical to the VH of SEQ ID NO: 60 and a VL of at least 80% (e.g. at least 85%, at least 90%, at least 95%, or at least 99%) identical to the VL of SEQ ID NO: 61.

    [0383] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, or at least 99%) identical to the VH of SEQ ID NO: 62 and a VL of at least 80% (e.g. at least 85%, at least 90%, at least 95%, or at least 99%) identical to the VL of SEQ ID NO: 63.

    [0384] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, or at least 99%) identical to the VH of SEQ ID NO: 64 and a VL of at least 80% (e.g. at least 85%, at least 90%, at least 95%, or at least 99%) identical to the VL of SEQ ID NO: 65.

    [0385] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, or at least 99%) identical to the VH of SEQ ID NO: 66 and a VL of at least 80% (e.g. at least 85%, at least 90%, at least 95%, or at least 99%) identical to the VL of SEQ ID NO: 67.

    [0386] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, or at least 99%) identical to the VH of SEQ ID NO: 278 and a VL of at least 80% (e.g. at least 85%, at least 90%, at least 95%, or at least 99%) identical to the VL of SEQ ID NO: 279.

    [0387] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH which is at least 80% (e.g. at least 85%, at least 90%, at least 95% or at least 99%) identical to the VH of SEQ ID NO: 52 and a VL of SEQ ID NO: 53.

    [0388] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH of SEQ ID NO: 52 and a VL which is at least 80% (e.g. at least 85%, at least 90%, at least 95% or at least 99%) identical to the VL of SEQ ID NO: 53.

    [0389] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH which is at least 95% identical to the VH of SEQ ID NO: 52 and a VL which is at least 95% identical to the VL of SEQ ID NO: 53.

    [0390] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH which is at least 95% identical to the VH of SEQ ID NO: 52 and a VL of SEQ ID NO: 53.

    [0391] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH of SEQ ID NO: 52 and a VL which is at least 95% identical to the VL of SEQ ID NO: 53.

    [0392] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH which is at least 95% identical to the VH of SEQ ID NO: 52 and a VL which is at least 99% identical to the VL of SEQ ID NO: 53.

    [0393] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH which is at least 99% identical to the VH of SEQ ID NO: 52 and a VL which is at least 99% identical to the VL of SEQ ID NO: 53.

    [0394] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH which is at least 99% identical to the VH of SEQ ID NO: 52 and a VL which is at least 95% identical to the VL of SEQ ID NO: 53.

    [0395] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, or at least 99%) identical to the VH of SEQ ID NO: 52 and a VL of at least 80% (e.g. at least 85%, at least 90%, at least 95%, or at least 99%) identical to the VL of SEQ ID NO: 53, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs 4, 5, 6, 7, 8, and 9, respectively.

    [0396] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH which is at least 80% (e.g. at least 85%, at least 90%, at least 95% or at least 99%) identical to the VH of SEQ ID NO: 52 and a VL of SEQ ID NO: 53, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs 4, 5, 6, 7, 8, and 9, respectively.

    [0397] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH of SEQ ID NO: 52 and a VL which is at least 80% (e.g. at least 85%, at least 90%, at least 95% or at least 99%) identical to the VL of SEQ ID NO: 53, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs 4, 5, 6, 7, 8, and 9, respectively.

    [0398] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH which is at least 95% identical to the VH of SEQ ID NO: 52 and a VL which is at least 95% identical to the VL of SEQ ID NO: 53, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs 4, 5, 6, 7, 8, and 9, respectively.

    [0399] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH which is at least 95% identical to the VH of SEQ ID NO: 52 and a VL of SEQ ID NO: 53, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs 4, 5, 6, 7, 8, and 9, respectively.

    [0400] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH of SEQ ID NO: 52 and a VL which is at least 95% identical to the VL of SEQ ID NO: 53, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs 4, 5, 6, 7, 8, and 9, respectively.

    [0401] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH which is at least 95% identical to the VH of SEQ ID NO: 52 and a VL which is at least 99% identical to the VL of SEQ ID NO: 53, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs 4, 5, 6, 7, 8, and 9, respectively.

    [0402] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH which is at least 99% identical to the VH of SEQ ID NO: 52 and a VL which is at least 99% identical to the VL of SEQ ID NO: 53, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs 4, 5, 6, 7, 8, and 9, respectively.

    [0403] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH which is at least 99% identical to the VH of SEQ ID NO: 52 and a VL which is at least 95% identical to the VL of SEQ ID NO: 53, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs 4, 5, 6, 7, 8, and 9, respectively.

    [0404] In some embodiment, the disclosure also provides an isolated antibody or antigen binding fragment thereof comprising an amino acid sequence at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the amino acid sequence of SEQ ID NO: 84 and wherein the antibody or antigen binding fragment thereof binds PSMA.

    [0405] In some embodiments, the disclosure also provides an isolated antibody or antigen binding fragment thereof comprising an amino acid sequence at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the amino acid sequence of SEQ ID NO: 85; and wherein the antibody or antigen binding fragment thereof binds PSMA.

    [0406] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 84 and a LC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 85; and wherein the antibody or antigen binding fragment thereof binds PSMA.

    [0407] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 80% (e.g. at least 85%, at least 90%, at least 95% or at least 99%) identical to the HC of SEQ ID NO: 84 and a LC of SEQ ID NO: 85.

    [0408] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC of SEQ ID NO: 84 and a LC which is at least 80% (e.g. at least 85%, at least 90%, at least 95% or at least 99%) identical to the LC of SEQ ID NO: 85.

    [0409] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 95% identical to the HC of SEQ ID NO: 84 and a LC which is at least 95% identical to the LC of SEQ ID NO: 85.

    [0410] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 95% identical to the HC of SEQ ID NO: 84 and a LC which is at least 99% identical to the LC of SEQ ID NO: 85.

    [0411] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 99% identical to the HC of SEQ ID NO: 84 and a LC which is at least 99% identical to the LC of SEQ ID NO: 85.

    [0412] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 99% identical to the HC of SEQ ID NO: 84 and a LC which is at least 95% identical to the LC of SEQ ID NO: 85.

    [0413] In some embodiment, the disclosure also provides an isolated antibody or antigen binding fragment thereof comprising an amino acid sequence at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the amino acid sequence of SEQ ID NO: 86 and wherein the antibody or antigen binding fragment thereof binds PSMA.

    [0414] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 86 and a LC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 85; and wherein the antibody or antigen binding fragment thereof binds PSMA.

    [0415] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 80% (e.g. at least 85%, at least 90%, at least 95% or at least 99%) identical to the HC of SEQ ID NO: 86 and a LC of SEQ ID NO: 85.

    [0416] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC of SEQ ID NO: 86 and a LC which is at least 80% (e.g. at least 85%, at least 90%, at least 95% or at least 99%) identical to the LC of SEQ ID NO: 85.

    [0417] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 95% identical to the HC of SEQ ID NO: 86 and a LC which is at least 95% identical to the LC of SEQ ID NO: 85.

    [0418] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 95% identical to the HC of SEQ ID NO: 86 and a LC which is at least 99% identical to the LC of SEQ ID NO: 85.

    [0419] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 99% identical to the HC of SEQ ID NO: 86 and a LC which is at least 99% identical to the LC of SEQ ID NO: 85.

    [0420] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 99% identical to the HC of SEQ ID NO: 86 and a LC which is at least 95% identical to the LC of SEQ ID NO: 85.

    [0421] In some embodiment, the disclosure also provides an isolated antibody or antigen binding fragment thereof comprising an amino acid sequence at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the amino acid sequence of SEQ ID NO: 88 and wherein the antibody or antigen binding fragment thereof binds PSMA.

    [0422] In some embodiment, the disclosure also provides an isolated antibody or antigen binding fragment thereof comprising an amino acid sequence at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the amino acid sequence of SEQ ID NO: 89 and wherein the antibody or antigen binding fragment thereof binds PSMA.

    [0423] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 88 and a LC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 89; and wherein the antibody or antigen binding fragment thereof binds PSMA.

    [0424] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 80% (e.g. at least 85%, at least 90%, at least 95% or at least 99%) identical to the HC of SEQ ID NO: 88 and a LC of SEQ ID NO: 89.

    [0425] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC of SEQ ID NO: 88 and a LC which is at least 80% (e.g. at least 85%, at least 90%, at least 95% or at least 99%) identical to the LC of SEQ ID NO: 89.

    [0426] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 95% identical to the HC of SEQ ID NO: 88 and a LC which is at least 95% identical to the LC of SEQ ID NO: 89.

    [0427] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 95% identical to the HC of SEQ ID NO: 88 and a LC which is at least 99% identical to the LC of SEQ ID NO: 89.

    [0428] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 99% identical to the HC of SEQ ID NO: 88 and a LC which is at least 99% identical to the LC of SEQ ID NO: 89.

    [0429] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 99% identical to the HC of SEQ ID NO: 88 and a LC which is at least 95% identical to the LC of SEQ ID NO: 89.

    [0430] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 84 and a LC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 4, 5, 6, 7, 8, and 9, respectively.

    [0431] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 80% (e.g. at least 85%, at least 90%, at least 95% or at least 99%) identical to the HC of SEQ ID NO: 84 and a LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 4, 5, 6, 7, 8, and 9, respectively.

    [0432] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC of SEQ ID NO: 84 and a LC which is at least 80% (e.g. at least 85%, at least 90%, at least 95% or at least 99%) identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 4, 5, 6, 7, 8, and 9, respectively.

    [0433] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 95% identical to the HC of SEQ ID NO: 84 and a LC which is at least 95% identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 4, 5, 6, 7, 8, and 9, respectively.

    [0434] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 95% identical to the HC of SEQ ID NO: 84 and a LC which is at least 99% identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 4, 5, 6, 7, 8, and 9, respectively.

    [0435] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 99% identical to the HC of SEQ ID NO: 84 and a LC which is at least 99% identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 4, 5, 6, 7, 8, and 9, respectively.

    [0436] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 99% identical to the HC of SEQ ID NO: 84 and a LC which is at least 95% identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 4, 5, 6, 7, 8, and 9, respectively.

    [0437] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 86 and a LC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 4, 5, 6, 7, 8, and 9, respectively.

    [0438] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 80% (e.g. at least 85%, at least 90%, at least 95% or at least 99%) identical to the HC of SEQ ID NO: 86 and a LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 4, 5, 6, 7, 8, and 9, respectively.

    [0439] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC of SEQ ID NO: 86 and a LC which is at least 80% (e.g. at least 85%, at least 90%, at least 95% or at least 99%) identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 4, 5, 6, 7, 8, and 9, respectively.

    [0440] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 95% identical to the HC of SEQ ID NO: 86 and a LC which is at least 95% identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 4, 5, 6, 7, 8, and 9, respectively.

    [0441] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 95% identical to the HC of SEQ ID NO: 86 and a LC which is at least 99% identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 4, 5, 6, 7, 8, and 9, respectively.

    [0442] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 99% identical to the HC of SEQ ID NO: 86 and a LC which is at least 99% identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 4, 5, 6, 7, 8, and 9, respectively.

    [0443] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 99% identical to the HC of SEQ ID NO: 86 and a LC which is at least 95% identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 4, 5, 6, 7, 8, and 9, respectively.

    [0444] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 88 and a LC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 89, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 4, 5, 6, 7, 8, and 9, respectively.

    [0445] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 80% (e.g. at least 85%, at least 90%, at least 95% or at least 99%) identical to the HC of SEQ ID NO: 88 and a LC of SEQ ID NO: 89, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 4, 5, 6, 7, 8, and 9, respectively.

    [0446] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC of SEQ ID NO: 88 and a LC which is at least 80% (e.g. at least 85%, at least 90%, at least 95% or at least 99%) identical to the LC of SEQ ID NO: 89, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 4, 5, 6, 7, 8, and 9, respectively.

    [0447] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 95% identical to the HC of SEQ ID NO: 88 and a LC which is at least 95% identical to the LC of SEQ ID NO: 89, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 4, 5, 6, 7, 8, and 9, respectively.

    [0448] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 95% identical to the HC of SEQ ID NO: 88 and a LC which is at least 99% identical to the LC of SEQ ID NO: 89, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 4, 5, 6, 7, 8, and 9, respectively.

    [0449] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 99% identical to the HC of SEQ ID NO: 88 and a LC which is at least 99% identical to the LC of SEQ ID NO: 89, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 4, 5, 6, 7, 8, and 9, respectively.

    [0450] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 99% identical to the HC of SEQ ID NO: 88 and a LC which is at least 95% identical to the LC of SEQ ID NO: 89, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 4, 5, 6, 7, 8, and 9, respectively.

    [0451] The disclosure also provides an isolated antibody comprising a HC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 84 and a LC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a VH of SEQ ID NO: 52 and a VL of SEQ ID NO: 53.

    [0452] In some embodiments, the antibody that binds PSMA comprises a HC which is at least 80% (e.g. at least 85%, at least 90%, at least 95% or at least 99%) identical to the HC of SEQ ID NO: 84 and a LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a VH of SEQ ID NO: 52 and a VL of SEQ ID NO: 53.

    [0453] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC of SEQ ID NO: 84 and a LC which is at least 80% (e.g. at least 85%, at least 90%, at least 95% or at least 99%) identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a VH of SEQ ID NO: 52 and a VL of SEQ ID NO: 53.

    [0454] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 95% identical to the HC of SEQ ID NO: 84 and a LC which is at least 95% identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a VH of SEQ ID NO: 52 and a VL of SEQ ID NO: 53.

    [0455] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 95% identical to the HC of SEQ ID NO: 84 and a LC which is at least 99% identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a VH of SEQ ID NO: 52 and a VL of SEQ ID NO: 53.

    [0456] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 99% identical to the HC of SEQ ID NO: 84 and a LC which is at least 99% identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a VH of SEQ ID NO: 52 and a VL of SEQ ID NO: 53.

    [0457] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 99% identical to the HC of SEQ ID NO: 84 and a LC which is at least 95% identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a VH of SEQ ID NO: 52 and a VL of SEQ ID NO: 53.

    [0458] The disclosure also provides an isolated antibody comprising a HC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 86 and a LC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a VH of SEQ ID NO: 52 and a VL of SEQ ID NO: 53.

    [0459] In some embodiments, the antibody that binds PSMA comprises a HC which is at least 80% (e.g. at least 85%, at least 90%, at least 95% or at least 99%) identical to the HC of SEQ ID NO: 86 and a LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a VH of SEQ ID NO: 52 and a VL of SEQ ID NO: 53.

    [0460] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC of SEQ ID NO: 86 and a LC which is at least 80% (e.g. at least 85%, at least 90%, at least 95% or at least 99%) identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a VH of SEQ ID NO: 52 and a VL of SEQ ID NO: 53.

    [0461] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 95% identical to the HC of SEQ ID NO: 86 and a LC which is at least 95% identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a VH of SEQ ID NO: 52 and a VL of SEQ ID NO: 53.

    [0462] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 95% identical to the HC of SEQ ID NO: 86 and a LC which is at least 99% identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a VH of SEQ ID NO: 52 and a VL of SEQ ID NO: 53.

    [0463] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 99% identical to the HC of SEQ ID NO: 86 and a LC which is at least 99% identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a VH of SEQ ID NO: 52 and a VL of SEQ ID NO: 53.

    [0464] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 99% identical to the HC of SEQ ID NO: 86 and a LC which is at least 95% identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a VH of SEQ ID NO: 52 and a VL of SEQ ID NO: 53.

    [0465] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH which is at least 80% (e.g. at least 85%, at least 90%, at least 95% or at least 99%) identical to the VH of SEQ ID NO: 54 and a VL of SEQ ID NO: 55.

    [0466] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH of SEQ ID NO: 54 and a VL which is at least 80% (e.g. at least 85%, at least 90%, at least 95% or at least 99%) identical to the VL of SEQ ID NO: 55.

    [0467] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH which is at least 95% identical to the VH of SEQ ID NO: 54 and a VL which is at least 95% identical to the VL of SEQ ID NO: 55.

    [0468] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH which is at least 95% identical to the VH of SEQ ID NO: 54 and a VL of SEQ ID NO: 55.

    [0469] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH of SEQ ID NO: 54 and a VL which is at least 95% identical to the VL of SEQ ID NO: 55.

    [0470] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH which is at least 95% identical to the VH of SEQ ID NO: 54 and a VL which is at least 99% identical to the VL of SEQ ID NO: 55.

    [0471] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH which is at least 99% identical to the VH of SEQ ID NO: 54 and a VL which is at least 99% identical to the VL of SEQ ID NO: 55.

    [0472] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH which is at least 99% identical to the VH of SEQ ID NO: 54 and a VL which is at least 95% identical to the VL of SEQ ID NO: 55.

    [0473] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, or at least 99%) identical to the VH of SEQ ID NO: 54 and a VL of at least 80% (e.g. at least 85%, at least 90%, at least 95%, or at least 99%) identical to the VL of SEQ ID NO: 55, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs 10, 11, 12, 13, 14 and 15, respectively.

    [0474] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH which is at least 80% (e.g. at least 85%, at least 90%, at least 95% or at least 99%) identical to the VH of SEQ ID NO: 54 and a VL of SEQ ID NO: 55, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs 10, 11, 12, 13, 14 and 15, respectively.

    [0475] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH of SEQ ID NO: 54 and a VL which is at least 80% (e.g. at least 85%, at least 90%, at least 95% or at least 99%) identical to the VL of SEQ ID NO: 55, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs 10, 11, 12, 13, 14 and 15, respectively.

    [0476] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH which is at least 95% identical to the VH of SEQ ID NO: 54 and a VL which is at least 95% identical to the VL of SEQ ID NO: 55, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs 10, 11, 12, 13, 14 and 15, respectively.

    [0477] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH which is at least 95% identical to the VH of SEQ ID NO: 54 and a VL of SEQ ID NO: 55, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs 10, 11, 12, 13, 14 and 15, respectively.

    [0478] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH of SEQ ID NO: 54 and a VL which is at least 95% identical to the VL of SEQ ID NO: 55, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs 10, 11, 12, 13, 14 and 15, respectively.

    [0479] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH which is at least 95% identical to the VH of SEQ ID NO: 54 and a VL which is at least 99% identical to the VL of SEQ ID NO: 55, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs 10, 11, 12, 13, 14 and 15, respectively.

    [0480] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH which is at least 99% identical to the VH of SEQ ID NO: 54 and a VL which is at least 99% identical to the VL of SEQ ID NO: 55, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs 10, 11, 12, 13, 14 and 15, respectively.

    [0481] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH which is at least 99% identical to the VH of SEQ ID NO: 54 and a VL which is at least 95% identical to the VL of SEQ ID NO: 55, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs 10, 11, 12, 13, 14 and 15, respectively.

    [0482] The disclosure also provides an isolated antibody comprising a HC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 88 and a LC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 89, wherein the antibody or antigen binding fragment comprises a VH of SEQ ID NO: 54 and a VL of SEQ ID NO: 55.

    [0483] In some embodiments, the antibody that binds PSMA comprises a HC which is at least 80% (e.g. at least 85%, at least 90%, at least 95% or at least 99%) identical to the HC of SEQ ID NO: 88 and a LC of SEQ ID NO: 89, wherein the antibody or antigen binding fragment comprises a VH of SEQ ID NO: 54 and a VL of SEQ ID NO: 55.

    [0484] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC of SEQ ID NO: 88 and a LC which is at least 80% (e.g. at least 85%, at least 90%, at least 95% or at least 99%) identical to the LC of SEQ ID NO: 89, wherein the antibody or antigen binding fragment comprises a VH of SEQ ID NO: 54 and a VL of SEQ ID NO: 55.

    [0485] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 95% identical to the HC of SEQ ID NO: 88 and a LC which is at least 95% identical to the LC of SEQ ID NO: 89, wherein the antibody or antigen binding fragment comprises a VH of SEQ ID NO: 54 and a VL of SEQ ID NO: 55.

    [0486] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 95% identical to the HC of SEQ ID NO: 88 and a LC which is at least 99% identical to the LC of SEQ ID NO: 89, wherein the antibody or antigen binding fragment comprises a VH of SEQ ID NO: 54 and a VL of SEQ ID NO: 55.

    [0487] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 99% identical to the HC of SEQ ID NO: 88 and a LC which is at least 99% identical to the LC of SEQ ID NO: 89, wherein the antibody or antigen binding fragment comprises a VH of SEQ ID NO: 54 and a VL of SEQ ID NO: 55.

    [0488] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 99% identical to the HC of SEQ ID NO: 88 and a LC which is at least 95% identical to the LC of SEQ ID NO: 89, wherein the antibody or antigen binding fragment comprises a VH of SEQ ID NO: 54 and a VL of SEQ ID NO: 55.

    [0489] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises comprising two antigen-binding domains, wherein the first antigen binding domain binds to an epitope of PSMA and the second binding domain binds to a different epitope on PSMA and wherein:

    [0490] the first antigen binding domain comprises a VH which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, or at least 99%) identical to the VH of SEQ ID NO: 52 and a VL of at least 80% (e.g. at least 85%, at least 90%, at least 95%, or at least 99%) identical to the VL of SEQ ID NO: 53; and

    [0491] the second antigen binding domain comprises a VH which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, or at least 99%) identical to the VH of SEQ ID NO: 278 and a VL of at least 80% (e.g. at least 85%, at least 90%, at least 95%, or at least 99%) identical to the VL of SEQ ID NO: 279.

    [0492] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises comprising two antigen-binding domains, wherein the first antigen binding domain binds to an epitope of PSMA and the second binding domain binds to a different epitope on PSMA and wherein:

    [0493] the first antigen binding domain comprises a heavy chain which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, or at least 99%) identical to SEQ ID NO: 268 and a light chain which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, or at least 99%) identical to SEQ ID NO: 269; and

    [0494] the second antigen binding domain comprises a heavy chain which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, or at least 99%) identical to SEQ ID NO: 282.

    [0495] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises comprising two antigen-binding domains, wherein the first antigen binding domain binds to an epitope of PSMA and the second binding domain binds to a different epitope on PSMA and wherein:

    [0496] the first antigen binding domain comprises a heavy chain which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, or at least 99%) identical to SEQ ID NO: 284 and a light chain which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, or at least 99%) identical to SEQ ID NO: 269; and

    [0497] the second antigen binding domain comprises a heavy chain which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, or at least 99%) identical to SEQ ID NO: 288.

    Half-Life Extension Moiety and Fc Engineering

    [0498] In addition to the modification set forth above, the anti-PSMA antibody or antigen binding fragment thereof of the present disclosure and their functional equivalents may be conjugated to other antibodies, proteins, antigen binding fragments or alternative scaffolds that may be used to adjust, alter, improve or moderate antibody characteristics as desired.

    [0499] For example, antibodies with increased in vivo half-lives can be generated by attaching half-life extending moiety such as albumin, albumin variants, albumin-binding proteins and/or domains, transferrin and fragments and analogues thereof, immunoglobulins (Ig) or fragments thereof, such as Fc regions to the antibody, antigen binding fragment of the disclosure. Additional half-life extending moieties include polyethylene glycol (PEG) molecules, such as PEG5000 or PEG20,000, fatty acids and fatty acid esters of different chain lengths, for example laurate, myristate, stearate, arachidate, behenate, oleate, arachidonate, octanedioic acid, tetradecanedioic acid, octadecanedioic acid, docosanedioic acid, and the like, polylysine, octane, carbohydrates (dextran, cellulose, oligo- or polysaccharides) for desired properties. These moieties may be direct fusions with the antibody or antigen binding fragment of the disclosure and may be generated by standard cloning and expression techniques.

    [0500] Half-life extending moieties can be attached to antibodies or antibody fragments or derivatives with or without a multifunctional linker either through conjugation to the N- or C-terminus of said antibodies or antibody fragments or via epsilon-amino groups present on lysine residues. Alternatively, well known chemical coupling methods may be used to attach the moieties to the recombinantly produced antibody or antigen binding fragment of the disclosure.

    [0501] A pegyl moiety may for example be conjugated to the antibody or antigen binding fragment thereof that bind PSMA by incorporating a cysteine residue to the C-terminus of the antibody or antigen binding fragment that bind PSMA or engineering cysteines into residue positions that face away from the PSMA binding site and attaching a pegyl group to the cysteine using well known methods.

    [0502] In some embodiments, the half-life extending moiety is albumin.

    [0503] In some embodiments, the half-life extending moiety is the albumin binding domain.

    [0504] In some embodiments, the half-life extending moiety is transferrin.

    [0505] In some embodiments, the half-life extending moiety is polyethylene glycol.

    [0506] In some embodiments, the half-life extending moiety is an Ig constant region or a fragment of the Ig constant region.

    [0507] In some embodiments, the half-life extending moiety is an Ig.

    [0508] In some embodiments, the half-life extending moiety is a fragment of the Ig.

    [0509] In some embodiments, the half-life extending moiety is the Ig constant region.

    [0510] In some embodiments, the half-life extending moiety is the fragment of the Ig constant region.

    [0511] In some embodiments, the half-life extending moiety is the Fc region.

    [0512] The Ig constant region or the fragment of the Ig constant region, such as the Fc region present in the antibody or antigen binding fragment thereof of the disclosure may be of any allotype or isotype, i.e., IgG1, IgG2, IgG3, IgG4, IgM, IgA and IgE.

    [0513] In some embodiments, the Ig constant region or the fragment of the Ig constant region is an IgG1 isotype.

    [0514] In some embodiments, the Ig constant region or the fragment of the Ig constant region is an IgG2 isotype.

    [0515] In some embodiments, the Ig constant region or the fragment of the Ig constant region is an IgG3 isotype.

    [0516] In some embodiments, the Ig constant region or the fragment of the Ig constant region is an IgG4 isotype.

    [0517] It is expected that allotype has no influence on properties of the Ig constant region, such as binding or Fc-mediated effector functions. Imunogenicity of therapeutic proteins comprising Ig constant regions of fragments thereof is associated with increased risk of infusion reactions and decreased duration of therapeutic response (Baert et al., (2003) N Engl J Med 348:602-08). The extent to which therapeutic proteins comprising Ig constant regions of fragments thereof induce an immune response in the host may be determined in part by the allotype of the Ig constant region (Stickler et al., (2011) Genes and Immunity 12:213-21). Ig constant region allotype is related to amino acid sequence variations at specific locations in the constant region sequences of the antibody.

    [0518] The antibody or antigen binding fragment thereof of the present disclosure and their functional equivalents may be conjugated to an Ig constant region or to the fragment of an Ig constant region to modulate the antibody or antigen binding fragment effector functions such as ADCC, ADCP and/or ADCP and/or pharmacokinetic properties. This may be achieved by introducing mutation(s) into the Fc that modulate binding of the mutated Fc to activating FcγRs (FcγRI, FcγRIIa, FcγRIII), inhibitory FcγRIIb and/or to FcRn.

    [0519] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA is conjugated to an Ig constant region or the fragment of the Ig constant region comprising at least one mutation in the Ig constant region or in the fragment of the Ig constant region.

    [0520] In some embodiments, the at least one mutation is in the Fc region.

    [0521] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA is conjugated to an Ig constant region or to the fragment of the Ig constant region comprises at least one, two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen or fifteen mutations in the Fc region.

    [0522] The neonatal Fc receptor (FcRn) plays a central role in the cellular trafficking and serum half-life of IgGs. In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA is conjugated to an Ig constant region or to the fragment of the Ig constant region comprising at least one mutation in the Fc region that modulates binding of the antibody or antigen binding fragment to FcRn and modulates the half-life of the antibody or antigen binding fragment.

    [0523] In some embodiments, the Ig constant region or the fragment of the first Ig constant region comprises at least one mutation that modulates a half-life of the isolated antibody or antigen binding fragment thereof.

    [0524] Fc positions that may be mutated to modulate half-life (e.g. binding to FcRn) include positions 250, 252, 253, 254, 256, 257, 307, 376, 380, 428, 434 and 435. Exemplary mutations that may be made singularly or in combination are mutations T250Q, M252Y, I253A, S254T, T256E, P257I, T307A, D376V, E380A, M428L, H433K, N434S, N434A, N434H, N434F, H435A and H435R. Exemplary singular or combination mutations that may be made to increase the half-life are mutations M428L/N434S, M252Y/S254T/T256E, T250Q/M428L, N434A and T307A/E380A/N434A. In some embodiments, the at least one mutation that modulates the half-life of the antibody or antigen binding fragment thereof of the disclosure and their functional equivalents is selected from the group consisting of H435A, P257I/N434H, D376V/N434H, M252Y/S254T/T256E/H433K/N434F, T308P/N434A and H435R, wherein residue numbering is according to the EU index

    [0525] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA is conjugated to the Ig constant region or to the fragment of the Ig constant region comprising M252Y/S254T/T256E mutation.

    [0526] In some embodiments, the antibody or antigen binding fragment of the disclosure and their function equivalents is conjugated to an Ig constant region or to the fragment of the Ig constant region comprising at least one mutation in the Fc region that reduces binding of the protein to an activating Fcγ receptor (FcγR) and/or reduces Fc effector functions such as Clq binding, complement dependent cytotoxicity (CDC), antibody-dependent cell-mediated cytotoxicity (ADCC) or phagocytosis (ADCP).

    [0527] Fc positions that may be mutated to reduce binding of the protein to the activating FcγR and subsequently to reduce effector function include positions 214, 233, 234, 235, 236, 237, 238, 265, 267, 268, 270, 295, 297, 309, 327, 328, 329, 330, 331 and 365. Exemplary mutations that may be made singularly or in combination are mutations K214T, E233P, L234V, L234A, deletion of G236, V234A, F234A, L235A, G237A, P238A, P238S, D265A, S267E, H268A, H268Q, Q268A, N297A, A327Q, P329A, D270A, Q295A, V309L, A327S, L328F, A330S and P331S in IgG1, IgG2, IgG3 or IgG4. Exemplary combination mutations that result in proteins with reduced ADCC are mutations L234A/L235A on IgG1, L234A/L235A/D265S on IgG1, V234A/G237A/P238S/H268A/V309L/A330S/P331S on IgG2, F234A/L235A on IgG4, S228P/F234A/L235A on IgG4, N297A on all Ig isotypes, V234A/G237A on IgG2, K214T/E233P/L234V/L235A/G236-deleted/A327G/P331A/D365E/L358M on IgG1, H268Q/V309L/A330S/P331S on IgG2, S267E/L328F on IgG1, L234F/L235E/D265A on IgG1, L234A/L235A/G237A/P238S/H268A/A330S/P331S on IgG1, S228P/F234A/L235A/G237A/P238S on IgG4, and S228P/F234A/L235A/G236-deleted/G237A/P238S on IgG4. Hybrid IgG2/4 Fc domains may also be used, such as Fc with residues 117-260 from IgG2 and residues 261-447 from IgG4.

    [0528] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA is conjugated to an IgG1 heavy chain constant region or a fragment of the IgG1 heavy chain constant region. In some embodiments, the IgG1 heavy chain constant region comprises at least one mutation that results in reduced binding of the antibody to a FcγR. In some embodiments, the at least one mutation that results in reduced binding of the antibody to the FcγR is selected from the group consisting of F234A/L235A, L234A/L235A, L234A/L235A/D265S, V234A/G237A/P238S/H268A/V309L/A330S/P331S, F234A/L235A, S228P/F234A/L235A, N297A, V234A/G237A, K214T/E233P/L234V/L235A/G236-deleted/A327G/P331A/D365E/L358M, H268Q/V309L/A330S/P331S, S267E/L328F, L234F/L235E/D265A, L234A/L235A/G237A/P238S/H268A/A330S/P331S, S228P/F234A/L235A/G237A/P238S and S228P/F234A/L235A/G236-deleted/G237A/P238S, wherein residue numbering is according to the EU index.

    [0529] In some embodiments, the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the following mutations: L234A_L235A_D265S.

    [0530] In some embodiments, the FcγR is FcγRI, FcγRIIA, FcγRIIB or FcγRIII, or any combination thereof.

    [0531] In some embodiments, the antibody or antigen binding fragment of the disclosure and their function equivalents is conjugated to an Ig constant region or to a fragment of an Ig constant region comprising at least one mutation in the Fc region that enhances binding of the protein to an Fcγ receptor (FcγR) and/or enhances Fc effector functions such as Clq binding, complement dependent cytotoxicity (CDC), antibody-dependent cell-mediated cytotoxicity (ADCC) and/or phagocytosis (ADCP).

    [0532] Fc positions that may be mutated to increase binding of the protein to the activating FcγR and/or enhance Fc effector functions include positions 236, 239, 243, 256, 290, 292, 298, 300, 305, 312, 326, 330, 332, 333, 334, 345, 360, 339, 378, 396 or 430 (residue numbering according to the EU index). Exemplary mutations that may be made singularly or in combination are G236A, S239D, F243L, T256A, K290A, R292P, S298A, Y300L, V305L, K326A, A330K, 1332E, E333A, K334A, A339T and P396L. Exemplary combination mutations that result in proteins with increased ADCC or ADCP are a S239D/I332E, S298A/E333A/K334A, F243L/R292P/Y300L, F243L/R292P/Y300L/P396L, F243L/R292P/Y300L/V305I/P396L and G236A/S239D/1332E.

    [0533] Fc positions that may be mutated to enhance CDC include positions 267, 268, 324, 326, 333, 345 and 430. Exemplary mutations that may be made singularly or in combination are S267E, F1268F, S324T, K326A, K326W, E333A, E345K, E345Q, E345R, E345Y, E430S, E430F and E430T. Exemplary combination mutations that result in proteins with increased CDC are K326A/E333A, K326W/E333A, H268F/S324T, S267E/H268F, S267E/S324T and S267E/H268F/S324T.

    [0534] In some embodiments, the disclosure provides an isolated antibody or antigen binding fragment thereof comprising a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 4, 5, 6, 7, 8, and 9, respectively, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or M252Y/S254T/T256E mutations.

    [0535] In some embodiments, the disclosure provides an isolated antibody or antigen binding fragment thereof comprising a VH of SEQ ID NO: 52 and a VL of SEQ ID NO: 53 and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0536] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, or at least 99%) identical to the VH of SEQ ID NO: 52 and a VL of at least 80% (e.g. at least 85%, at least 90%, at least 95%, or at least 99%) identical to the VL of SEQ ID NO: 53, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 4, 5, 6, 7, 8, and 9, respectively, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0537] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH which is at least 80% (e.g. at least 85%, at least 90%, at least 95% or at least 99%) identical to the VH of SEQ ID NO: 52 and a VL of SEQ ID NO: 53, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 4, 5, 6, 7, 8, and 9, respectively, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0538] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH of SEQ ID NO: 52 and a VL which is at least 80% (e.g. at least 85%, at least 90%, at least 95% or at least 99%) identical to the VL of SEQ ID NO: 53, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 4, 5, 6, 7, 8, and 9, respectively, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0539] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH which is at least 95% identical to the VH of SEQ ID NO: 52 and a VL which is at least 95% identical to the VL of SEQ ID NO: 53, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 4, 5, 6, 7, 8, and 9, respectively, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0540] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH which is at least 95% identical to the VH of SEQ ID NO: 52 and a VL which is at least 99% identical to the VL of SEQ ID NO: 53, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 4, 5, 6, 7, 8, and 9, respectively, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0541] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH which is at least 99% identical to the VH of SEQ ID NO: 52 and a VL which is at least 99% identical to the VL of SEQ ID NO: 53, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 4, 5, 6, 7, 8, and 9, respectively, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0542] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH which is at least 99% identical to the VH of SEQ ID NO: 52 and a VL which is at least 95% identical to the VL of SEQ ID NO: 53, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 4, 5, 6, 7, 8, and 9, respectively, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0543] In some embodiments, the disclosure provides an isolated antibody or antigen binding fragment thereof comprising a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 10, 11, 12, 13, 14, and 15 respectively, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or M252Y/S254T/T256E mutations.

    [0544] In some embodiments, the disclosure provides an isolated antibody or antigen binding fragment thereof comprising a VH of SEQ ID NO: 54 and a VL of SEQ ID NO: 55 and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0545] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, or at least 99%) identical to the VH of SEQ ID NO: 54 and a VL of at least 80% (e.g. at least 85%, at least 90%, at least 95%, or at least 99%) identical to the VL of SEQ ID NO: 55, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 10, 11, 12, 13, 14, and 15, respectively, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0546] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH which is at least 80% (e.g. at least 85%, at least 90%, at least 95% or at least 99%) identical to the VH of SEQ ID NO: 54 and a VL of SEQ ID NO: 55, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 10, 11, 12, 13, 14, and 15, respectively, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0547] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH of SEQ ID NO: 54 and a VL which is at least 80% (e.g. at least 85%, at least 90%, at least 95% or at least 99%) identical to the VL of SEQ ID NO: 55, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 10, 11, 12, 13, 14, respectively, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0548] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH which is at least 95% identical to the VH of SEQ ID NO: 54 and a VL which is at least 95% identical to the VL of SEQ ID NO: 55, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 10, 11, 12, 13, 14, and 15, respectively, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0549] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH which is at least 95% identical to the VH of SEQ ID NO: 54 and a VL which is at least 99% identical to the VL of SEQ ID NO: 55, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 10, 11, 12, 13, 14, and 15, respectively, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0550] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH which is at least 99% identical to the VH of SEQ ID NO: 54 and a VL which is at least 99% identical to the VL of SEQ ID NO: 55, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 10, 11, 12, 13, 14, and 15, respectively, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0551] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a VH which is at least 99% identical to the VH of SEQ ID NO: 54 and a VL which is at least 95% identical to the VL of SEQ ID NO: 55, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 10, 11, 12, 13, 14, and 15, respectively, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0552] In some embodiment, the disclosure also provides an isolated antibody or antigen binding fragment thereof comprising an amino acid sequence at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the amino acid sequence of SEQ ID NO: 84 and wherein the antibody or antigen binding fragment thereof binds PSMA, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0553] In some embodiments, the disclosure also provides an isolated antibody or antigen binding fragment thereof comprising an amino acid sequence at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the amino acid sequence of SEQ ID NO: 85; and wherein the antibody or antigen binding fragment thereof binds PSMA, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0554] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 84 and a LC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 85, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0555] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 80% (e.g. at least 85%, at least 90%, at least 95% or at least 99%) identical to the HC of SEQ ID NO: 84 and a LC of SEQ ID NO: 85, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0556] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC of SEQ ID NO: 84 and a LC which is at least 80% (e.g. at least 85%, at least 90%, at least 95% or at least 99%) identical to the LC of SEQ ID NO: 85, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0557] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 95% identical to the HC of SEQ ID NO: 84 and a LC which is at least 95% identical to the LC of SEQ ID NO: 85, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0558] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 95% identical to the HC of SEQ ID NO: 84 and a LC which is at least 99% identical to the LC of SEQ ID NO: 85, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0559] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 99% identical to the HC of SEQ ID NO: 84 and a LC which is at least 99% identical to the LC of SEQ ID NO: 85, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0560] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 99% identical to the HC of SEQ ID NO: 84 and a LC which is at least 95% identical to the LC of SEQ ID NO: 85, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the following L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0561] In some embodiment, the disclosure also provides an isolated antibody or antigen binding fragment thereof comprising an amino acid sequence at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the amino acid sequence of SEQ ID NO: 86 and wherein the antibody or antigen binding fragment thereof binds PSMA, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0562] In some embodiments, the disclosure also provides an isolated antibody or antigen binding fragment thereof comprising an amino acid sequence at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the amino acid sequence of SEQ ID NO: 85; and wherein the antibody or antigen binding fragment thereof binds PSMA, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0563] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 86 and a LC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 85, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0564] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 80% (e.g. at least 85%, at least 90%, at least 95% or at least 99%) identical to the HC of SEQ ID NO: 86 and a LC of SEQ ID NO: 85, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0565] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC of SEQ ID NO: 86 and a LC which is at least 80% (e.g. at least 85%, at least 90%, at least 95% or at least 99%) identical to the LC of SEQ ID NO: 85, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0566] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 95% identical to the HC of SEQ ID NO: 86 and a LC which is at least 95% identical to the LC of SEQ ID NO: 85, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0567] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 95% identical to the HC of SEQ ID NO: 86 and a LC which is at least 99% identical to the LC of SEQ ID NO: 85, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0568] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 99% identical to the HC of SEQ ID NO: 86 and a LC which is at least 99% identical to the LC of SEQ ID NO: 85, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0569] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 99% identical to the HC of SEQ ID NO: 86 and a LC which is at least 95% identical to the LC of SEQ ID NO: 85, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the following L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0570] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 88 and a LC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 89, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0571] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 80% (e.g. at least 85%, at least 90%, at least 95% or at least 99%) identical to the HC of SEQ ID NO: 88 and a LC of SEQ ID NO: 89, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0572] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC of SEQ ID NO: 88 and a LC which is at least 80% (e.g. at least 85%, at least 90%, at least 95% or at least 99%) identical to the LC of SEQ ID NO: 89, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0573] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 95% identical to the HC of SEQ ID NO: 88 and a LC which is at least 95% identical to the LC of SEQ ID NO: 89, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0574] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 95% identical to the HC of SEQ ID NO: 88 and a LC which is at least 99% identical to the LC of SEQ ID NO: 89, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0575] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 99% identical to the HC of SEQ ID NO: 88 and a LC which is at least 99% identical to the LC of SEQ ID NO: 89, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0576] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC which is at least 99% identical to the HC of SEQ ID NO: 86 and a LC which is at least 95% identical to the LC of SEQ ID NO: 85, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the following L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0577] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 84 and a LC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 4, 5, 6, 7, 8, and 9, respectively, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0578] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 84 and a LC which is at least 100% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 4, 5, 6, 7, 8, and 9, respectively, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0579] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 100% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 84 and a LC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 4, 5, 6, 7, 8, and 9, respectively, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0580] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 95% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 84 and a LC which is at least 95% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 4, 5, 6, 7, 8, and 9, respectively, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0581] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 95% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 84 and a LC which is at least 99% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 4, 5, 6, 7, 8, and 9, respectively, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0582] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 99% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 84 and a LC which is at least 99% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 4, 5, 6, 7, 8, and 9, respectively, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0583] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 99% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 84 and a LC which is at least 95% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 4, 5, 6, 7, 8, and 9, respectively, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0584] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 86 and a LC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 4, 5, 6, 7, 8, and 9, respectively, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0585] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 86 and a LC which is at least 100% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 4, 5, 6, 7, 8, and 9, respectively, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0586] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 100% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 86 and a LC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 4, 5, 6, 7, 8, and 9, respectively, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0587] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 95% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 86 and a LC which is at least 95% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 4, 5, 6, 7, 8, and 9, respectively, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0588] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 95% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 86 and a LC which is at least 99% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 4, 5, 6, 7, 8, and 9, respectively, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0589] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 99% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 86 and a LC which is at least 99% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 4, 5, 6, 7, 8, and 9, respectively, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0590] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 99% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 86 and a LC which is at least 95% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 4, 5, 6, 7, 8, and 9, respectively, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0591] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 88 and a LC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 89, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 10, 11, 12, 13, 14, and 15, respectively, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0592] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 88 and a LC which is at least 100% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 89, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 10, 11, 12, 13, 14, and 15, respectively, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0593] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 100% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 88 and a LC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 89, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 10, 11, 12, 13, 14, and 15, respectively, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0594] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 95% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 88 and a LC which is at least 95% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 89, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 10, 11, 12, 13, 14, and 15, respectively, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0595] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 95% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 88 and a LC which is at least 99% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 89, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 10, 11, 12, 13, 14, and 15, respectively, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0596] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 99% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 88 and a LC which is at least 99% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 89, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 10, 11, 12, 13, 14, and 15, respectively, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0597] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 99% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 88 and a LC which is at least 95% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 89, wherein the antibody or antigen binding fragment comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 10, 11, 12, 13, 14, and 15, respectively, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0598] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 84 and a LC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a VH of SEQ ID NO: 52 and a VL of SEQ ID NO: 53, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0599] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 84 and a LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a VH of SEQ ID NO: 52 and a VL of SEQ ID NO: 53, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0600] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC of SEQ ID NO: 84 and a LC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a VH of SEQ ID NO: 52 and a VL of SEQ ID NO: 53, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0601] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 95% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 84 and a LC which is at least 95% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a VH of SEQ ID NO: 52 and a VL of SEQ ID NO: 53, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0602] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 95% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 84 and a LC which is at least 99% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a VH of SEQ ID NO: 52 and a VL of SEQ ID NO: 53, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0603] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 99% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 84 and a LC which is at least 99% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a VH of SEQ ID NO: 52 and a VL of SEQ ID NO: 53, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0604] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 99% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 84 and a LC which is at least 95% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a VH of SEQ ID NO: 52 and a VL of SEQ ID NO: 53, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0605] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 86 and a LC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a VH of SEQ ID NO: 52 and a VL of SEQ ID NO: 53, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0606] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 86 and a LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a VH of SEQ ID NO: 52 and a VL of SEQ ID NO: 53, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0607] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC of SEQ ID NO: 86 and a LC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a VH of SEQ ID NO: 52 and a VL of SEQ ID NO: 53, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0608] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 95% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 86 and a LC which is at least 95% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a VH of SEQ ID NO: 52 and a VL of SEQ ID NO: 53, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0609] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 95% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 86 and a LC which is at least 99% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a VH of SEQ ID NO: 52 and a VL of SEQ ID NO: 53, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0610] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 99% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 86 and a LC which is at least 99% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a VH of SEQ ID NO: 52 and a VL of SEQ ID NO: 53, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0611] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 99% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 86 and a LC which is at least 95% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a VH of SEQ ID NO: 52 and a VL of SEQ ID NO: 53, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0612] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 86 and a LC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a VH of SEQ ID NO: 52 and a VL of SEQ ID NO: 53, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0613] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 86 and a LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a VH of SEQ ID NO: 52 and a VL of SEQ ID NO: 53, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0614] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC of SEQ ID NO: 86 and a LC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a VH of SEQ ID NO: 52 and a VL of SEQ ID NO: 53, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0615] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 95% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 86 and a LC which is at least 95% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a VH of SEQ ID NO: 52 and a VL of SEQ ID NO: 53, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0616] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 95% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 86 and a LC which is at least 99% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a VH of SEQ ID NO: 52 and a VL of SEQ ID NO: 53, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0617] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 99% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 86 and a LC which is at least 99% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a VH of SEQ ID NO: 52 and a VL of SEQ ID NO: 53, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0618] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 99% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 86 and a LC which is at least 95% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 85, wherein the antibody or antigen binding fragment comprises a VH of SEQ ID NO: 52 and a VL of SEQ ID NO: 53, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0619] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 88 and a LC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 89, wherein the antibody or antigen binding fragment comprises a VH of SEQ ID NO: 54 and a VL of SEQ ID NO: 55, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0620] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 88 and a LC of SEQ ID NO: 89, wherein the antibody or antigen binding fragment comprises a VH of SEQ ID NO: 54 and a VL of SEQ ID NO: 55, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0621] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA comprises a HC of SEQ ID NO: 88 and a LC which is at least 80% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 89, wherein the antibody or antigen binding fragment comprises a VH of SEQ ID NO: 54 and a VL of SEQ ID NO: 55, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0622] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 95% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 88 and a LC which is at least 95% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 89, wherein the antibody or antigen binding fragment comprises a VH of SEQ ID NO: 54 and a VL of SEQ ID NO: 55, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0623] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 95% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 85 and a LC which is at least 99% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 89, wherein the antibody or antigen binding fragment comprises a VH of SEQ ID NO: 54 and a VL of SEQ ID NO: 55, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0624] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 99% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 88 and a LC which is at least 99% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 89, wherein the antibody or antigen binding fragment comprises a VH of SEQ ID NO: 54 and a VL of SEQ ID NO: 55, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    [0625] The disclosure also provides an isolated antibody or antigen binding fragment thereof comprising a HC which is at least 99% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the HC of SEQ ID NO: 88 and a LC which is at least 95% (e.g. at least 85%, at least 90%, at least 95%, at least 99% or 100%) identical to the LC of SEQ ID NO: 89, wherein the antibody or antigen binding fragment comprises a VH of SEQ ID NO: 54 and a VL of SEQ ID NO: 55, and wherein the antibody or antigen binding fragment is IgG1 (e.g. IgG1λ), optionally wherein the first Ig constant region or the fragment of the first Ig constant region and/or the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations, such as wherein the first Ig constant region or the fragment of the first Ig constant region and the second Ig constant region or the fragment of the second Ig constant region comprise the L234A_L235A_D265S and/or the M252Y/S254T/T256E mutations.

    Polynucleotides

    [0626] Polynucleotides encoding the anti-PSMA antibody or antigen binding fragment of the disclosure and their functional equivalents are also provided. The disclosure provides an isolated polynucleotide encoding any of the anti-PSMA antibody or antigen binding fragment thereof of the disclosure.

    [0627] In some embodiment, the disclosure provides an isolated polynucleotide encoding the VH of SEQ ID NO: 52.

    [0628] In some embodiment, the disclosure provides an isolated polynucleotide encoding the VH of SEQ ID NO: 54.

    [0629] In some embodiment, the disclosure provides an isolated polynucleotide encoding the VH of SEQ ID NO: 56.

    [0630] In some embodiment, the disclosure provides an isolated polynucleotide encoding the VH of SEQ ID NO: 58.

    [0631] In some embodiment, the disclosure provides an isolated polynucleotide encoding the VH of SEQ ID NO: 60.

    [0632] In some embodiment, the disclosure provides an isolated polynucleotide encoding the VH of SEQ ID NO: 62.

    [0633] In some embodiment, the disclosure provides an isolated polynucleotide encoding the VH of SEQ ID NO: 64.

    [0634] In some embodiment, the disclosure provides an isolated polynucleotide encoding the VH of SEQ ID NO: 66.

    [0635] In some embodiment, the disclosure provides an isolated polynucleotide encoding the VH of SEQ ID NO: 278.

    [0636] In some embodiment, the disclosure provides an isolated polynucleotide encoding the VL of SEQ ID NO: 53.

    [0637] In some embodiment, the disclosure provides an isolated polynucleotide encoding the VL of SEQ ID NO: 55.

    [0638] In some embodiment, the disclosure provides an isolated polynucleotide encoding the VL of SEQ ID NO: 57.

    [0639] In some embodiment, the disclosure provides an isolated polynucleotide encoding the VL of SEQ ID NO: 59.

    [0640] In some embodiment, the disclosure provides an isolated polynucleotide encoding the VL of SEQ ID NO: 61.

    [0641] In some embodiment, the disclosure provides an isolated polynucleotide encoding the VL of SEQ ID NO: 63.

    [0642] In some embodiment, the disclosure provides an isolated polynucleotide encoding the VL of SEQ ID NO: 65.

    [0643] In some embodiment, the disclosure provides an isolated polynucleotide encoding the VL of SEQ ID NO: 67.

    [0644] In some embodiment, the disclosure provides an isolated polynucleotide encoding the VL of SEQ ID NO: 279.

    [0645] In some embodiment, the disclosure provides an isolated polynucleotide encoding the heavy chain of SEQ ID NO: 84.

    [0646] In some embodiment, the disclosure provides an isolated polynucleotide encoding the heavy chain of SEQ ID NO: 86.

    [0647] In some embodiment, the disclosure provides an isolated polynucleotide encoding the heavy chain of SEQ ID NO: 88.

    [0648] In some embodiment, the disclosure provides an isolated polynucleotide encoding the heavy chain of SEQ ID NO: 90.

    [0649] In some embodiment, the disclosure provides an isolated polynucleotide encoding the heavy chain of SEQ ID NO: 92.

    [0650] In some embodiment, the disclosure provides an isolated polynucleotide encoding the heavy chain of SEQ ID NO: 94.

    [0651] In some embodiment, the disclosure provides an isolated polynucleotide encoding the heavy chain of SEQ ID NO: 96.

    [0652] In some embodiment, the disclosure provides an isolated polynucleotide encoding the heavy chain of SEQ ID NO: 98.

    [0653] In some embodiment, the disclosure provides an isolated polynucleotide encoding the heavy chain of SEQ ID NO: 100.

    [0654] In some embodiment, the disclosure provides an isolated polynucleotide encoding the heavy chain of SEQ ID NO: 102.

    [0655] In some embodiment, the disclosure provides an isolated polynucleotide encoding the heavy chain of SEQ ID NO: 268.

    [0656] In some embodiment, the disclosure provides an isolated polynucleotide encoding the heavy chain of SEQ ID NO: 282.

    [0657] In some embodiment, the disclosure provides an isolated polynucleotide encoding the heavy chain of SEQ ID NO: 284.

    [0658] In some embodiment, the disclosure provides an isolated polynucleotide encoding the heavy chain of SEQ ID NO: 288.

    [0659] In some embodiment, the disclosure provides an isolated polynucleotide encoding the light chain of SEQ ID NO: 85.

    [0660] In some embodiment, the disclosure provides an isolated polynucleotide encoding the light chain of SEQ ID NO: 89.

    [0661] In some embodiment, the disclosure provides an isolated polynucleotide encoding the light chain of SEQ ID NO: 93.

    [0662] In some embodiment, the disclosure provides an isolated polynucleotide encoding the light chain of SEQ ID NO: 95.

    [0663] In some embodiment, the disclosure provides an isolated polynucleotide encoding the light chain of SEQ ID NO: 97.

    [0664] In some embodiment, the disclosure provides an isolated polynucleotide encoding the light chain of SEQ ID NO: 99.

    [0665] In some embodiment, the disclosure provides an isolated polynucleotide encoding the light chain of SEQ ID NO: 101.

    [0666] In some embodiment, the disclosure provides an isolated polynucleotide encoding the light chain of SEQ ID NO: 103.

    [0667] In some embodiment, the disclosure provides an isolated polynucleotide encoding the light chain of SEQ ID NO: 269.

    [0668] In some embodiments, the disclosure provides isolated polynucleotide sequences encoding polypeptide sequences of SEQ ID NOs: 52 and 53.

    [0669] In some embodiments, the disclosure provides isolated polynucleotide sequences encoding polypeptide sequences of SEQ ID NOs: 84 and 85.

    [0670] In some embodiments, the disclosure provides isolated polynucleotide sequences encoding polypeptide sequences of SEQ ID NOs: 86 and 85.

    [0671] In some embodiments, the disclosure provides isolated polynucleotide sequences encoding polypeptide sequences of SEQ ID NOs: 54 and 55.

    [0672] In some embodiments, the disclosure provides isolated polynucleotide sequences encoding polypeptide sequences of SEQ ID NOs: 88 and 89.

    [0673] In some embodiments, the disclosure provides isolated polynucleotide sequences encoding polypeptide sequences of SEQ ID NOs: 52, 53, 278 and 279.

    [0674] In some embodiments, the disclosure provides isolated polynucleotide sequences encoding polypeptide sequences of SEQ ID NOs: 268, 269 and 282.

    [0675] In some embodiments, the disclosure provides isolated polynucleotide sequences encoding polypeptide sequences of SEQ ID NOs: 284, 269 and 288.

    [0676] In some embodiments, the disclosure provides an isolated polynucleotide of SEQ ID NO: 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 104, 105, 106, 108, 109, 110, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 134, 135, 270, 271, 280, 281, 283, 286 or 289.

    [0677] Polynucleotides encoding the anti-PSMA antibody or antigen binding fragment of the disclosure include polynucleotides with nucleic acid sequences that are substantially the same as the nucleic acid sequences of the polynucleotide of the disclosure. “Substantially the same” nucleic acid sequence is defined herein as a sequence with at least 80% identity to another nucleic acid sequence when the two sequences are aligned. Two nucleic acid sequences are substantially identical if the polypeptide encoded by the first nucleic acid is immunologically cross reactive with the polypeptide encoded by the second nucleic acid. Another indication that two nucleic acid sequences are substantially identical is that the two molecules hybridize to each other under stringent conditions.

    [0678] Modified nucleotides may be used to generate the polynucleotides of the disclosure. Exemplary modified nucleotides are 5-fluorouracil, 5-bromouracil, 5-chlorouracil, 5-iodouracil, hypoxanthine, xanthine, 4-acetylcytosine, 5-(carboxyhydroxymethyl) uracil, carboxymethylaminomethyl-2-thiouridine, 5-carboxymethylaminomethyluracil, dihydrouracil, N.sup.6-substituted adenine, 7-methylguanine, 5-methylaminomethyluracil, 5-methoxyaminomethyl-2-thiouracil, beta-D-mannosylqueosine, 5″-methoxycarboxymethyluracil, 5-methoxyuracil, 2-methylthio-N.sup.6-isopentenyladenine, uracil-5-oxyacetic acid (v), wybutoxosine, pseudouracil, queuosine, beta-D-galactosylqueosine, inosine, N.sup.6-isopentenyladenine, 1-methylguanine, 1-methylinosine, 2,2-dimethylguanine, 2-methyladenine, 2-methylguanine, 3-methylcytosine, 5-methylcytosine, 2-thiocytosine, 5-methyl-2-thiouracil, 2-thiouracil, 4-thiouracil, 5-methyluracil, uracil-5-oxyacetic acid methylester, 3-(3-amino-3-N-2-carboxypropyl) uracil, and 2,6-diaminopurine.

    Vectors Comprising Polynucleotides Encoding for the Anti-PSMA Antibodies

    [0679] Vectors comprising DNA encoding the anti-PSMA antibody or antigen binding fragment of the disclosure are also provided. The disclosed vectors can be used, for example, to generate any of the above disclosed anti-PSMA antibody, or antigen binding fragment thereof. Polynucleotides encoding any of the anti-PSMA antibody or antigen binding fragment thereof of the disclosure may be incorporated into vectors using standard molecular biology methods.

    [0680] In some embodiments, the disclosure provides an expression vector comprising the polynucleotide of the invention. Such vectors may be plasmid vectors, viral vectors, vectors for baculovirus expression, transposon-based vectors or any other vector suitable for introduction of the synthetic polynucleotide of the invention into a given organism or genetic background by any means. The vector of the disclosure may be an expression vector for the efficient synthesis of PSMA antibody polypeptide and expression of the PSMA antibody polypeptide of the disclosure in prokaryotic and eukaryotic systems, including but not limited to yeast and mammalian cell culture.

    [0681] Exemplary vectors that may be used are Bacterial: pBs, phagescript, PsiX174, pBluescript SK, pBs KS, pNH8a, pNH16a, pNH18a, pNH46a (Stratagene, La Jolla, Calif., USA); pTrc99A, pKK223-3, pKK233-3, pDR540, and pRIT5 (Pharmacia, Uppsala, Sweden). Eukaryotic: pWLneo, pSV2cat, pOG44, PXR1, pSG (Stratagene) pSVK3, pBPV, pMSG and pSVL (Pharmacia), pEE6.4 (Lonza) and pEE12.4 (Lonza). Additional vectors include the pUC series (Fermentas Life Sciences, Glen Burnie, Md.), the pBluescript series (Stratagene, LaJolla, Calif.), the pET series (Novagen, Madison, Wis.), the pGEX series (Pharmacia Biotech, Uppsala, Sweden), and the pEX series (Clontech, Palo Alto, Calif.). Bacteriophage vectors, such as λGT10, λGT11, λEMBL4, and λNM1149, λZapII (Stratagene) can be used. Exemplary plant expression vectors include pBI01, pBI0.2, pBI121, pBI101.3, and pBIN19 (Clontech). Exemplary animal expression vectors include pEUK-Cl, pMAM, and pMAMneo (Clontech). The expression vector may be a viral vector, e.g., a retroviral vector, e.g., a gamma retroviral vector.

    [0682] The vector of the disclosure may contain a promoter and an enhancer sequence. Polynucleotides encoding the PSMA binding proteins of the disclosure may be operably linked to control sequences in the expression vector(s) that ensure the expression of the PSMA binding proteins. Such regulatory elements may include a transcriptional promoter, sequences encoding suitable mRNA ribosomal binding sites, and sequences that control the termination of transcription and translation. Expression vectors may also include one or more non-transcribed elements such as an origin of replication, a suitable promoter and enhancer linked to the gene to be expressed, other 5′ or 3′ flanking nontranscribed sequences, 5′ or 3′ nontranslated sequences (such as necessary ribosome binding sites), a polyadenylation site, splice donor and acceptor sites, or transcriptional termination sequences. An origin of replication that confers the ability to replicate in a host may also be incorporated.

    [0683] Vectors of the disclosure may also contain one or more Internal Ribosome Entry Site(s) (IRES). Inclusion of an IRES sequence into fusion vectors may be beneficial for enhancing expression of some proteins. In some embodiments, the vector system will include one or more polyadenylation sites (e.g., SV40), which may be upstream or downstream of any of the aforementioned nucleic acid sequences. Vector components may be contiguously linked or arranged in a manner that provides optimal spacing for expressing the gene products (i.e., by the introduction of “spacer” nucleotides between the ORFs) or positioned in another way. Regulatory elements, such as the IRES motif, may also be arranged to provide optimal spacing for expression.

    [0684] Vectors of the disclosure may be circular or linear. They may be prepared to contain a replication system functional in a prokaryotic or eukaryotic host cell. Replication systems can be derived, e.g., from ColE1, SV40, 2μ plasmid, λ, bovine papilloma virus, and the like.

    [0685] The recombinant expression vectors can be designed for either transient expression, for stable expression, or for both. Also, the recombinant expression vectors can be made for constitutive expression or for inducible expression.

    [0686] The vectors may also comprise selection markers, which are well known in the art. Selection markers include positive and negative selection marker. Marker genes include biocide resistance, e.g., resistance to antibiotics, heavy metals, etc., complementation in an auxotrophic host to provide prototrophy, and the like. Exemplary marker genes include antibiotic resistance genes (e.g., neomycin resistance gene, a hygromycin resistance gene, a kanamycin resistance gene, a tetracycline resistance gene, a penicillin resistance gene, histidinol resistance gene, histidinol x resistance gene), glutamine synthase genes, HSV-TK, HSV-TK derivatives for ganciclovir selection, or bacterial purine nucleoside phosphorylase gene for 6-methylpurine selection (Gadi et al., 7 Gene Ther. 1738-1743 (2000)). A nucleic acid sequence encoding a selection marker or the cloning site may be upstream or downstream of a nucleic acid sequence encoding a polypeptide of interest or cloning site.

    Host Cells

    [0687] The disclosure also provides for a host cell comprising any of the vectors of the disclosure. “Host cell” refers to a cell into which a vector has been introduced. It is understood that the term host cell is intended to refer not only to the particular subject cell but to the progeny of such a cell, and also to a stable cell line generated from the particular subject cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not be identical to the parent cell but are still included within the scope of the term “host cell” as used herein. Such host cells may be eukaryotic cells, prokaryotic cells, plant cells or archeal cells. Escherichia coli, bacilli, such as Bacillus subtilis, and other enterobacteriaceae, such as Salmonella, Serratia, and various Pseudomonas species are examples of prokaryotic host cells. Other microbes, such as yeast, are also useful for expression. Saccharomyces (e.g., S. cerevisiae) and Pichia are examples of suitable yeast host cells. Exemplary eukaryotic cells may be of mammalian, insect, avian or other animal origins. Mammalian eukaryotic cells include immortalized cell lines such as hybridomas or myeloma cell lines such as SP2/0 (American Type Culture Collection (ATCC), Manassas, Va., CRL-1581), NS0 (European Collection of Cell Cultures (ECACC), Salisbury, Wiltshire, UK, ECACC No. 85110503), FO (ATCC CRL-1646) and Ag653 (ATCC CRL-1580) murine cell lines. An exemplary human myeloma cell line is U266 (ATTC CRL-TIB-196). Other useful cell lines include those derived from Chinese Hamster Ovary (CHO) cells such as CHO-K1SV (Lonza Biologics, Walkersville, Md.), CHO-K1 (ATCC CRL-61) or DG44.

    [0688] The disclosure provides recombinant host cells containing any of the expression vectors of the disclosure. Nucleic acids encoding any of the PSMA binding proteins or fragments thereof can be used for transformation of a suitable mammalian host cell. Host cell transformation, culture, antibody expression and purification are done using well known methods.

    [0689] Cell lines may be selected based on high level of expression of the PSMA antibody of interest and minimal contamination from host cell proteins. Mammalian cell lines available as host cells for expression are well known in the art and include, but are not limited to from Chinese Hamster Ovary (CHO) cells such as CHO-K1SV (Lonza Biologics, Walkersville, Md.), CHO-K1 (ATCC CRL-61), or CHO DG44, and Baby Hamster Kidney (BHK) cells. These cell lines can be used to produce any of the anti-PSMA antibody or antibody fragment of the disclosure by culturing the cells under conditions suitable for expression of the antibody and purifying the antibody from the host cell or medium surrounding the host cell.

    [0690] The disclosure also provides a method of producing the anti-PSMA binding protein of the disclosure comprising culturing the host cell of the disclosure in conditions that the anti-PSMA binding protein is expressed, and recovering the anti-PSMA antibody binding protein produced by the host cell using well known methods in the art. A subject protein may be substantially pure, e.g., at least about 80% to 85% pure, at least about 85% to 90% pure, at least about 90% to 95% pure, or at least about 98% to 99%, or more, pure, e.g., free from contaminants such as cell debris, macromolecules, etc. other than the subject protein.

    Radioconjugates and Antibody Drug Conjugates

    [0691] The disclosure also provides antibody drug conjugates (ADCs) and radioconjugates comprising the anti-PSMA antibodies of the disclosure. In certain embodiments, the antibodies or antigen binding fragment thereof of the disclosure may be conjugated with pharmaceutically active moieties or diagnostic moieties to form an “antibody drug conjugate” (ADC), or a “radioconjugate”. The ADCs or radioconjugates of the disclosure may be used to deliver cytotoxins or other payloads to the target location.

    [0692] As used herein, the term “antibody drug conjugate” is used broadly and refers to an antibody, or antigen binding fragments thereof, conjugated to (e.g., covalently associated) a second molecule such as any pharmaceutically active moiety, a therapeutic moiety, a toxin, or a drug.

    [0693] As used herein, the term “targeting ligand” refers to any molecule that provides an enhanced affinity for a selected target, e.g., an antigen, a cell, cell type, tissue, organ, region of the body, or a compartment (e.g., a cellular, tissue or organ compartment). Targeting ligands include, but are not limited to, antibodies or antigen binding fragments thereof, aptamers, polypeptides, and scaffold proteins. In some embodiments, a targeting ligand is a polypeptide. In some embodiments, the targeting ligand is an antibody or antigen binding fragment thereof, engineered domain, or scaffold protein. The targeting ligand may serve as a shuttle to deliver a payload to a specific site, which is defined by the target recognized by said targeting ligand. A targeting ligand, for instance, targeting a receptor, delivers its payload to a site which is characterized by abundance of said receptor. In the present disclosure, the targeting ligand is an anti-PSMA antibody or fragment thereof conjugated to pharmaceutical active moiety and capable of delivering a payload to a site which is characterized by the abundance of PSMA.

    [0694] The term “payload”, as used herein, represents any naturally occurring or synthetically generated molecule, including small-molecular weight molecules or chemical entities that can chemically be synthesized, and larger molecules or biological entities that need to be produced by fermentation of host cells and that confer a novel functionality to a targeting ligand specific for binding to targets or antigens. Examples of payload include but are not limited to drugs, toxins, cytokines, markers, oligonucleotides, antisense, small interfering RNAs oligonucleotides (siRNAs), or the like, for the generation of site-specifically conjugated antibody drug conjugates (ADCs). The payload may also be a radiometal complex or a radio metal ion as described below.

    [0695] As used herein the terms “drug” or “warhead” may be used interchangeably and will mean a biologically active or detectable molecule or compound, including anti-cancer agents as described below. A “payload” may comprise a drug or warhead in combination with an optional linker compound. The warhead on the conjugate may comprise peptides, proteins, prodrugs which are metabolized to an active agent in vivo, polymers, nucleic acid molecules, small molecules, binding agents, mimetic agents, synthetic drugs, inorganic molecules, organic molecules and radioisotopes. In some embodiments, the disclosed ADCs or radioconjugates will direct the bound payload to the target site in a relatively unreactive, non-toxic state before releasing and activating the payload. This targeted release of the payload is preferably achieved through stable conjugation of the payloads via residue-specific or site-specific conjugation as describe below, and the relatively homogeneous composition of the ADC or radioconjugate preparations which minimize over-conjugated toxic species.

    [0696] In some embodiments the disclosure comprises payloads of therapeutic moieties (e.g., cytotoxins), or other payloads such as diagnostic agents. The selected payload may be covalently or non-covalently linked to the antibody and exhibit various stoichiometric molar ratios depending, at least in part, on the method used to affect the conjugation.

    [0697] The conjugates of the disclosure may be represented by the formula: Ab-[L-D]n or a pharmaceutically acceptable salt thereof wherein

    [0698] a) Ab comprises an anti-PSMA antibody or antigen binding fragment thereof disclosed herein;

    [0699] b) L comprises an optional linker;

    [0700] c) D comprises a drug moiety or chelator; and

    [0701] d) n is an integer from about 1 to about 20.

    [0702] Those of skill in the art will appreciate that conjugates according to the aforementioned formula may be fabricated using a number of different linkers and drugs and that conjugation methodology will vary depending on the selection of components.

    Linker

    [0703] In some embodiments, the (ADCs) and radioconjugates of the disclosure comprise a linker that links the anti-PSMA antibodies and antigen binding fragment thereof of the disclosure to a drug moiety or a chelator.

    [0704] As used herein, the term “linker” refers to a chemical moiety that joins a compound (such as a chelator or a drug) to a nucleophilic moiety, electrophilic moiety, targeting ligand or an antibody or antigen binding domain thereof. Any suitable linker known to those skilled in the art in view of the present disclosure can be used to conjugate the antibodies of the disclosure to the relevant drug or chelator. Preferably, linkers will covalently bind with a reactive residue of the antibody. Accordingly, any linker that reacts with a selected antibody residue and may be used to provide the relatively stable conjugates (site-specific or otherwise) of the instant disclosure is compatible with the teachings herein. Ideally, linkers are designed to largely release the drug once it has been delivered to the tumor site, substantially reducing undesirable non-specific toxicity by minimizing exposure of non-targeted cells and tissue to the cytotoxic drug, thereby providing an enhanced therapeutic index.

    [0705] The linkers can contain, for example, a substituted or unsubstituted alkyl, a substituted or unsubstituted heteroalkyl moiety, a substituted or unsubstituted aryl or heteroaryl, a polyethylene glycol (PEG) linker, a peptide linker, a sugar-based linker, or a cleavable linker, such as a disulfide linkage or a protease cleavage site such as valine-citrulline-p-aminobenzyloxycarbonyl (PAB). The linker may be composed of one or more linker components. Exemplary linker components include 6-maleimidocaproyl (“MC”), maleimidopropanoyl (“MP”), valine-citrulline (“val-cit”), alanine-phenylalanine (“alaphe”), p-aminobenzyloxycarbonyl (“PAB”), N-Succinimidyl 4-(2-pyridylthio) pentanoate (“SPP”), N-Succinimidyl 4-(N-maleimidomethyl) cyclohexane-1 carboxylate (“SMCC”), and N-Succinimidyl (4-iodo-acetyl) aminobenzoate (“SIAB”).

    [0706] In some embodiments, the linker is valine-citrulline-p-aminobenzyloxycarbonyl (“vc-PAB”). In some embodiments, the linker may comprise amino acid residues. Exemplary amino acid linker components include a dipeptide, a tripeptide, a tetrapeptide or a pentapeptide. Exemplary dipeptides include: valine-citrulline (vc or val-cit), alanine-phenylalanine (af or ala-phe). Exemplary tripeptides include: glycine-valine-citrulline (gly-val-cit) and glycine-glycine-glycine (gly-gly-gly). Amino acid residues which comprise an amino acid linker component include those occurring naturally, as well as minor amino acids and non-naturally occurring amino acid analogs, such as citrulline. Amino acid linker components can be designed and optimized in their selectivity for enzymatic cleavage by particular enzymes, for example, a tumor-associated protease, cathepsin B, C and D, or a plasmin protease.

    [0707] Exemplary linker structures suitable for use in the disclosure also include, but are not limited to:

    ##STR00005##

    and wherein m is an integer of 0 to 12.

    [0708] In preferred embodiments compatible linkers will confer stability on the ADCs or radioconjugate in the extracellular environment, prevent aggregation of the ADC molecules or radioconjugate and keep the ADC and radioconjugate freely soluble in aqueous media and in a monomeric state. Before transport or delivery into a cell, the ADC or radioconjugate is preferably stable and remains intact, i.e. the antibody remains linked to the drug moiety. While the linkers are stable outside the target cell they are designed to be cleaved or degraded at some efficacious rate inside the cell. Accordingly, an effective linker will: (i) maintain the specific binding properties of the antibody; (ii) allow intracellular delivery of the conjugate or drug moiety; (iii) remain stable and intact, i.e. not cleaved or degraded, until the conjugate has been delivered or transported to its targeted site; and (iv) maintain a cytotoxic, cell-killing effect or a cytostatic effect of the drug moiety.

    [0709] The stability of the ADC or radioconjugate may be measured by standard analytical techniques such as mass spectroscopy, hydrophobic interaction chromatography (HIC), HPLC, and the separation/analysis technique LC/MS.

    Cytotoxic Agents and Drugs

    [0710] In some embodiments, the anti-PSMA antibody or antigen binding fragment thereof of the disclosure is conjugated to one or more therapeutic moiety or a drug such as an anti-cancer agent including, but not limited to, cytotoxic agents, cytostatic agents, anti-angiogenic agents, debulking agents, chemotherapeutic agents, radiotherapeutic agents, targeted anti-cancer agents, biological response modifiers, cancer vaccines, cytokines, hormone therapies, oligonucleotides, antisense, siRNAs, anti-metastatic agents and immunotherapeutic agents.

    [0711] In some embodiments, the anti-PSMA antibody or antigen binding fragment thereof of the disclosure is conjugated to one or more cytotoxic agents. Exemplary cytotoxic agents include chemotherapeutic agents or drugs, growth inhibitory agents, toxins (e.g., protein toxins, enzymatically active toxins of bacterial, fungal, plant, or animal origin, or fragments thereof), and radioactive isotopes. Exemplary toxins include, but are not limited to, bacterial toxins such as diphtheria toxin, plant toxins such as ricin, small molecule toxins such as geldanamycin (Mandler et al (2000) Jour, of the Nat. Cancer Inst. 92(19): 1573-1581; Mandler et al (2000) Bioorganic & Med. Chem. Letters 10:1025-1028; Mandler et al (2002) Bioconjugate Chem. 13:786-791), maytansinoids (EP 1391213; Liu et al., (1996) Proc. Natl. Acad. Sci. USA 93:8618-8623), and calicheamicin (Lode et al (1998) Cancer Res. 58:2928; Hinman et al (1993) Cancer Res. 53:3336-3342). The toxins may achieve their cytotoxic and cytostatic effects by mechanisms including tubulin binding, DNA binding, or topoisomerase inhibition. Some cytotoxic drugs tend to be inactive or less active. Enzymatically active toxins and fragments thereof that can be used include diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa}, ricin A chain, abrin A chain, modeccinAchain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAPII, and PAP-S), Momordica charantia inhibitor, curcin, crotin, Sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin, and the tricothecenes.

    [0712] In some embodiments, the anti-PSMA antibody or antigen binding fragment thereof provided herein is conjugated to one or more drugs. Exemplary drugs include a maytansinoid (see, e.g., U.S. Pat. Nos. 5,208,020, 5,416,06); an auristatin such as monomethyl auristatin drug moieties DE and DF (MMAE and MMAF) (see, e.g., U.S. Pat. Nos. 5,635,483 and 5,780,588, and 7,498,298), a dolastatin, a calicheamicin or derivative thereof (see, e.g., U.S. Pat. Nos. 5,712,374, 5,714,586, 5,739, 116, 5,767,285, 5,770,701, 5,770,710, 5,773,001, and 5,877,296; Himnan et al., (1993) Cancer Res 53:3336-3342; and Lode et al., (1998) Cancer Res 58:2925-2928); an anthracycline such as daunomycin or doxorubicin (see, e.g., Kratz et al., (2006) Current Med. Chem 13:477-523; Jeffrey et al., (2006) Bioorganic & Med Chem Letters 16:358-362; Torgov et al., (2005) Bioconj Chem 16:717-721; Nagy et al., (2000) Proc Natl Acad Sci USA 97:829-834; Dubowchik et al, Bioorg. & Med. Chem. Letters 12: 1529-1532 (2002); King et al., (2002) J Med Chem 45:4336-4343; and U.S. Pat. No. 6,630,579), methotrexate, vindesine, a taxane such as docetaxel, paclitaxel, larotaxel, tesetaxel, and ortataxel, a camptothecin (CPT) analogue such as topotecan and irinotecan (see, e.g., Slichenmyer et al, (1994) Cancer Chemother Pharmacol, 34 (Suppl): S 53-S 570), a pyrrolobenzodiazepine (PBD) derivative (U.S. Pat. No. 10,639,373), an amatoxin derivative such as, α-amanitin and β-amanitin, or a duocarmycin analogs.

    Radiometal Ion

    [0713] In some embodiments, the anti-PSMA antibodies or antigen binding fragments thereof of the disclosure is conjugated to a radiometal ion to form radioconjugates.

    [0714] A “radioconjugate” (also referred to herein as a “radioimmunoconjugate” or “immunoconjugate”) is an immunoconjugate in which an antibody or antigen binding fragment thereof is labeled with a radiometal or conjugated to a radiometal complex. A “radioconjugate” in particular, refers to an antibody or an antigen binding domain, that is conjugated (joined, e.g., bound via a covalent bond) to at least one radiometal complex. Stated another way, a radioconjugate refers to at least one radiometal complex joined, e.g., bound via a covalent bond, to an antibody or antigen binding domain. A radioconjugate may comprise at least one radiometal complex that comprises a linker, wherein the radiometal complex is joined to the antibody or antigen binding domain via the linker. A “radiometal complex” as used herein refers to a complex comprising a radiometal ion associated with a chelator. Typically, a radiometal ion is bound to or coordinated to a chelator via coordinate bonding. In some embodiments, the chelator is a macrocycle compound. Heteroatoms of the macrocyclic ring can participate in coordinate bonding of a radiometal ion to a chelator. A chelator can be substituted with one or more substituent groups, and the one or more substituent groups can also participate in coordinate bonding of a radiometal ion to a chelator in addition to, or alternatively to the heteroatoms of the macrocyclic ring.

    [0715] As used herein, the term “radiometal ion” or “radioactive metal ion” refers to one or more isotopes of the elements that emit particles and/or photons. Any radiometal ion known to those skilled in the art in view of the present disclosure can be used in the invention. Exemplary radioactive isotopes may be γ-emitting, Auger-emitting, β-emitting, alpha-emitting or positron-emitting radioactive isotope. Exemplary radioactive isotopes include .sup.3H, .sup.11C, .sup.13C, .sup.15N, .sup.18F, .sup.19F, .sup.55Co, .sup.57Co, .sup.60Co, .sup.61Cu, .sup.62Cu .sup.64Cu, .sup.67Cu, .sup.68Ga, .sup.72As, .sup.75Br, .sup.86Y, .sup.89Zr, .sup.90Sr, .sup.94mTc, .sup.99mTc, .sup.115In, .sup.123I, .sup.124I, .sup.125I, .sup.131I, .sup.211At, .sup.212Bi, .sup.213Bi, .sup.223Ra, .sup.226Ra, .sup.34Ce, .sup.225Ac and .sup.227Ac.

    [0716] Exemplary metal atoms are metals with an atomic number greater than 20, such as calcium atoms, scandium atoms, titanium atoms, vanadium atoms, chromium atoms, manganese atoms, iron atoms, cobalt atoms, nickel atoms, copper atoms, zinc atoms, gallium atoms, germanium atoms, arsenic atoms, selenium atoms, bromine atoms, krypton atoms, rubidium atoms, strontium atoms, yttrium atoms, zirconium atoms, niobium atoms, molybdenum atoms, technetium atoms, ruthenium atoms, rhodium atoms, palladium atoms, silver atoms, cadmium atoms, indium atoms, tin atoms, antimony atoms, tellurium atoms, iodine atoms, xenon atoms, cesium atoms, barium atoms, lanthanum atoms, hafnium atoms, tantalum atoms, tungsten atoms, rhenium atoms, osmium atoms, iridium atoms, platinum atoms, gold atoms, mercury atoms, thallium atoms, lead atoms, bismuth atoms, francium atoms, radium atoms, actinium atoms, cerium atoms, praseodymium atoms, neodymium atoms, promethium atoms, samarium atoms, europium atoms, gadolinium atoms, terbium atoms, dysprosium atoms, holmium atoms, erbium atoms, thulium atoms, ytterbium atoms, lutetium atoms, thorium atoms, protactinium atoms, uranium atoms, neptunium atoms, plutonium atoms, americium atoms, curium atoms, berkelium atoms, californium atoms, einsteinium atoms, fermium atoms, mendelevium atoms, nobelium atoms, or lawrencium atoms.

    [0717] In some embodiments, the radiometal ion is a “therapeutic emitter,” meaning a radiometal ion that is useful in therapeutic applications such as to damage cells, such as cancer cells. A suitable radiometal for use as a therapeutic agent is one that is capable of reducing or inhibiting the growth of, or in particular killing, a cancer cell, such as a prostate cancer cell. High energy radiometal selected to target cancer cells, preferably acts over a short range so that the cytotoxic effects are localized to the targeted cells. In certain embodiments, the radioconjugates of the disclosure can deliver a cytotoxic payload with the ability to emit alpha and/or beta particles in the vicinity of a tumor by binding onto cancer cells' surface antigens and initiating cell death. Radiotherapy is thus delivered in a more localized fashion to decrease damage to non-cancerous cells.

    [0718] Examples of radiometal ions suitable for use to generate the radioconjugates of the disclosure include, but are not limited to, .sup.47Sc, .sup.62Cu, .sup.64Cu, .sup.67C, .sup.67Ga, .sup.68Ga, .sup.86Y, .sup.89Zr, .sup.89Sr, .sup.90Y, .sup.99Tc, .sup.105Rh, .sup.109Pd, .sup.111Ag, .sup.111In, .sup.117Sn, .sup.149Tb, .sup.152Tb, .sup.155Tb, .sup.153Sm, .sup.159Gd, .sup.165Dy, .sup.166Ho, .sup.169Er, .sup.177Lu, .sup.186Re, .sup.188Re, .sup.194Ir, .sup.198Au, .sup.199Au, .sup.211At, .sup.212Pb, .sup.212Bi, .sup.213Bi, .sup.213Ra, .sup.225Ac, .sup.227Th, and .sup.255Fm. Preferably, the radiometal ion is a “therapeutic emitter,” meaning a radiometal ion that is useful in therapeutic applications. Examples of therapeutic emitters include, but are not limited to, beta or alpha emitters, such as, .sup.132La, .sup.135La, .sup.134Ce, .sup.144Nd, .sup.149Tb, .sup.152Th, .sup.155T, .sup.153Sm, .sup.159Gd, .sup.165Dy, .sup.166Ho, .sup.169Er, .sup.177Lu, .sup.186Re, .sup.88Re, .sup.194Ir, .sup.198Au, .sup.199Au, .sup.211At, .sup.212Pb, .sup.212Bi, .sup.213Bi, .sup.223Ra, .sup.225Ac, .sup.255Fm and .sup.227Th, .sup.226Th, .sup.230U.

    [0719] In some embodiments, the radiometal ion used as a therapeutic agent is an alpha-emitting radiometal ion, such as actinium-225 (.sup.225Ac). The 10-day half-life of .sup.225Ac is long enough to facilitate radio-conjugate production, but short enough to match the circulation pharmacokinetics of delivery vehicles such as antibodies. As such, .sup.225Ac radioimmunoconjugates are of particular interest. Additionally, .sup.225Ac decays in a series of steps that ultimately emits 4 alpha particles before reaching a stable isotope. Further, .sup.225Ac has advantages over .sup.177Lutetium since .sup.225Ac emits alpha-particles which are short-range and have high-energy, and are anticipated to cause limited damage to normal tissues when compared to long range .sup.177Lutetium beta particles.

    [0720] In some embodiments the radiometals may be used as an imaging agents or detectable label. Radionuclides used to radiolabel include, but are not limited to, carbon-11, nitrogen-13, oxygen-15, fluorine-18, copper-67, gallium-67, gallium-68, krypton-81m, rubidium-82, technetium-99, indium-111, iodine-123, iodine-124, iodine-125, iodine-131, xenon-133, thallium-201, zirconium-89, copper-64, yttrium-90, technetium-99m, iodine-123, iodine-124, and iodine-125, lutetium-177, At-211, lead-212, bismuth-212, bismuth-213, cerium-134 and actinium-225. These radionuclides, as well as their characteristics (e.g., half-life, emission, etc) are well known in the art, as are methods of making them and labeling proteins with them. In some embodiments the radiometal used as an imaging agents or detectable label is Cerium 134 (.sup.134Ce).

    [0721] In some embodiments the radiometal used as an imaging agents or detectable label is Indium 111 (.sup.111In) or Xenon 134 (.sup.134Xe).

    [0722] In some embodiments, the radiometal ion is conjugated to the isolated antibody or the antigen binding fragment thereof of the disclosure using known methods.

    [0723] In some embodiments, the radiometal ion is conjugated to the antibody or antigen binding fragment of the disclosure with a linker.

    [0724] In some embodiments, the radiometal ion is complexed with a chelating agent or a chelator.

    [0725] In some embodiments, the radiometal ion is bound to the chelator via coordinate bonding to form the radiometal complex.

    [0726] In some embodiments, the anti-PSMA antibodies or antigen binding fragments thereof of the disclosure is conjugated to (i.e., covalently linked to) chelators and radiometal complexes to produce radioimmunoconjugates that are suitable, for example, for medicinal applications in subjects, e.g., humans, such as targeted radiotherapy. In some embodiments, the anti-PSMA antibodies or antigen binding fragments thereof of the disclosure is conjugated to (i.e., covalently linked to) chelators and radiometal complexes to produce radioimmunoconjugates that are suitable for detection.

    [0727] In some embodiments, the anti-PSMA antibody or antigen binding fragment thereof of the disclosure is conjugated to a chelator and radiometal complex comprising actinium-225.

    [0728] In some embodiments, the anti-PSMA antibody or antigen binding fragments thereof of the disclosure is conjugated to a chelator and radiometal complex comprising indium-111.

    Chelator

    [0729] In some embodiments, the radioconjugates of the disclosure comprise a chelator or a radiometal complex comprising a radiometal ion coordinated to the chelator via coordinate bonding. As used herein, the term “chelator” or “chelant” refers to a chemical compound to which a radionuclide or radiometal, can be chelated via coordinate bonding to form a radiometal complex. In some embodiments, the chelator is a macrocyclic ring containing one or more heteroatoms, e.g., oxygen and/or nitrogen as ring atoms.

    [0730] In some embodiments, the chelator comprises a macrocyclic chelating moiety. Examples of macrocyclic chelating moieties include, without limitation, 1,4,7,10-tetraazacyclododecane-1,4,7,10,tetraacetic acid (DOTA), S-2-(4-isothiocyanatobenzyl)-1,4,7-triazacyclononane-1,4,7-triacetic acid (NOTA), 1,4,8,11-tetraazacyclodocedan-1,4,8,11-tetraacetic acid (TETA), 3,6,9,15-tetraazabicyclo[9.3.1]-pentadeca-1(15),11,13-triene-4-(S)-(4-isothiocyanatobenzyl)-3,6,9-triacetic acid (PCTA), 5-S-(4-aminobenzyl)-1-oxa-4,7,10-triazacyclododecane-4,7,10-tris(acetic acid) (DO3A), or a derivative thereof. In some aspects, the chelator is 1,4,7,10-tetraazacyclododecane-1,4,7,10,tetraacetic acid (DOTA). In other aspects, the chelator is S-2-(4-isothiocyanatobenzyl)-1,4,7-triazacyclononane-1,4,7-triacetic acid (NOTA). In further aspects, the chelator is 1,4,8,11-tetraazacyclodocedan-1,4,8,11-tetraacetic acid (TETA). In yet other aspects, the chelator is 3,6,9,15-tetraazabicyclo[9.3.1]-pentadeca-1(15),11,13-triene-4-(S)-(4-isothiocyanatobenzyl)-3,6,9-triacetic acid (PCTA). In still further aspects, the chelator is 5-S-(4-aminobenzyl)-1-oxa-4,7,10-triazacyclododecane-4,7,10-tris(acetic acid) (DO3A). In other aspects, the chelator is DOTA, DFO, DTPA, NOTA, TETA, DTPA, or HOPO.

    [0731] In some embodiments, the chelator is DOTA (1,4,7,10-Tetraazacyclododecane-1,4,7,10-tetraacetic acid; tetraxaten).

    [0732] In some embodiments, the radioconjugate of the present disclosure comprises a radiometal ion chelated to the chelator p-SCN-Bn-DOTA (S-2-(4-Isothiocyanatobenzyl)-1,4,7,10-tetraazacyclododecane tetraacetic acid) of formula IV

    ##STR00006##

    or a pharmaceutically acceptable salt thereof.

    [0733] In some embodiments, the chelator is H.sub.2bp18c6 (N,N′-bis[(6-carboxy-2-pyridil)methyl]-4,13-diaza-18-crown-6) or a H.sub.2bp18c6 derivative as described in Thiele et al. “An Eighteen-Membered Macrocyclic Ligand for Actinium-225 Targeted Alpha Therapy” Angew. Chem. Int. Ed. (2017) 56, 14712-14717, and Roca-Sabio et al. “Macrocyclic Receptor Exhibiting Unprecedented Selectivity for Light Lanthanides” J. Am. Chem. Soc. (2009) 131, 3331-3341.

    [0734] As used herein, the term “TOPA” refers to a macrocycle known in the art as H.sub.2bp18c6 and may alternatively be referred to as N,N′-bis[(6-carboxy-2-pyridil)methyl]-4,13-diaza-18-crown-6. See, e.g., Roca-Sabio et al., “Macrocyclic Receptor Exhibiting Unprecedented Selectivity for Light Lanthanides,” J. Am. Chem. Soc. (2009) 131, 3331-3341, which is incorporated by reference herein.

    [0735] Additional chelators suitable for use in accordance with the present invention are described in WO2018/183906 and WO2020/106886, which are incorporated by reference herein. In some embodiments, the radioconjugate of the present disclosure comprises a radiometal ion chelated to a chelator described in WO2020/229974 which is incorporated herein by reference in its entirety. In some embodiments, the chelator has the structure of formula (I)

    ##STR00007##

    or a pharmaceutically acceptable salt thereof, wherein:

    [0736] each of ring A and ring B is independently a 6-10 membered aryl or a 5-10 membered heteroaryl

    [0737] each of Z.sub.1 and Z.sub.2 is independently —(C(R.sub.12).sub.2).sub.m— or —(CH.sub.2).sub.n—C(R.sub.12)(X)—(CH.sub.2).sub.n—;

    [0738] each of R.sub.14, R.sub.15, R.sub.16, and R.sub.17 is independently hydrogen, alkyl, or X, or alternatively R.sub.14 and R.sub.15 and/or R.sub.16 and R.sub.17 are taken together with the carbon atoms to which they are attached to form a 5- or 6-membered cycloalkyl ring optionally substituted with X;

    [0739] each X is independently -L.sub.1-R.sub.4;

    [0740] R.sub.4 is a nucleophilic moiety or an electrophilic moiety, or R.sub.4 comprises a targeting ligand; and L.sub.1 is absent or a linker.

    [0741] In some embodiments, the radioconjugate of the present disclosure comprises a radiometal ion chelated to a chelator described in WO2021/060350 which is incorporated herein by reference in its entirety.

    In some embodiments, the radioconjugate of the disclosure comprises a radiometal ion chelated to a compound of formula (II)

    ##STR00008##

    [0742] or a pharmaceutically acceptable salt thereof, wherein:

    [0743] R.sub.1 is hydrogen and R.sub.2 is -L.sub.1-R.sub.4;

    [0744] alternatively, R.sub.1 is -L.sub.1-R.sub.4 and R.sub.2 is hydrogen;

    [0745] R.sub.3 is hydrogen;

    [0746] alternatively, R.sub.2 and R.sub.3 are taken together with the carbon atoms to which they are attached to form a 5- or 6-membered cycloalkyl, wherein the 5- or 6-membered cycloalkyl is optionally substituted with -L.sub.1-R.sub.4;

    [0747] L.sub.1 is absent or a linker; and

    [0748] R.sub.4 is a nucleophilic moiety, an electrophilic moiety, or a targeting ligand.

    [0749] In some embodiments, L.sub.1 is absent. When L.sub.1 is absent, R.sub.4 is directly bound (e.g., via covalent linkage) to the compound.

    [0750] In some embodiments, the linker structures include, but are not limited to:

    ##STR00009##

    and wherein m is an integer of 0 to 12.

    [0751] In some embodiments, R.sub.4 is a nucleophilic moiety or an electrophilic moiety. A “nucleophilic moiety” or “nucleophilic group” refers to a functional group that donates an electron pair to form a covalent bond in a chemical reaction. An “electrophilic moiety” or “electrophilic group” refers to a functional group that accepts an electron pair to form a covalent bond in a chemical reaction. Nucleophilic groups react with electrophilic groups, and vice versa, in chemical reactions to form new covalent bonds. Reaction of the nucleophilic group or electrophilic group of a compound of the invention with a targeting ligand or other chemical moiety (e.g., linker) comprising the corresponding reaction partner allows for covalent linkage of the targeting ligand or chemical moiety to the compound of the invention.

    [0752] Exemplary examples of nucleophilic groups include, but are not limited to, azides, amines, and thiols. Exemplary examples of electrophilic groups include, but are not limited to amine-reactive groups, thiol-reactive groups, alkynyls and cycloalkynyls. An amine-reactive group preferably reacts with primary amines, including primary amines that exist at the N-terminus of each polypeptide chain and in the side-chain of lysine residues. Examples of amine-reactive groups suitable for use in the invention include, but are not limited to, N-hydroxy succinimide (NHS), substituted NHS (such as sulfo-NHS), isothiocyanate (—NCS), isocyanate (—NCO), esters, carboxylic acid, acyl halides, amides, alkylamides, and tetra- and per-fluoro phenyl ester. A thiol-reactive group reacts with thiols, or sulfhydryls, preferably thiols present in the side-chain of cysteine residues of polypeptides. Examples of thiol-reactive groups suitable for use in the invention include, but are not limited to, Michael acceptors (e.g., maleimide), haloacetyl, acyl halides, activated disulfides, and phenyloxadiazole sulfone.

    [0753] In certain embodiments, R.sub.4 is —NH.sub.2, —NCS (isothiocyanate), —NCO (isocyanate), —N.sub.3 (azido), alkynyl, cycloalkynyl, carboxylic acid, ester, amido, alkylamide, maleimido, acyl halide, tetrazine, or trans-cyclooctene, more particularly —NCS, —NCO, —N.sub.3, alkynyl, cycloalkynyl, —C(O)R.sub.13, —COOR.sub.13, —CON(R.sub.13).sub.2, maleimido, acyl halide (e.g., —C(O)Cl, —C(O)Br), tetrazine, or trans-cyclooctene wherein each R.sub.13 is independently hydrogen or alkyl.

    [0754] In some embodiments, R.sub.4 is an alkynyl, cycloalkynyl, or azido group thus allowing for attachment of the compound of the invention to a targeting ligand or other chemical moiety (e.g., linker) using a click chemistry reaction. In such embodiments, the click chemistry reaction that can be performed is a Huisgen cycloaddition or 1,3-dipolar cycloaddition between an azido (—N.sub.3) and an alkynyl or cycloalkynyl group to form a 1,2,4-triazole linker or moiety. In one embodiment, the compound of the invention comprises an alkynyl or cycloalkynyl group and the targeting ligand or other chemical moiety comprises an azido group. In another embodiment, the compound of the invention comprises an azido group and the targeting ligand or other chemical moiety comprises an alkynyl or cycloalkynyl group.

    [0755] In certain embodiments, R.sub.4 is an alkynyl group, more preferably a terminal alkynyl group or cycloalkynyl group that is reactive with an azide group, particularly via strain-promoted azide-alkyne cycloaddition (SPAAC). Examples of cycloalkynyl groups that can react with azide groups via SPAAC include, but are not limited to cyclooctynyl or a bicyclononynyl (BCN), difluorinated cyclooctynyl (DIFO), dibenzocyclooctynyl (DIBO), keto-DIBO, biarylazacyclooctynonyl (BARAC), dibenzoazacyclooctynyl (DIBAC, DBCO, ADIBO), dimethoxyazacyclooctynyl (DIMAC), difluorobenzocyclooctynyl (DIFBO), monobenzocyclooctynyl (MOBO), and tetramethoxy dibenzocyclooctynyl (TMDIBO).

    [0756] In certain embodiments, R.sub.4 is dibenzoazacyclooctynyl, such as DIBAC, DBCO, and ADIBO, which has the following structure:

    ##STR00010##

    [0757] In embodiments in which R.sub.4 is DBCO, the DBCO can be covalently linked to a compound directly or indirectly via a linker, and is preferably attached to the compound indirectly via a linker.

    [0758] In certain embodiments, R.sub.4 is a targeting ligand. The targeting ligand can be linked to the compound directly via a covalent linkage, or indirectly via a linker. The targeting ligand can be a polypeptide, e.g., antibody or antigen binding fragment thereof, aptamer, or scaffold protein, etc. In preferred embodiments, the targeting ligand is an antibody or antigen binding fragment thereof, such as antibody or antigen binding fragment thereof, e.g., monoclonal antibody (mAb) or antigen binding fragment thereof, which specifically binds an antigen associated with a neoplastic disease or disorder, such as a cancer antigen, which can be prostate-specific membrane antigen (PSMA), BCMA, Her2, EGFR, KLK2, CD19, CD22, CD30, CD33, CD79b, or Nectin-4. In some embodiment, R.sub.4 is an anti PSMA antibody or fragment thereof of the disclosure.

    [0759] In some embodiments, the radioconjugate comprises a radiometal ion chelated to a compound of formula (III)

    ##STR00011##

    or a pharmaceutically acceptable salt thereof, wherein:

    [0760] L.sub.1 is absent or a linker; and

    [0761] R.sub.4 is a nucleophilic moiety, an electrophilic moiety, or a targeting ligand.

    [0762] In another embodiment the radioconjugate comprises a radiometal ion chelated to a compound of formula (IV):

    ##STR00012##

    or a pharmaceutically acceptable salt thereof, wherein:

    [0763] L.sub.1 is absent or a linker; and

    [0764] R.sub.4 is a nucleophilic moiety, an electrophilic moiety, or a targeting ligand.

    [0765] In another embodiment, the radioconjugate comprises a radiometal ion chelated to a chelator, wherein: R.sub.1 is -L.sub.1-R.sub.4; R.sub.2 and R.sub.3 are taken together with the carbon atoms to which they are attached to form a 5- or 6-membered cycloalkyl; L.sub.1 is absent or a linker; and R.sub.4 is a nucleophilic moiety, an electrophilic moiety, or a targeting ligand; or a pharmaceutically acceptable salt thereof.

    [0766] In a further embodiment, the radioconjugate comprises a radiometal ion chelated to a chelator, wherein R.sub.1 is H; R.sub.2 and R.sub.3 are taken together with the carbon atoms to which they are attached to form a 5- or 6-membered cycloalkyl substituted with -L.sub.1-R.sub.4; L.sub.1 is absent or a linker; and R.sub.4 is a nucleophilic moiety, an electrophilic moiety, or a targeting ligand; or a pharmaceutically acceptable salt thereof:

    [0767] Additional embodiments include radioconjugate comprises a radiometal ion chelated to a chelator wherein R.sub.4 is a targeting ligand, wherein the targeting ligand is selected from the group consisting of an antibody, antigen binding fragment of an antibody, scaffold protein, and aptamer.

    [0768] In some embodiments, the radioconjugate comprises a radiometal ion chelated to any one or more independently selected chelator from the group consisting of:

    ##STR00013## ##STR00014## ##STR00015## ##STR00016## ##STR00017## ##STR00018## ##STR00019## ##STR00020## ##STR00021##

    and, wherein n is 1-10.

    [0769] In some embodiments, the radioconjugate of the present disclosure comprises a radiometal ion chelated to the chelator TOPA-[C7]-phenylisothiocyanate of formula:

    ##STR00022##

    or a pharmaceutically acceptable salt thereof.

    [0770] In some embodiments, the chelator is covalently attached to a targeting ligand (e.g., an antibody or antigen binding fragment thereof of the disclosure) to form immunoconjugates or radioimmunoconjugates by reacting the compound with an azide-labeled targeting ligand to form a 1,2,3-triazole linker via a click chemistry reaction as described in more detail below. Chelators of the disclosure can be produced by any method known in the art in view of the present disclosure. For example, the pendant aromatic/heteroaromatic groups can be attached to the macrocyclic ring portion by methods known in the art, such as those exemplified and described below.

    [0771] As used herein, an “antibody-chelator complex” or “conjugate intermediate” refers to a precursor of a radioconjugate, which comprises an antibody, or antigen binding domain, that is conjugated (joined, e.g., bound via a covalent bond) to a chelator that does not comprise a radiometal. A conjugate intermediate may comprise a linker, wherein the chelator is joined to the antibody or antigen binding domain via the linker. After a radiometal is chelated to the chelator of a conjugate intermediate, it becomes a radioconjugate. For example, “DOTA-mAb” refers to a conjugate intermediate comprising a DOTA conjugated to an antibody.

    [0772] Any of the chelators described herein can comprise a radiometal ion. In some embodiments the radiometal ion is an alpha-emitting radiometal ion. In some embodiments, the radiometal is .sup.225Ac. In some embodiments the radiometal ion is a gamma-emitting radiometal ion. In some embodiments, the radiometal is .sup.111In. In some embodiments, the radiometal is .sup.134Ce. Chelators of the disclosure can robustly chelate radiometal ions, particularly .sup.225Ac at any specific activity irrespective of metal impurities, thus forming a radiometal complex having high chelation stability in vivo and in vitro and which is stable.

    [0773] Radiometal complexes can be produced by any method known in the art in view of the present disclosure. For example, a chelator of the invention can be mixed with a radiometal ion and the mixture incubated to allow for formation of the radiometal complex. In an exemplary embodiment, a chelator is mixed with a solution of .sup.225Ac(NO3).sub.3 to form a radiocomplex comprising .sup.225Ac bound to the chelator via coordinate bonding. Chelators of in the invention efficiently chelate radiometals, particularly .sup.225Ac. Thus, in particular embodiments, a chelator of the invention is mixed with a solution of .sup.225Ac ion at a ratio by concentration of chelator to 225Ac ion of 1:1000, 1:500, 1:400, 1:300, 1:200, 1:100, 1:50, 1:10, or 1:5, preferably 1:5 to 1:200, more preferably 1:5 to 1:100. The radiocomplex can be characterized by instant thin layer chromatography (e.g., iTLC-SG), HPLC, LC-MS, etc.

    Radiometal Complexes

    [0774] In some embodiments, the anti-PSMA antibodies or antigen binding fragments thereof of the disclosure is conjugated to radiometal complexes comprising a radiometal ion complexed to a chelator of the disclosure via coordinate bonding to form a radioimmunoconjugate. Any of the chelator of the disclosure can comprise a radiometal ion. In some embodiments, the radiometal ion is an alpha-emitting radiometal ion. In some embodiments the radiometal ion is .sup.225Ac. In some embodiments the radiometal ion is .sup.111In. In some embodiments the radiometal ion is .sup.134Ce.

    [0775] Chelators of the disclosure can complex to radiometal ions at any specific activity irrespective of metal impurities, thus forming a radiometal complex having high chelation stability in vivo and in vitro and which is stable to challenge agents, e.g., diethylene triamine pentaacetic acid (DTPA).

    [0776] Any radiometal complex described herein can be used to produce a radioimmunoconjugate of the invention.

    [0777] In some embodiments, the anti-PSMA antibody or antigen binding fragment thereof of the disclosure is conjugated to a radiometal complex of formula (I-M.sup.+):

    ##STR00023##

    or a pharmaceutically acceptable salt thereof, wherein:

    [0778] M.sup.+ is a radiometal ion, wherein M.sup.+ is selected from the group consisting of actinium-225(.sup.225Ac), indium-111 (.sup.111In), radium-223 (.sup.233Ra), bismuth-213 (.sup.213Bi), lead-212 (.sup.212Pb(II) and/or .sup.212Pb(IV)), terbium-149 (.sup.149Tb), terbium-152 (.sup.152Tb), terbium-155 (.sup.155Tb), fermium-255 (.sup.255Fm), thorium-227 (.sup.227Th), thorium-226 (.sup.226Th.sup.4+), astatine-211 (.sup.211At), cerium-134 (.sup.134Ce), neodymium-144 (.sup.144Nd), lanthanum-132 (.sup.132La), lanthanum-135 (.sup.135La) and uranium-230 (.sup.230U);

    [0779] R.sub.1 is hydrogen and R.sub.2 is -L.sub.1-R.sub.4;

    [0780] alternatively, R.sub.1 is -L.sub.1-R.sub.4 and R.sub.2 is hydrogen;

    [0781] R.sub.3 is hydrogen;

    [0782] alternatively, R.sub.2 and R.sub.3 are taken together with the carbon atoms to which they are attached to form a 5- or 6-membered cycloalkyl, wherein the 5- or 6-membered cycloalkyl is optionally substituted with -L.sub.1-R.sub.4;

    [0783] L.sub.1 is absent or a linker;

    [0784] R.sub.4 is a nucleophilic moiety, an electrophilic moiety, or a targeting ligand.

    [0785] In some embodiment, the anti-PSMA antibody or antigen binding fragment thereof of the disclosure is conjugated to a radiometal complex of Formula (II-M.sup.+):

    ##STR00024##

    [0786] or a pharmaceutically acceptable salt thereof, wherein:

    [0787] M.sup.+ is a radiometal ion, wherein M.sup.+ is selected from the group consisting of actinium-225(.sup.225Ac), indium-111 (.sup.111In), radium-223 (.sup.233Ra), bismuth-213 (.sup.213Bi), lead-212 (.sup.212Pb(II) and/or .sup.212Pb(IV)), terbium-149 (.sup.149Tb), terbium-152 (.sup.152Tb), terbium-155 (.sup.155Tb), fermium-255 (.sup.255Fm), thorium-227 (.sup.227Th), thorium-226 (.sup.226Th.sup.4+), astatine-211 (.sup.211At), cerium-134 (.sup.134Ce), neodymium-144 (.sup.144Nd), lanthanum-132 (.sup.132La), lanthanum-135 (.sup.135La) and uranium-230 (.sup.230U);

    [0788] L.sub.1 is absent or a linker;

    [0789] R.sub.4 is a nucleophilic moiety, an electrophilic moiety, or a targeting ligand.

    [0790] In some embodiment, the anti-PSMA antibody or antigen binding fragment thereof of the disclosure is conjugated to a radiometal complex of Formula (III-M.sup.+):

    ##STR00025##

    or a pharmaceutically acceptable salt thereof, wherein:

    [0791] M.sup.+ is a radiometal ion, wherein M.sup.+ is selected from the group consisting of actinium-225(.sup.225Ac), indium-111 (.sup.111In), radium-223 (.sup.233Ra), bismuth-213 (.sup.213Bi), lead-212 (.sup.212Pb(II) and/or .sup.212Pb(IV)), terbium-149 (.sup.149Tb), terbium-152 (.sup.152Tb), terbium-155 (.sup.155Tb), fermium-255 (.sup.255Fm), thorium-227 (.sup.227Th), thorium-226 (.sup.226Th.sup.4+), astatine-211 (.sup.211At), cerium-134 (.sup.134Ce), neodymium-144 (.sup.144Nd), lanthanum-132 (.sup.132La), lanthanum-135 (.sup.135La) and uranium-230 (.sup.230U); L.sub.1 is absent or a linker; and

    [0792] R.sub.4 is a nucleophilic moiety, an electrophilic moiety, or a targeting ligand.

    [0793] In another embodiment, the anti-PSMA antibodies or antigen binding fragments thereof of the disclosure is conjugated to a radiometal complex wherein:

    [0794] M.sup.+ is a radiometal ion, wherein M.sup.+ is selected from the group consisting of actinium-225(.sup.225Ac), indium-111 (.sup.111In), radium-223 (.sup.233Ra), bismuth-213 (.sup.213Bi), lead-212 (.sup.212Pb(II) and/or .sup.212Pb(IV)), terbium-149 (.sup.149Tb), terbium-152 (.sup.152Tb), terbium-155 (.sup.155Tb), fermium-255 (.sup.255Fm), thorium-227 (.sup.227Th), thorium-226 (.sup.226Th.sup.4+), astatine-211 (.sup.211At), cerium-134 (.sup.134Ce), neodymium-144 (.sup.144Nd), lanthanum-132 (.sup.132La), lanthanum-135 (.sup.135La) and uranium-230 (.sup.230U);

    [0795] R.sub.1 is -L.sub.1-R.sub.4;

    [0796] R.sub.2 and R.sub.3 are taken together with the carbon atoms to which they are attached to form a 5- or 6-membered cycloalkyl;

    [0797] L.sub.1 is absent or a linker; and

    [0798] R.sub.4 is a nucleophilic moiety, an electrophilic moiety, or a targeting ligand;

    [0799] or a pharmaceutically acceptable salt thereof.

    [0800] In a further embodiment, the anti-PSMA antibodies or antigen binding fragments thereof of the disclosure is conjugated to a radiometal complex wherein

    [0801] M.sup.+ is a radiometal ion, wherein M.sup.+ is selected from the group consisting of actinium-225(.sup.225Ac), Indium-111 (.sup.111In), radium-223 (.sup.233Ra), bismuth-213 (.sup.213Bi), lead-212 (.sup.212Pb(II) and/or .sup.212Pb(IV)), terbium-149 (.sup.149Tb), terbium-152 (.sup.152Tb), terbium-155 (.sup.155Tb), fermium-255 (.sup.255Fm), thorium-227 (.sup.227Th), thorium-226 (.sup.226Th.sup.4+), astatine-211 (.sup.211At), cerium-134 (.sup.134Ce), neodymium-144 (.sup.144Nd), lanthanum-132 (.sup.132La), lanthanum-135 (.sup.135La) and uranium-230 (.sup.230U);

    [0802] R.sub.1 is H;

    [0803] R.sub.2 and R.sub.3 are taken together with the carbon atoms to which they are attached to form a 5- or 6-membered cycloalkyl substituted with -L.sub.1-R.sub.4;

    [0804] L.sub.1 is absent or a linker; and

    [0805] R.sub.4 is a nucleophilic moiety, an electrophilic moiety, or a targeting ligand;

    [0806] or a pharmaceutically acceptable salt thereof.

    [0807] In some embodiment, the anti-PSMA antibodies or antigen binding fragments thereof of the disclosure is conjugated to any one or more radiometal complexes selected from the group consisting of:

    ##STR00026## ##STR00027## ##STR00028## ##STR00029## ##STR00030## ##STR00031## ##STR00032## ##STR00033## ##STR00034##

    wherein:

    [0808] n is 1-10 and

    [0809] M.sup.+ is a radiometal ion, wherein M.sup.+ is selected from the group consisting of actinium-225(.sup.225Ac), indium-1111 (.sup.111In), radium-223 (.sup.233Ra), bismuth-213 (.sup.213Bi), lead-212 (.sup.212Pb(II) and/or .sup.212Pb(IV)), terbium-149 (.sup.149Tb), terbium-152 (.sup.152Tb), terbium-155 (.sup.155Tb), fermium-255 (.sup.255Fm), thorium-227 (.sup.227Th), thorium-226 (.sup.226Th.sup.4+), astatine-211 (.sup.211At), cerium-134 (.sup.134Ce), neodymium-144 (.sup.144Nd), lanthanum-132 (.sup.132La), lanthanum-135 (.sup.135La) and uranium-230 (.sup.230U).

    [0810] In some embodiments, the anti-PSMA antibodies or antigen binding fragments thereof of the disclosure is conjugated to a radiometal complex of Formula:

    ##STR00035##

    or a pharmaceutically acceptable salt thereof, wherein:

    [0811] M.sup.+ is a radiometal ion, wherein M.sup.+ is selected from the group consisting of actinium-225(.sup.225Ac), indium-1111 (.sup.111In), radium-223 (.sup.33Ra), bismuth-213 (.sup.213Bi), lead-212 (.sup.212Pb(II) and/or .sup.212Pb(IV)), terbium-149 (.sup.149Tb), terbium-152 (.sup.152Tb), terbium-155 (.sup.155Tb), fermium-255 (.sup.255Fm), thorium-227 (.sup.227Th), thorium-226 (.sup.226Th.sup.4+), astatine-211 (.sup.211At), cerium-134 (.sup.134Ce), neodymium-144 (.sup.144Nd), lanthanum-132 (.sup.132La), lanthanum-135 (.sup.135La) and uranium-230 (.sup.230U).

    [0812] In some embodiments, the anti-PSMA antibodies or antigen binding fragments thereof of the disclosure is conjugated to a radiometal complex of Formula:

    ##STR00036##

    or a pharmaceutically acceptable salt thereof, wherein:

    [0813] M.sup.+ is a radiometal ion, wherein M.sup.+ is selected from the group consisting of actinium-225(.sup.225Ac), indium-111 (.sup.111In), radium-223 (.sup.233Ra), bismuth-213 (.sup.213Bi), lead-212 (.sup.212Pb(II) and/or .sup.212Pb(IV)), terbium-149 (.sup.149Tb), terbium-152 (.sup.152Tb), terbium-155 (.sup.155Tb), fermium-255 (.sup.255Fm), thorium-227 (.sup.227Th), thorium-226 (.sup.226Th.sup.4+), astatine-211 (.sup.211At), cerium-134 (.sup.134Ce), neodymium-144 (.sup.144Nd), lanthanum-132 (.sup.132La), lanthanum-135 (.sup.135La) and uranium-230 (.sup.230U)

    [0814] In certain embodiments, the radioimmunoconjugate is any one or more structures independently selected from the group consisting of:

    ##STR00037##

    wherein:

    [0815] M.sup.+ is a radiometal ion, wherein M.sup.+ is selected from the group consisting of actinium-225(.sup.225Ac), indium-111 (.sup.111In), radium-223 (.sup.233Ra), bismuth-213 (.sup.213Bi), lead-212 (.sup.212Pb(II) and/or .sup.212Pb(IV)), terbium-149 (.sup.149Tb), terbium-152 (.sup.152Tb), terbium-155 (.sup.155Tb), fermium-255 (.sup.255Fm), thorium-227 (.sup.227Th), thorium-226 (.sup.226Th.sup.4+), astatine-211 (.sup.211At), cerium-134 (.sup.134Ce), neodymium-144 (.sup.144Nd), lanthanum-132 (.sup.132La), lanthanum-135 (.sup.135La) and uranium-230 (.sup.230U);

    [0816] L.sub.1 is absent or a linker; and

    [0817] mAb is an antibody or antigen binding fragment thereof of the disclosure that binds PSMA.

    [0818] In another embodiment, the radioimmunoconjugate is any one or more selected from the group consisting of:

    ##STR00038##

    wherein:

    [0819] M.sup.+ is a radiometal ion, wherein M.sup.+ is selected from the group consisting of actinium-225(.sup.225Ac), indium-111 (.sup.111In), radium-223 (.sup.233Ra), bismuth-213 (.sup.213Bi), lead-212 (.sup.212Pb(II) and/or .sup.212Pb(IV)), terbium-149 (.sup.149Tb), terbium-152 (.sup.152Tb), terbium-155 (.sup.155Tb), fermium-255 (.sup.255Fm), thorium-227 (.sup.227Th), thorium-226 (.sup.226Th.sup.4+), astatine-211 (.sup.211At), cerium-134 (.sup.134Ce), neodymium-144 (.sup.144Nd), lanthanum-132 (.sup.132La), lanthanum-135 (.sup.135La) and uranium-230 (.sup.230U); and

    [0820] mAb is an antibody or antigen binding fragment thereof of the disclosure that binds PSMA.

    [0821] It is noted that, in the radioimmunoconjugate structures depicted herein comprising “mAb,” the structures do not show the residue of the mAb (e.g., the lysine residue of the mAb) that is linked to the radiometal complex.

    [0822] In some embodiments, the disclosure provides a radioimmunoconjugate having the following structure:

    ##STR00039##

    (also referred to herein as TOPA-[C7]-phenylthiourea-PSMA Antibody Conjugate), wherein:

    [0823] M.sup.+ is a radiometal ion, wherein M.sup.+ is selected from the group consisting of actinium-225(.sup.225Ac), indium-111 (111In), radium-223 (.sup.233Ra), bismuth-213 (.sup.213Bi), lead-212 (.sup.212Pb(II) and/or .sup.212Pb(IV)), terbium-149 (.sup.149Tb), terbium-152 (.sup.152Tb), terbium-155 (.sup.155Tb), fermium-255 (.sup.255Fm), thorium-227 (.sup.227Th), thorium-226 (.sup.226Th.sup.4+), astatine-211 (.sup.211At), cerium-134 (.sup.134Ce), neodymium-144 (.sup.144Nd), lanthanum-132 (.sup.132La), lanthanum-135 (.sup.135La) and uranium-230 (.sup.230U); and

    [0824] mAb is an antibody or antigen binding fragment thereof of the disclosure that binds PSMA.

    [0825] In some embodiments, the disclosure provides a radioimmunoconjugate having the following structure:

    ##STR00040##

    (also referred to herein as p-SCN-Bn-DOTA-PSMA Antibody Conjugate),

    [0826] wherein M.sup.+ is a radiometal ion, wherein M.sup.+ is selected from the group consisting of actinium-225(.sup.225Ac), indium-111 (111In), radium-223 (.sup.233Ra), bismuth-213 (.sup.213Bi), lead-212 (.sup.212Pb(II) and/or .sup.212Pb(IV)), terbium-149 (.sup.149Tb), terbium-152 (.sup.152Tb), terbium-155 (.sup.155Tb), fermium-255 (.sup.255Fm), thorium-227 (.sup.227Th), thorium-226 (.sup.226Th.sup.4+), astatine-211 (.sup.211At), cerium-134 (.sup.134Ce), neodymium-144 (44Nd), lanthanum-132 (.sup.132La), lanthanum-135 (.sup.135La) and uranium-230 (.sup.230U); and

    [0827] mAb is an antibody or antigen binding fragment thereof of the disclosure that binds PSMA.

    Conjugation

    [0828] It will be appreciated that a number of well-known different reactions may be used to attach the drug moiety, chelator and/or linker to the selected antibody.

    [0829] According to certain embodiments, a drug moiety, chelator or chelator-linker comprises a nucleophilic moiety or an electrophilic moiety. Reaction of the nucleophilic group or electrophilic group of a chelator or chelator-linker with an antibody or antigen binding domain comprising the corresponding reaction partner allows for covalent linkage of the antibody or antigen binding domain to the drug moiety, chelator, or chelator-linker. Examples of nucleophilic groups include, but are not limited to, azides, amines, and thiols. Examples of electrophilic groups include, but are not limited to amine-reactive groups, thiol-reactive groups, alkynyls and cycloalkynyls. An amine-reactive group preferably reacts with primary amines, including primary amines that exist at the N-terminus of each polypeptide chain and in the side-chain of lysine residues. Examples of amine-reactive groups include, but are not limited to, N-hydroxy succinimide (NHS), substituted NHS (such as sulfo-NHS), isothiocyanate (—NCS), isocyanate (—NCO), esters, carboxylic acid, acyl halides, amides, alkylamides, and tetra- and per-fluoro phenyl ester. A thiol-reactive group reacts with thiols, or sulfhydryls, preferably thiols present in the side-chain of cysteine residues of polypeptides. Examples of thiol-reactive groups include, but are not limited to, Michael acceptors (e.g., maleimide), haloacetyl, acyl halides, activated disulfides, and phenyloxadiazole sulfone.

    Residue Specific Conjugation

    [0830] In some embodiments the conjugation of drug moiety, chelator and/or linker to the antibody or antigen binding fragment thereof of the disclosure may be achieved through residue-specific methods (random conjugation) such as acylation of amines on lysine residues and alkylation of thiols on cysteine residues. Examples of residue specific methods for conjugation that can be used include, but are not limited to, conjugation of a drug moiety, chelator, linker and/or radiometal complex to lysine residues of the antibody using a drug moiety, chelator, linker, or radiometal complex comprising, e.g., an activated ester or isothiocyanate group; conjugation of a drug moiety, chelator, linker and/or radiometal complex to cysteine residues of the antibody using a drug moiety, chelator, linker, or radiometal complex comprising, e.g., a maleimide, haloacetyl derivative, acyl halide, activated disulfide group, or methylsulfonyl phenyloxadiazole group; conjugation of a drug moiety, chelator, linker and/or radiometal complex to tyrosine resides of the antibody using a drug moiety, chelator, linker, or radiometal complex comprising, e.g., 4-phenyl-3H-1,2,4-triazoline-3,5(4H)-diones (PTADs); and conjugation of a drug moiety, chelator, linker and/or radiometal complex to methionine residues of the antibody using a drug moiety, chelator, linker, or radiometal complex comprising, e.g., an oxaziridine derivative.

    [0831] Residue-specific methods for conjugation to proteins are well established and most commonly involve either lysine side chains, using an activated ester or isothiocyanate, or cysteine side chains with a maleimide, haloacetyl derivative or activated disulfide (Brinkley Bioconjugate Chem 1992:2). Since most proteins have multiple lysine and cysteine residues, heterogeneous mixtures of product with different numbers of conjugated molecules at a variety of amino acid positions are typically obtained using such methods. Additional methods have been established including tyrosine-specific conjugation (Ban et al. Bioconjugate Chemistry 2013:520), methionine-specific methods (Lin et al. Science 2017 (355) 597), additional cysteine-focused approaches (Toda et al. Angew Chemie 2013:12592), and others.

    [0832] In some embodiments, the PSMA antibody or antibody fragment thereof of the disclosure can be conjugated to any of the radiometal complexes described herein through one or more Lysine residues of the antibody.

    [0833] In some embodiments, the ADCs or radioconjugates of the disclosure may be generated through conjugation of a drug moiety, chelator, linker, or radiometal complex to solvent-exposed amino groups of lysine residues present in the selected antibody. Conjugation reactions involving lysines include, but are not limited to, isothiocyanate, NHS-ester, sulfonyl fluorides, fluorosulfates, dichlorotriazines, activated esters, activated sulfonamides, vinyl sulfonamides, imidoesters, isothiocyanates, salicylaldehydes, iminoboronates and α,β-unsaturated carbonyls.

    [0834] In some embodiments, the ADCs or radioconjugates of the disclosure may be generated through reactions exploiting sulfhydryl groups of cysteines residues present in the selected antibody. Particularly preferred embodiments will comprise conjugation of antibodies comprising one or more free cysteines. Conjugation reactions involving reduced cysteines include, but are not limited to, thiol-maleimide, thiol-halogeno (acyl halide), thiol-ene, thiol-yne, thiol-vinylsulfone, thiol-bisulfone, thiol-thiosulfonate, thiol-pyridyl disulfide and thiol-parafluoro reactions.

    [0835] In some embodiments, prior to conjugation, antibodies may be made reactive for conjugation with linker reagents by treatment with a reducing agent such as dithiothreitol (DTT) or (tris(2-carboxyethyl)phosphine (TCEP). In some embodiments reactive thiol groups may be introduced into the selected antibody (or fragment thereof) by introducing one, two, three, four, or more free cysteine residues. In some embodiments, conjugation methodology may include full or partial reduction of each of the intrachain or interchain antibody disulfide bonds to provide conjugation sites. In some embodiments, free cysteines may be made reactive for conjugation with linker reagents by treatment with a reducing agent such as dithiothreitol (DTT) or (tris (2-carboxyethyl)phosphine (TCEP). Each free cysteine will thus present, theoretically, a reactive thiol nucleophile.

    [0836] Since most proteins have multiple lysine, threonine, methionine and cysteine residues, heterogeneous mixtures of product with different numbers of conjugated molecules at a variety of amino acid positions are typically obtained using residue-specific conjugations methods.

    Site Specific Conjugation

    [0837] More recently, site-selective and site-specific conjugation methods have been established for monoclonal antibodies and other proteins (Agarwal, P. and C. R. Bertozzi, Bioconjug Chem, 2015. 26(2): p. 176-92; Rabuka et al. Curr Opin Chem Biol 2010:790). These include incorporation of unnatural amino acids; fusion of the protein of interest to a ‘self-labeling tag’ such as SNAP or DHFR or a tag that is recognized and modified specifically by another enzyme such as sortase A, lipoic acid ligase and formylglycine-generating enzyme; enzymatic modification of the glycan to allow conjugation of payloads of interest (Hu et al. Chem Soc Rev 2016:1691); use of microbial transglutaminase to selectively recognize defined positions on the antibody; and additional methods using molecular recognition and/or chemical approaches to affect selective conjugation (Yamada et al. 2019:5592; Park et al. Bioconjugate Chem 2018:3240; Pham et al. Chembiochem 2018:799). Efficacy and safety of immunoconjugates can be increased with site-specific methods as compared to random conjugation.

    [0838] In some embodiments the conjugation of drug moiety, chelator and/or linker to the antibody or antigen binding fragment of the disclosure may be achieved through site-specific conjugation.

    [0839] In some embodiment, transglutaminase may be used to attach the drug moiety, chelator and/or linker to the antibody or antigen binding fragment of the disclosure. Transglutaminases are enzymes that catalyzes the formation of an isopeptide bond between a free amine group on a payload and the acyl group on the side chain of a glutamine residue in an antibody or antigen binding fragment thereof. Transglutaminases are protein-glutamine γ-glutamyltransferases (EC 2.3.2.13), which typically catalyze pH-dependent transamidation of glutamine residues with lysine residues. Examples of transglutaminases include, but are not limited to, microbial transglutaminase (mTG), human transglutaminase, tissue transglutaminase (tTG), and Factor XIII. Examples of human transglutaminases include, but are not limited to, keratinocyte transglutaminase (Uniprot P22735), tissue transglutaminase (UniProt P21980), epidermal transglutaminase and prostate transglutaminase. These enzymes can be from either natural or recombinant sources. Glutamine and lysine amino acids in a peptide or polypeptide can be substrates for transglutaminase crosslinking. For example, the payload can be linked to a linker comprising a lysine.

    [0840] The transglutaminase can be any transglutaminase deemed suitable by those of skill in the art. The transglutaminase can be obtained or made from a variety of sources. In some embodiments, the transglutaminase is a calcium dependent transglutaminase which requires calcium to induce enzyme conformational changes and allow enzyme activity. For example, transglutaminase can be derived from guinea pig liver and obtained through commercial sources (e.g., Sigma-Aldrich (St Louis, Mo.) and MP Biomedicals (Irvine, Calif.)).

    [0841] In some embodiments, the transglutaminase is derived from a fungal protein (e.g., Oomycetes, Actinomycetes, Saccharomyces, Candida, Cryptococcus, Monascus, or Rhizopus transglutaminases). In some embodiments, the transglutaminase polypeptide is derived from Myxomycetes (e.g., Physarum polycephalum transglutaminase). In some embodiments, the mTGase polypeptide is derived from a bacterial protein, such as transglutaminase from, but not limited to, Streptoverticillium mobarensis, Streptoverticillium griseocameum, Streptoverticillium ladakanum, Streptomyces mobarensis, Streptomyces viridis, Streptomyces ladakanum, Streptomyces caniferus, Streptomyces platensis, Streptomyces hygroscopius, Streptomyces netropsis, Streptomyces fradiae, Streptomyces roseovertivillatus, Streptomyces cinnamaoneous, Streptomyces griseocameum, Streptomyces lavendulae, Streptomyces lividans, Streptomyces lydicus, Streptomyces sioyansis, Actinomadura sp., Bacillus (e.g., Bacillus circulans, Bacillus subtilis, etc.), Corynebacterium ammonia genes, Corynebacterium glutamicum, Clostridium, Enterobacter sp., Micrococcus, Providencia sp., or isolates thereof. In some embodiments, the transglutaminase polypeptide is derived from S. mobarensis.

    [0842] Commercially available calcium independent transglutaminase such as ACTIVA (Ajinomoto, Japan) is also suitable for the present invention. In some embodiments, the transglutaminase can also be a recombinant protein produced using recombinant techniques known to persons skilled in the art. In some embodiments, the transglutaminase used in the invention described herein can be a purified protein.

    [0843] In some embodiments, the antibody or antigen binding fragment of the disclosure is conjugated at Gln295, in the CH2 domain, using transglutaminase to generate the ADC, immunoconjugate or radioimmunoconjugate of the disclosure.

    [0844] In some embodiments, the antibody or antigen binding fragment of the disclosure is modified before conjugation with transglutaminase. In some embodiments, the antibody or antigen binding fragment of the disclosure used to produce the ADC, immunoconjugate or radioimmunoconjugate of the disclosure comprises a substitution at position 302 of the heavy chain. Such substitution can be, for example, V302S, V302A, V302I, V302L, V302M, V302T, V302F, and V302Y, preferably the amino acid substitutions V302A and V302S, wherein the amino acid numbering is according to the EU Index of Kabat.

    [0845] In some embodiments, the antibody or antigen binding fragment of the disclosure used to produce the ADC, immunoconjugate or radioimmunoconjugate of the disclosure comprises the amino acid substitution V302A or V302S, optionally Y300L, and further comprises a glutamine substitution at heavy chain position 286, 287, 288, 289, 290, 293 or 294, preferably the amino acid substitution N286Q, A287Q, K288Q, T289Q, K290Q, E293Q or E294Q, wherein the amino acid numbering is according to the EU Index of Kabat.

    [0846] In some embodiments, the antibody or antigen binding fragment of the disclosure used to produce the ADC, immunoconjugate or radioimmunoconjugate of the disclosure comprises the amino acid substitution V302A or V302S and at least one of the amino acid substitutions E293Q and E294Q, wherein the amino acid numbering is according to the EU Index of Kabat.

    [0847] In some embodiments, the antibody or antigen binding fragment of the disclosure used to produce the ADC, immunoconjugate or radioimmunoconjugate of the disclosure comprises the amino acid substitution V302A or V302S and further comprises a glutamine substitution at heavy chain position 286, 287, 288, 289, 290, 293 or 294, such as the amino acid substitution N286Q, A287Q, K288Q, T289Q, K290Q, E293Q or E294Q, and/or an alanine substitution at heavy chain position 241, 243, 294 or 301, such as F241A, F243A, E294A or R301A.

    [0848] In some embodiments, the antibody or antigen binding fragment of the disclosure conjugated with transglutaminase to produce the ADC, immunoconjugate or radioimmunoconjugate of the disclosure is glycosylated or is a glycan intact antibody or its glycan content is unchanged compared to the native antibody. In some embodiments, the antibody or antigen binding fragment of the disclosure conjugated with transglutaminase to produce the ADC, immunoconjugate or radioimmunoconjugate of the disclosure is glycosylated at position N297 or the glycan content of the antibody or antigen binding fragment thereof at position N297 is unchanged compared to the native antibody.

    [0849] In some embodiments, the method of producing the ADC, or radioconjugate of the disclosure comprises reacting a glycosylated or glycan intact antibody or antigen binding fragment of the disclosure with an amine compound in the presence of transglutaminase in low-ionic strength conditions. Low-ionic strength conditions include, but are not limited to, solutions comprising a salt concentration of about 25 mM or less, of about 20 mM or less, of about 15 mM or less, of about 10 mM or less.

    [0850] In some embodiments, the antibody or antigen binding fragment of the disclosure used to produce the ADC, immunoconjugate or radioimmunoconjugate of the disclosure is modified by trimming the antibody or antigen binding fragment thereof with a bacterial endoglycosidase specific for the β-1,4 linkage between a core GlcNac residue in an FEc-glycosylation site of the antibody, such as GlycINATOR (Genovis), which leaves the inner most GlcNAc intact on the Fc, allowing for the site-specific incorporation of azido sugars at that site. The trimmed antibody or antigen binding fragment thereof can then be reacted with an azide-labeled sugar, such as UDP-N-azidoacetylgalactosamine (UDP-GalNAz) or UDP-6-azido 6-deoxy GalNAc, in the presence of a sugar transferase, such as GalT galactosyltransferase or GalNAc transferase, to thereby obtain the modified antibody or antigen binding fragment thereof.

    [0851] In other embodiments, the antibody or antigen binding fragment thereof of the disclosure used for producing the immunoconjugate or radioimmunoconjugate of the disclosure is modified by deglycosylating the antibody or antigen binding fragment thereof with an amidase.

    Click Chemistry

    [0852] In some embodiment, click chemistry may be used to attach the drug moiety, chelator and/or linker to the selected antibody of the disclosure. As used herein, the term “click chemistry” refers to a chemical philosophy introduced by Sharpless, describing chemistry tailored to generate covalent bonds quickly and reliably by joining small units comprising reactive groups together (see Kolb, et al., Angewandte Chemie International Edition (2001) 40: 2004-2021). Click chemistry does not refer to a specific reaction, but to a concept including, but not limited to, reactions that mimic reactions found in nature. In some embodiments, click chemistry reactions are modular, wide in scope, give high chemical yields, generate inert byproducts, are stereospecific, exhibit a large thermodynamic driving force to favor a reaction with a single reaction product, and/or can be carried out under physiological conditions. In some embodiments, a click chemistry reaction can be carried out under simple reaction conditions, uses readily available starting materials and reagents, uses non-toxic solvents or uses a solvent that is benign or easily removed, such as water, and/or provides simple product isolation by non-chromatographic methods, such as crystallization or distillation.

    [0853] Click chemistry reactions utilize reactive groups that are rarely found in naturally-occurring biomolecules and are chemically inert towards biomolecules, but when the click chemistry partners are reacted together, the reaction can take place efficiently under biologically relevant conditions, for example in cell culture conditions, such as in the absence of excess heat and/or harsh reagents. In general, click chemistry reactions require at least two molecules comprising click reaction partners that can react with each other. Such click reaction partners that are reactive with each other are sometimes referred to herein as click chemistry handle pairs, or click chemistry pairs. In some embodiments, the click reaction partners are an azide and a strained alkyne, e.g. cycloalkyne such as a cyclooctyne or cyclooctyne derivative, or any other alkyne. In other embodiments, the click reaction partners are reactive dienes and suitable tetrazine dienophiles. For example, trans-cyclooctene, norbornene, or biscyclononene can be paired with a suitable tetrazine dienophile as a click reaction pair.

    [0854] In yet other embodiments, tetrazoles can act as latent sources of nitrile imines, which can pair with unactivated alkenes in the presence of ultraviolet light to create a click reaction pair, termed a “photo-click” reaction pair.

    [0855] In other embodiments, the click reaction partners are a cysteine and a maleimide. For example the cysteine from a peptide (e.g., GGGC (SEQ ID NO: 338)) can be reacted with a maleimide that is associated with a chelating agent (e.g., NOTA). Other suitable click chemistry handles are known to those of skill in the art (see, e.g., Spicer et al., Selective chemical protein modification. Nature Communications. 2014; 5: p. 4740). In other embodiments, the click reaction partners are Staudinger ligation components, such as phosphine and azide. In other embodiments, the click reaction partners are Diels-Alder reaction components, such as dienes (e.g., tetrazine) and alkenes (e.g., trans-cyclooctene (TCO) or norbornene). Exemplary click reaction partners are described in US20130266512 and in WO2015073746, the relevant description on click reaction partners in both of which are incorporated by reference herein.

    [0856] According to preferred embodiments, a click chemistry reaction utilizes an azide group and an alkyne group, more preferably a strained alkyne group, e.g., cycloalkyne such as a cyclooctyne or cyclooctyne derivative, as the click chemistry pair or reaction partners. In such embodiments, the click chemistry reaction is a Huisgen cycloaddition or 1,3-dipolar cycloaddition between the azide (—N.sub.3) and alkyne moiety to form a 1,2,3-triazole linker. Click chemistry reactions between alkynes and azides typically require the addition of a copper catalyst to promote the 1,3-cycloaddition reaction, and are known as copper-catalyzed azide-alkyne cycloaddition (CuAAC) reactions. However, click chemistry reactions between cyclooctyne or cyclooctyne derivatives and azides typically do not require the addition of a copper catalyst, and instead proceed via strain-promoted azide-alkyne cycloaddition (SPAAC) (Debets, M. F., et al., Bioconjugation with strained alkenes and alkynes. Acc Chem Res, 2011. 44(9): p. 805-15). A radioimmunoconjugate can be produced by first preparing an immunoconjugate of the invention by covalently linking a chelator of the invention to an antibody or antigen-binding fragment thereof by, for example, a click chemistry reaction; the immunoconjugate can subsequently be labeled with a radiometal ion to produce a radioimmunoconjugate.

    [0857] Radioimmunoconjugates produced by the methods described herein can be analyzed using methods known to those skilled in the art in view of the present disclosure. For example, LC/MS analysis can be used to determine the ratio of the chelator to the labeled polypeptide, e.g., antibody or antigen binding fragment thereof; analytical size-exclusion chromatography can be used to determine the oligomeric state of the polypeptides and polypeptide conjugates, e.g., antibody and antibody conjugates; radiochemical yield can be determined by instant thin layer chromatography (e.g., iTLC-SG), and radiochemical purity can be determined by size-exclusion HPLC.

    DAR Distribution

    [0858] The term “drug-to-antibody ratio (DAR)” or “chelator antibody ratio (CAR)” refers, to the number of drug-linker molecules per antibody molecule or the number of chelator molecules per antibody. The DAR can be measured by intact mass analysis using RP-HPLC with online mass analysis. According to certain embodiments, the average DAR of a conjugate intermediate of the disclosure is from about 1 to about 10, or from 1 to about 9, or from 1 to about 8, of from about 1 to about 7, or from about 1 to about 6, or from about 1 to about 5, or from about 1 to about 4, or from about 1 to about 3, or from about 2 to about 4, or from about 2 to about 3.

    [0859] In some embodiments a conjugate preparation may be substantially homogeneous with respect to its DAR distribution, meaning that within the preparation is a predominant species of site-specific ADC with a particular DAR that is also uniform with respect to the site of loading (i.e., on the free cysteines). In certain embodiments it is possible to achieve the desired homogeneity through the use of site-specific antibodies or selective combination. In other embodiments the desired homogeneity may be achieved through the use of site-specific constructs in combination with selective reduction. In yet other embodiments, the preparations may be further purified using analytical or preparative chromatography techniques. In each of these embodiments the homogeneity of the ADC sample can be analyzed using various techniques known in the art including but not limited to SDS-PAGE, HPLC (e.g. size exclusion HPLC, RP-HPLC, HIC-HPLC etc.) or capillary electrophoresis.

    [0860] In some embodiments, the anti-PSMA antibody or antigen binding fragment thereof is conjugated to a radiometal complex with a DAR of 4. In some embodiments, the anti-PSMA antibody or antigen binding fragment thereof if conjugated to a radiometal complex with a DAR of 8.

    Radioconjugates and ADCs of the Disclosure

    [0861] Any of the anti-PSMA antibodies, antigen binding fragment thereof, chelators or radiometal complexes of the disclosure such as those described herein, can be used to produce the radioimmunoconjugates or ADCs of the disclosure.

    [0862] In some embodiments, the radioconjugate or ADC comprises an antibody, or an antigen binding domain, which specifically binds to PSMA.

    [0863] In some embodiments, the radioconjugate or ADC comprises an antibody, or an antigen binding domain, that specifically binds to PSMA and which comprises (a) a heavy chain variable region (VH) comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:4, a VH CDR2 having an amino acid sequence of and SEQ ID NO:5 and a VH CDR3 having an amino acid sequence of SEQ ID NO:6; and (b) a light chain variable region (VL) comprising a VL CDR1 having an amino acid sequence of SEQ ID NO:7, a VL CDR2 having an amino acid sequence of and SEQ ID NO:8 and a VL CDR3 having an amino acid sequence of SEQ ID NO:9.

    [0864] In some embodiments, the radioconjugate or ADC comprises an antibody, or an antigen binding domain, that specifically binds to PSMA and which comprises a heavy chain variable region (VH) having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 52, and/or a light chain variable region (VL) having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 53.

    [0865] In some embodiments, the radioconjugate or ADC comprises an antibody, or an antigen binding domain, that specifically binds to PSMA and which comprises a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 52, and/or a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 53.

    [0866] In some embodiments, the radioconjugate or ADC comprises an antibody, or an antigen binding domain, that specifically binds to PSMA and which comprises a heavy chain constant region having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 84, and/or a light chain constant region having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 85.

    [0867] In some embodiments, the radioconjugate or ADC comprises an antibody, or an antigen binding domain, that specifically binds to PSMA and which comprises a heavy chain constant region comprising the amino acid sequence of SEQ ID NO: 84, and/or a light chain constant region comprising the amino acid sequence of SEQ ID NO: 85.

    [0868] In some embodiments, the radioconjugate or ADC comprises an antibody, or an antigen binding domain, that specifically binds to PSMA and which comprises a heavy chain constant region having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 86, and/or a light chain constant region having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 85.

    [0869] In some embodiments, the radioconjugate or ADC comprises an antibody, or an antigen binding domain, that specifically binds to PSMA and which comprises a heavy chain constant region comprising the amino acid sequence of SEQ ID NO: 86, and/or a light chain constant region comprising the amino acid sequence of SEQ ID NO: 85.

    [0870] In some embodiments, the radioconjugate or ADC comprises an antibody, or an antigen binding domain, that specifically binds to PSMA and which comprises (a) a heavy chain variable region (VH) comprising a VH CDR1 having an amino acid sequence of SEQ ID NO: 10, a VH CDR2 having an amino acid sequence of and SEQ ID NO: 11 and a VH CDR3 having an amino acid sequence of SEQ ID NO: 12; and (b) a light chain variable region (VL) comprising a VL CDR1 having an amino acid sequence of SEQ ID NO: 13, a VL CDR2 having an amino acid sequence of and SEQ ID NO: 14 and a VL CDR3 having an amino acid sequence of SEQ ID NO:15.

    [0871] In some embodiments, the radioconjugate or ADC comprises an antibody, or an antigen binding domain, that specifically binds to PSMA and which comprises a heavy chain variable region (VH) having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 54, and/or a light chain variable region (VL) having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 55.

    [0872] In some embodiments, the radioconjugate or ADC comprises an antibody, or an antigen binding domain, that specifically binds to PSMA and which comprises a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 54, and/or a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 55.

    [0873] In some embodiments, the radioconjugate or ADC comprises an antibody, or an antigen binding domain, that specifically binds to PSMA and which comprises a heavy chain constant region having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 88, and/or a light chain constant region having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 89.

    [0874] In some embodiments, the radioconjugate or ADC comprises an antibody, or an antigen binding domain, that specifically binds to PSMA and which comprises a heavy chain constant region comprising the amino acid sequence of SEQ ID NO: 88, and/or a light chain constant region comprising the amino acid sequence of SEQ ID NO: 89.

    [0875] In some embodiments, the radioconjugate or ADC comprises an antibody, or an antigen binding domain, that specifically binds to PSMA and which comprises a heavy chain constant region having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 90, and/or a light chain constant region having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 89.

    [0876] In some embodiments, the radioconjugate or ADC comprises an antibody, or an antigen binding domain, that specifically binds to PSMA and which comprises a heavy chain constant region comprising the amino acid sequence of SEQ ID NO: 90, and/or a light chain constant region comprising the amino acid sequence of SEQ ID NO: 89.

    [0877] In some embodiments, the radioconjugate comprises an antibody, such as the PSMA antibody or antigen binding fragment thereof of the disclosure, conjugated to a radiometal complex comprising a chelator and a radiometal. In some embodiments, the PSMA antibody or antigen binding fragment thereof is covalently bound to the chelator. In some embodiments, the radiometal complex comprises a linker.

    [0878] In some embodiments the radiometal ion is actinium-225 (.sup.225Ac).

    [0879] In some embodiments the radiometal ion is Cerium 134 (.sup.134Ce).

    [0880] In some embodiments the radiometal ion is Indium 111 (.sup.111In).

    [0881] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody or antigen binding fragment thereof which comprises:

    [0882] (a) a heavy chain variable region (VH) comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:4, a VH CDR2 having an amino acid sequence of and SEQ ID NO:5 and a VH CDR3 having an amino acid sequence of SEQ ID NO:6;

    [0883] (b) a light chain variable region (VL) comprising a VL CDR1 having an amino acid sequence of SEQ ID NO:7, a VL CDR2 having an amino acid sequence of and SEQ ID NO:8 and a VL CDR3 having an amino acid sequence of SEQ ID NO:9; and

    [0884] (c) an alpha-emitting radiometal ion coordinated to a chelator moiety, wherein the alpha-emitting radiometal ion is .sup.225Ac.

    [0885] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody which comprises a heavy chain variable region (VH) having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 52, a light chain variable region (VL) having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 53; and

    [0886] an alpha-emitting radiometal ion coordinated to a chelator moiety, wherein the alpha-emitting radiometal ion is .sup.225Ac.

    [0887] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody which comprises a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 52, a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 53; and an alpha-emitting radiometal ion coordinated to a chelator moiety, wherein the alpha-emitting radiometal ion is .sup.225Ac.

    [0888] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody which comprises a heavy chain constant region having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 84, a light chain constant region having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 85; and

    [0889] an alpha-emitting radiometal ion coordinated to a chelator moiety, wherein the alpha-emitting radiometal ion is .sup.225Ac.

    [0890] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody which comprises a heavy chain constant region comprising the amino acid sequence of SEQ ID NO: 84, a light chain constant region comprising the amino acid sequence of SEQ ID NO: 85; and an alpha-emitting radiometal ion coordinated to a chelator moiety, wherein the alpha-emitting radiometal ion is .sup.225Ac.

    [0891] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody or antigen binding fragment thereof which comprises:

    [0892] (a) a heavy chain variable region (VH) comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:10, a VH CDR2 having an amino acid sequence of and SEQ ID NO:11 and a VH CDR3 having an amino acid sequence of SEQ ID NO: 12;

    [0893] (b) a light chain variable region (VL) comprising a VL CDR1 having an amino acid sequence of SEQ ID NO: 13, a VL CDR2 having an amino acid sequence of and SEQ ID NO: 14 and a VL CDR3 having an amino acid sequence of SEQ ID NO: 15; and

    [0894] (c) an alpha-emitting radiometal ion coordinated to a chelator moiety, wherein the alpha-emitting radiometal ion is .sup.225Ac.

    [0895] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody which comprises a heavy chain variable region (VH) having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 54, a light chain variable region (VL) having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 55; and

    [0896] an alpha-emitting radiometal ion coordinated to a chelator moiety, wherein the alpha-emitting radiometal ion is .sup.225Ac.

    [0897] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody which comprises a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 54, a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 55; and an alpha-emitting radiometal ion coordinated to a chelator moiety, wherein the alpha-emitting radiometal ion is .sup.225Ac.

    [0898] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody which comprises a heavy chain constant region having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 88, a light chain constant region having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 89; and

    [0899] an alpha-emitting radiometal ion coordinated to a chelator moiety, wherein the alpha-emitting radiometal ion is .sup.225Ac.

    [0900] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody which comprises a heavy chain constant region comprising the amino acid sequence of SEQ ID NO: 88, a light chain constant region comprising the amino acid sequence of SEQ ID NO: 89; and an alpha-emitting radiometal ion coordinated to a chelator moiety, wherein the alpha-emitting radiometal ion is .sup.225Ac.

    [0901] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody which comprises a heavy chain constant region having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 86, a light chain constant region having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 85; and

    [0902] an alpha-emitting radiometal ion coordinated to a chelator moiety, wherein the alpha-emitting radiometal ion is .sup.225Ac.

    [0903] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody which comprises a heavy chain constant region comprising the amino acid sequence of SEQ ID NO: 86, a light chain constant region comprising the amino acid sequence of SEQ ID NO: 85; and an alpha-emitting radiometal ion coordinated to a chelator moiety, wherein the alpha-emitting radiometal ion is .sup.225Ac.

    [0904] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody which comprises a heavy chain constant region having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 90, a light chain constant region having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 89; and

    [0905] an alpha-emitting radiometal ion coordinated to a chelator moiety, wherein the alpha-emitting radiometal ion is .sup.225Ac.

    [0906] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody which comprises a heavy chain constant region comprising the amino acid sequence of SEQ ID NO: 90, a light chain constant region comprising the amino acid sequence of SEQ ID NO: 89; and an alpha-emitting radiometal ion coordinated to a chelator moiety, wherein the alpha-emitting radiometal ion is .sup.225Ac.

    [0907] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody or antigen binding fragment thereof which comprises

    [0908] (a) a heavy chain variable region (VH) comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:4, a VH CDR2 having an amino acid sequence of and SEQ ID NO:5 and a VH CDR3 having an amino acid sequence of SEQ ID NO:6;

    [0909] (b) a light chain variable region (VL) comprising a VL CDR1 having an amino acid sequence of SEQ ID NO:7, a VL CDR2 having an amino acid sequence of and SEQ ID NO:8 and a VL CDR3 having an amino acid sequence of SEQ ID NO:9; and

    [0910] (c) a radiometal ion coordinated to a chelator moiety, wherein radiometal ion is .sup.111In.

    [0911] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody which comprises a heavy chain variable region (VH) having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 52, a light chain variable region (VL) having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 53 and

    [0912] a radiometal ion coordinated to a chelator moiety, wherein radiometal ion is .sup.111In.

    [0913] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody which comprises a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 52, a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 53 and a radiometal ion coordinated to a chelator moiety, wherein radiometal ion is .sup.111In.

    [0914] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody which comprises a heavy chain constant region having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 84, a light chain constant region having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 85 and a radiometal ion coordinated to a chelator moiety, wherein radiometal ion is .sup.111In.

    [0915] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody which comprises a heavy chain constant region comprising the amino acid sequence of SEQ ID NO: 84, a light chain constant region comprising the amino acid sequence of SEQ ID NO: 85 and a radiometal ion coordinated to a chelator moiety, wherein radiometal ion is .sup.111In.

    [0916] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody which comprises a heavy chain constant region having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 86, a light chain constant region having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 85 and a radiometal ion coordinated to a chelator moiety, wherein radiometal ion is .sup.111In.

    [0917] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody which comprises a heavy chain constant region comprising the amino acid sequence of SEQ ID NO: 86, a light chain constant region comprising the amino acid sequence of SEQ ID NO: 85 and a radiometal ion coordinated to a chelator moiety, wherein radiometal ion is .sup.111In.

    [0918] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody or antigen binding fragment thereof which comprises

    [0919] (a) a heavy chain variable region (VH) comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:10, a VH CDR2 having an amino acid sequence of and SEQ ID NO:11 and a VH CDR3 having an amino acid sequence of SEQ ID NO: 12;

    [0920] (b) a light chain variable region (VL) comprising a VL CDR1 having an amino acid sequence of SEQ ID NO:13, a VL CDR2 having an amino acid sequence of and SEQ ID NO:14 and a VL CDR3 having an amino acid sequence of SEQ ID NO: 15; and

    [0921] (c) a radiometal ion coordinated to a chelator moiety, wherein radiometal ion is .sup.111In.

    [0922] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody which comprises a heavy chain variable region (VH) having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 54, a light chain variable region (VL) having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 55 and

    [0923] a radiometal ion coordinated to a chelator moiety, wherein radiometal ion is .sup.111In.

    [0924] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody which comprises a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 54, a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 55 and a radiometal ion coordinated to a chelator moiety, wherein radiometal ion is .sup.111In.

    [0925] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody which comprises a heavy chain constant region having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 88, a light chain constant region having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 89 and a radiometal ion coordinated to a chelator moiety, wherein radiometal ion is .sup.111In.

    [0926] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody which comprises a heavy chain constant region comprising the amino acid sequence of SEQ ID NO: 88, a light chain constant region comprising the amino acid sequence of SEQ ID NO: 89 and a radiometal ion coordinated to a chelator moiety, wherein radiometal ion is .sup.111In.

    [0927] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody which comprises a heavy chain constant region having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 90, a light chain constant region having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 89 and a radiometal ion coordinated to a chelator moiety, wherein radiometal ion is .sup.111In.

    [0928] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody which comprises a heavy chain constant region comprising the amino acid sequence of SEQ ID NO: 90, a light chain constant region comprising the amino acid sequence of SEQ ID NO: 89 and a radiometal ion coordinated to a chelator moiety, wherein radiometal ion is .sup.111In.

    [0929] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody or antigen binding fragment thereof which comprises

    [0930] (a) a heavy chain variable region (VH) comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:4, a VH CDR2 having an amino acid sequence of and SEQ ID NO:5 and a VH CDR3 having an amino acid sequence of SEQ ID NO:6;

    [0931] (b) a light chain variable region (VL) comprising a VL CDR1 having an amino acid sequence of SEQ ID NO:7, a VL CDR2 having an amino acid sequence of and SEQ ID NO:8 and a VL CDR3 having an amino acid sequence of SEQ ID NO:9; and

    [0932] (c) a radiometal ion coordinated to a chelator moiety, wherein radiometal ion is .sup.134Ce.

    [0933] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody which comprises a heavy chain variable region (VH) having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 52, a light chain variable region (VL) having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 53 and a radiometal ion coordinated to a chelator moiety, wherein radiometal ion is .sup.134Ce.

    [0934] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody which comprises a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 52, a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 53 and a radiometal ion coordinated to a chelator moiety, wherein radiometal ion is .sup.134Ce.

    [0935] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody which comprises a heavy chain constant region having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 84, a light chain constant region having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 85 and a radiometal ion coordinated to a chelator moiety, wherein radiometal ion is .sup.134Ce.

    [0936] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody which comprises a heavy chain constant region comprising the amino acid sequence of SEQ ID NO: 84, a light chain constant region comprising the amino acid sequence of SEQ ID NO: 85 and a radiometal ion coordinated to a chelator moiety, wherein radiometal ion is .sup.134Ce.

    [0937] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody which comprises a heavy chain constant region having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 86, a light chain constant region having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 85 and a radiometal ion coordinated to a chelator moiety, wherein radiometal ion is .sup.134Ce.

    [0938] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody which comprises a heavy chain constant region comprising the amino acid sequence of SEQ ID NO: 86, a light chain constant region comprising the amino acid sequence of SEQ ID NO: 85 and a radiometal ion coordinated to a chelator moiety, wherein radiometal ion is .sup.134Ce.

    [0939] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody which comprises a heavy chain constant region having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 90, a light chain constant region having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 89 and a radiometal ion coordinated to a chelator moiety, wherein radiometal ion is .sup.134Ce.

    [0940] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody which comprises a heavy chain constant region comprising the amino acid sequence of SEQ ID NO: 90, a light chain constant region comprising the amino acid sequence of SEQ ID NO: 89 and a radiometal ion coordinated to a chelator moiety, wherein radiometal ion is .sup.134Ce.

    [0941] In some embodiments, the chelator is any of the chelator of the disclosure.

    [0942] In some embodiments, the chelator is p-SCN-Bn-DOTA (S-2-(4-Isothiocyanatobenzyl)-1,4,7,10-tetraazacyclododecane tetraacetic acid) of formula

    ##STR00041##

    [0943] or a pharmaceutically acceptable salt thereof.

    [0944] In some embodiments, the chelator is TOPA-[C7]-phenylisothiocyanate of formula:

    ##STR00042##

    [0945] or a pharmaceutically acceptable salt thereof.

    [0946] In some embodiments, the radioconjugate of the disclosure comprises

    [0947] (a) an anti-PSMA antibody or antigen binding fragment thereof which comprises a heavy chain variable region (VH) comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:4, a VH CDR2 having an amino acid sequence of and SEQ ID NO:5 and a VH CDR3 having an amino acid sequence of SEQ ID NO:6; a light chain variable region (VL) comprising a VL CDR1 having an amino acid sequence of SEQ ID NO:7, a VL CDR2 having an amino acid sequence of and SEQ ID NO:8 and a VL CDR3 having an amino acid sequence of SEQ ID NO:9; and

    [0948] (b) a radiometal ion used as an imaging agent coordinated to a chelator moiety, wherein the radiometal ion is .sup.111In and the chelator is p-SCN-Bn-DOTA (S-2-(4-Isothiocyanatobenzyl)-1,4,7,10-tetraazacyclododecane tetraacetic acid) of formula

    ##STR00043##

    [0949] or a pharmaceutically acceptable salt thereof.

    [0950] In some embodiments, the radioconjugate of the disclosure comprises:

    [0951] an anti-PSMA antibody which comprises a heavy chain variable region (VH) having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 52, a light chain variable region (VL) having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 53; and

    [0952] a radiometal ion used as an imaging agent coordinated to a chelator moiety, wherein the radiometal ion is .sup.111In and the chelator is p-SCN-Bn-DOTA (S-2-(4-Isothiocyanatobenzyl)-1,4,7,10-tetraazacyclododecane tetraacetic acid) of formula IV or a pharmaceutically acceptable salt thereof.

    [0953] In some embodiments, the radioconjugate of the disclosure comprises

    [0954] an anti-PSMA antibody which comprises a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 52, a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 53; and

    [0955] a radiometal ion used as an imaging agent coordinated to a chelator moiety, wherein the radiometal ion is .sup.111In and the chelator is p-SCN-Bn-DOTA (S-2-(4-Isothiocyanatobenzyl)-1,4,7,10-tetraazacyclododecane tetraacetic acid) of formula IV or a pharmaceutically acceptable salt thereof.

    [0956] In some embodiments, the radioconjugate of the disclosure comprises:

    [0957] an anti-PSMA antibody which comprises a heavy chain constant region having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 84, a light chain constant region having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 85; and

    [0958] a radiometal ion used as an imaging agent coordinated to a chelator moiety, wherein the radiometal ion is .sup.111In and the chelator is p-SCN-Bn-DOTA (S-2-(4-Isothiocyanatobenzyl)-1,4,7,10-tetraazacyclododecane tetraacetic acid) of formula IV or a pharmaceutically acceptable salt thereof.

    [0959] In some embodiments, the radioconjugate of the disclosure comprises:

    [0960] an anti-PSMA antibody which comprises a heavy chain constant region comprising the amino acid sequence of SEQ ID NO: 84, a light chain constant region comprising the amino acid sequence of SEQ ID NO: 85; and

    [0961] a radiometal ion used as an imaging agent coordinated to a chelator moiety, wherein the radiometal ion is .sup.111In and the chelator is p-SCN-Bn-DOTA (S-2-(4-Isothiocyanatobenzyl)-1,4,7,10-tetraazacyclododecane tetraacetic acid) of formula:

    ##STR00044##

    [0962] or a pharmaceutically acceptable salt thereof.

    [0963] In some embodiments, the radioconjugate of the disclosure comprises:

    [0964] (a) an anti-PSMA antibody or antigen binding fragment thereof which comprises a heavy chain variable region (VH) comprising a VH CDR1 having an amino acid sequence of SEQ ID NO: 10, a VH CDR2 having an amino acid sequence of and SEQ ID NO: 11 and a VH CDR3 having an amino acid sequence of SEQ ID NO: 12; a light chain variable region (VL) comprising a VL CDR1 having an amino acid sequence of SEQ ID NO: 13, a VL CDR2 having an amino acid sequence of and SEQ ID NO: 14 and a VL CDR3 having an amino acid sequence of SEQ ID NO:15;

    [0965] (b) a radiometal ion used as an imaging agent coordinated to a chelator moiety, wherein the radiometal ion is .sup.111In and the chelator is p-SCN-Bn-DOTA (S-2-(4-Isothiocyanatobenzyl)-1,4,7,10-tetraazacyclododecane tetraacetic acid) of formula

    ##STR00045##

    [0966] or a pharmaceutically acceptable salt thereof.

    [0967] In some embodiments, the radioconjugate of the disclosure comprises:

    [0968] an anti-PSMA antibody which comprises a heavy chain variable region (VH) having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 54, a light chain variable region (VL) having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 55; and

    [0969] a radiometal ion used as an imaging agent coordinated to a chelator moiety, wherein the radiometal ion is .sup.111In and the chelator is p-SCN-Bn-DOTA (S-2-(4-Isothiocyanatobenzyl)-1,4,7,10-tetraazacyclododecane tetraacetic acid) of formula

    ##STR00046##

    [0970] or a pharmaceutically acceptable salt thereof.

    [0971] In some embodiments, the radioconjugate of the disclosure comprises:

    [0972] an anti-PSMA antibody which comprises a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 54, a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 55; and

    [0973] a radiometal ion used as an imaging agent coordinated to a chelator moiety, wherein the radiometal ion is .sup.111In and the chelator is p-SCN-Bn-DOTA (S-2-(4-Isothiocyanatobenzyl)-1,4,7,10-tetraazacyclododecane tetraacetic acid) of formula IV or a pharmaceutically acceptable salt thereof.

    [0974] In some embodiments, the radioconjugate of the disclosure comprises:

    [0975] anti-PSMA antibody which comprises a heavy chain constant region having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 88, a light chain constant region having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 89; and

    [0976] a radiometal ion used as an imaging agent coordinated to a chelator moiety, wherein the radiometal ion is .sup.111In and the chelator is p-SCN-Bn-DOTA (S-2-(4-Isothiocyanatobenzyl)-1,4,7,10-tetraazacyclododecane tetraacetic acid) of formula IV or a pharmaceutically acceptable salt thereof.

    [0977] In some embodiments, the radioconjugate of the disclosure comprises

    [0978] (a) an anti-PSMA antibody which comprises a heavy chain constant region comprising the amino acid sequence of SEQ ID NO: 88, a light chain constant region comprising the amino acid sequence of SEQ ID NO: 89; and

    [0979] (b) a radiometal ion used as an imaging agent coordinated to a chelator moiety, wherein the radiometal ion is .sup.111In and the chelator is p-SCN-Bn-DOTA (S-2-(4-Isothiocyanatobenzyl)-1,4,7,10-tetraazacyclododecane tetraacetic acid) of formula IV or a pharmaceutically acceptable salt thereof.

    [0980] In some embodiment, the disclosure provides a radioimmunoconjugate having the following structure:

    ##STR00047##

    [0981] (also referred to herein as TOPA-[C7]-phenylthiourea—Antibody Conjugate),

    [0982] wherein M.sup.+ is actinium-225(.sup.225Ac), and

    [0983] wherein the mAb has binding specificity for PSMA.

    [0984] In some embodiment, the disclosure provides a radioimmunoconjugate having the following structure:

    ##STR00048##

    (also referred to herein as TOPA-[C7]-phenylthiourea-PSMA Antibody Conjugate),

    [0985] wherein M.sup.+ is actinium-225(.sup.225Ac), and

    [0986] wherein the mAb has binding specificity for PSMA; for example,

    [0987] (i) wherein the mAb is an PSMB1154 antibody comprising a heavy chain (HC) variable region comprising the amino acid sequences of SEQ ID NO: 4 and SEQ ID NO: 5 and SEQ ID NO: 6 and a light chain (LC) variable region comprising the amino acid sequences of SEQ ID NO: 7 and SEQ ID NO: 8 and SEQ ID NO: 9; and/or

    [0988] (ii) wherein the mAb comprises a heavy chain variable region (VH) having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98%, or 100% sequence identity to the amino acid sequence of SEQ ID NO: 52, and/or a light chain variable region (VL) having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98%, or 100% sequence identity to the amino acid sequence of SEQ ID NO: 53.

    [0989] In some embodiments, the disclosure provides a radioimmunoconjugate having the following structure:

    ##STR00049##

    [0990] (i) wherein the mAb is an PSMB1154 antibody comprising a heavy chain (HC) variable region comprising the amino acid sequences of SEQ ID NO: 4 and SEQ ID NO: 5 and SEQ ID NO: 6 and a light chain (LC) variable region comprising the amino acid sequences of SEQ ID NO: 7 and SEQ ID NO: 8 and SEQ ID NO: 9; and/or

    [0991] (ii) wherein the mAb comprises a heavy chain variable region (VH) having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98%, or 100% sequence identity to the amino acid sequence of SEQ ID NO: 52, and/or a light chain variable region (VL) having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98%, or 100% sequence identity to the amino acid sequence of SEQ ID NO: 53.

    [0992] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody or antigen binding fragment thereof which comprises

    [0993] (a) a heavy chain variable region (VH) comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:4, a VH CDR2 having an amino acid sequence of and SEQ ID NO:5 and a VH CDR3 having an amino acid sequence of SEQ ID NO:6;

    [0994] (b) a light chain variable region (VL) comprising a VL CDR1 having an amino acid sequence of SEQ ID NO:7, a VL CDR2 having an amino acid sequence of and SEQ ID NO:8 and a VL CDR3 having an amino acid sequence of SEQ ID NO:9;

    [0995] (c) an alpha-emitting radiometal ion coordinated to a chelator moiety, wherein the alpha-emitting radiometal ion is .sup.225Ac and the chelator is a compound of formula:

    ##STR00050##

    [0996] or a pharmaceutically acceptable salt thereof.

    [0997] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody which comprises a heavy chain variable region (VH) having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 52, a light chain variable region (VL) having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 53; and

    [0998] an alpha-emitting radiometal ion coordinated to a chelator moiety, wherein the alpha-emitting radiometal ion is .sup.225Ac and the chelator is a compound of formula:

    ##STR00051##

    [0999] or a pharmaceutically acceptable salt thereof.

    [1000] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody which comprises a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 52, a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 53; and an alpha-emitting radiometal ion coordinated to a chelator moiety, wherein the alpha-emitting radiometal ion is 225Ac and the chelator is a compound of formula:

    ##STR00052##

    [1001] or a pharmaceutically acceptable salt thereof.

    [1002] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody which comprises a heavy chain constant region having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 84, a light chain constant region having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 85; and

    [1003] an alpha-emitting radiometal ion coordinated to a chelator moiety, wherein the alpha-emitting radiometal ion is .sup.225Ac and the chelator is a compound of formula:

    ##STR00053##

    [1004] or a pharmaceutically acceptable salt thereof.

    [1005] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody which comprises a heavy chain constant region comprising the amino acid sequence of SEQ ID NO: 84, a light chain constant region comprising the amino acid sequence of SEQ ID NO: 85; and an alpha-emitting radiometal ion coordinated to a chelator moiety, wherein the alpha-emitting radiometal ion is .sup.225Ac and the chelator is a compound of formula:

    ##STR00054##

    [1006] or a pharmaceutically acceptable salt thereof.

    [1007] In some embodiments, the disclosure provides a radioimmunoconjugate having the following structure:

    ##STR00055##

    (also referred to herein as TOPA-[C7]-phenylthiourea-PSMA Antibody Conjugate),

    [1008] wherein M.sup.+ is actinium-225(.sup.225Ac), and

    [1009] wherein the mAb has binding specificity for PSMA; for example,

    [1010] (i) wherein the mAb is an PSMB1183 antibody comprising a heavy chain (HC) variable region comprising the amino acid sequences of SEQ ID NO: 10 and SEQ ID NO: 11 and SEQ ID NO: 12 and a light chain (LC) variable region comprising the amino acid sequences of SEQ ID NO: 13 and SEQ ID NO: 14 and SEQ ID NO: 15; and/or

    [1011] (ii) wherein the mAb comprises a heavy chain variable region (VH) having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98%, or 100% sequence identity to the amino acid sequence of SEQ ID NO: 54, and/or a light chain variable region (VL) having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98%, or 100% sequence identity to the amino acid sequence of SEQ ID NO: 55.

    [1012] An embodiment of the present invention provides a radioimmunoconjugate having the following structure:

    ##STR00056##

    [1013] (i) wherein the mAb is an PSMB1183 antibody comprising a heavy chain (HC) variable region comprising the amino acid sequences of SEQ ID NO: 10 and SEQ ID NO: 11 and SEQ ID NO: 12 and a light chain (LC) variable region comprising the amino acid sequences of SEQ ID NO: 13 and SEQ ID NO: 14 and SEQ ID NO: 15; and/or

    [1014] (ii) wherein the mAb comprises a heavy chain variable region (VH) having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98%, or 100% sequence identity to the amino acid sequence of SEQ ID NO: 54, and/or a light chain variable region (VL) having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98%, or 100% sequence identity to the amino acid sequence of SEQ ID NO: 55.

    [1015] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody or antigen binding fragment thereof which comprises:

    [1016] (a) a heavy chain variable region (VH) comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:10, a VH CDR2 having an amino acid sequence of and SEQ ID NO:11 and a VH CDR3 having an amino acid sequence of SEQ ID NO: 12;

    [1017] (b) a light chain variable region (VL) comprising a VL CDR1 having an amino acid sequence of SEQ ID NO:13, a VL CDR2 having an amino acid sequence of and SEQ ID NO:14 and a VL CDR3 having an amino acid sequence of SEQ ID NO: 15; and

    [1018] (c) an alpha-emitting radiometal ion coordinated to a chelator moiety, wherein the alpha-emitting radiometal ion is .sup.225Ac and the chelator is a compound of formula:

    ##STR00057##

    [1019] or a pharmaceutically acceptable salt thereof.

    [1020] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody which comprises a heavy chain variable region (VH) having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 54, a light chain variable region (VL) having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 55; and

    [1021] an alpha-emitting radiometal ion coordinated to a chelator moiety, wherein the alpha-emitting radiometal ion is .sup.225Ac and the chelator is a compound of formula:

    ##STR00058##

    or a pharmaceutically acceptable salt thereof.

    [1022] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody which comprises a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 54, a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 55; and an alpha-emitting radiometal ion coordinated to a chelator moiety, wherein the alpha-emitting radiometal ion is .sup.225Ac and the chelator is a compound of formula:

    ##STR00059##

    [1023] or a pharmaceutically acceptable salt thereof.

    [1024] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody which comprises a heavy chain constant region having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 88, a light chain constant region having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 89; and

    [1025] an alpha-emitting radiometal ion coordinated to a chelator moiety, wherein the alpha-emitting radiometal ion is .sup.225Ac and the chelator is a compound of formula:

    ##STR00060##

    [1026] or a pharmaceutically acceptable salt thereof.

    [1027] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody which comprises a heavy chain constant region comprising the amino acid sequence of SEQ ID NO: 88, a light chain constant region comprising the amino acid sequence of SEQ ID NO: 89; and an alpha-emitting radiometal ion coordinated to a chelator moiety, wherein the alpha-emitting radiometal ion is .sup.225Ac and the chelator is a compound of formula:

    ##STR00061##

    [1028] or a pharmaceutically acceptable salt thereof.

    [1029] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody which comprises a heavy chain constant region having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 86, a light chain constant region having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 85; and

    [1030] an alpha-emitting radiometal ion coordinated to a chelator moiety, wherein the alpha-emitting radiometal ion is .sup.225Ac and the chelator is a compound of formula:

    ##STR00062##

    [1031] or a pharmaceutically acceptable salt thereof.

    [1032] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody which comprises a heavy chain constant region comprising the amino acid sequence of SEQ ID NO: 86, a light chain constant region comprising the amino acid sequence of SEQ ID NO: 85; and an alpha-emitting radiometal ion coordinated to a chelator moiety, wherein the alpha-emitting radiometal ion is .sup.225Ac and the chelator is a compound of formula:

    ##STR00063##

    [1033] or a pharmaceutically acceptable salt thereof.

    [1034] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody which comprises a heavy chain constant region having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 90, a light chain constant region having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 89; and

    [1035] an alpha-emitting radiometal ion coordinated to a chelator moiety, wherein the alpha-emitting radiometal ion is .sup.225Ac and the chelator is a compound of formula:

    ##STR00064##

    [1036] or a pharmaceutically acceptable salt thereof.

    [1037] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody which comprises a heavy chain constant region comprising the amino acid sequence of SEQ ID NO: 90, a light chain constant region comprising the amino acid sequence of SEQ ID NO: 89; and an alpha-emitting radiometal ion coordinated to a chelator moiety, wherein the alpha-emitting radiometal ion is .sup.225Ac and the chelator is a compound of formula:

    ##STR00065##

    [1038] or a pharmaceutically acceptable salt thereof.

    [1039] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody or antigen binding fragment thereof which comprises:

    [1040] (a) a heavy chain variable region (VH) comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:4, a VH CDR2 having an amino acid sequence of and SEQ ID NO:5 and a VH CDR3 having an amino acid sequence of SEQ ID NO:6;

    [1041] (b) a light chain variable region (VL) comprising a VL CDR1 having an amino acid sequence of SEQ ID NO:7, a VL CDR2 having an amino acid sequence of and SEQ ID NO:8 and a VL CDR3 having an amino acid sequence of SEQ ID NO:9;

    [1042] (c) a radiometal ion coordinated to a chelator moiety, wherein radiometal ion is .sup.134Ce; and the chelator is a compound of formula:

    ##STR00066##

    [1043] or a pharmaceutically acceptable salt thereof.

    [1044] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody which comprises a heavy chain variable region (VH) having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 52, a light chain variable region (VL) having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 53 and

    [1045] a radiometal ion coordinated to a chelator moiety, wherein radiometal ion is .sup.134Ce and the chelator is a compound of formula:

    ##STR00067##

    [1046] or a pharmaceutically acceptable salt thereof.

    [1047] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody which comprises a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 52, a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 53 and a radiometal ion coordinated to a chelator moiety, wherein radiometal ion is .sup.134Ce and the chelator is a compound of formula:

    ##STR00068##

    [1048] or a pharmaceutically acceptable salt thereof.

    [1049] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody which comprises a heavy chain constant region having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 86, a light chain constant region having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 85 and a radiometal ion coordinated to a chelator moiety, wherein radiometal ion is .sup.134Ce and the chelator is a compound of formula:

    ##STR00069##

    [1050] or a pharmaceutically acceptable salt thereof.

    [1051] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody which comprises a heavy chain constant region comprising the amino acid sequence of SEQ ID NO: 86, a light chain constant region comprising the amino acid sequence of SEQ ID NO: 85 and a radiometal ion coordinated to a chelator moiety, wherein radiometal ion is .sup.134Ce and the chelator is a compound of formula:

    ##STR00070##

    [1052] or a pharmaceutically acceptable salt thereof.

    [1053] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody which comprises a heavy chain constant region having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 90, a light chain constant region having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 89 and a radiometal ion coordinated to a chelator moiety, wherein radiometal ion is .sup.134Ce and the chelator is a compound of formula:

    ##STR00071##

    [1054] or a pharmaceutically acceptable salt thereof.

    [1055] In some embodiments, the radioconjugate of the disclosure comprises an anti-PSMA antibody which comprises a heavy chain constant region comprising the amino acid sequence of SEQ ID NO: 90, a light chain constant region comprising the amino acid sequence of SEQ ID NO: 89 and a radiometal ion coordinated to a chelator moiety, wherein radiometal ion is .sup.134Ce and the chelator is a compound of formula:

    ##STR00072##

    [1056] or a pharmaceutically acceptable salt thereof.

    Pharmaceutical Composition

    [1057] Also provided is the use of any of the disclosed antibodies, antigen binding fragments thereof, radioconjugates or ADCs of the disclosure for the preparation of a medicament for treating a PSMA positive cancer.

    [1058] Also provided is a pharmaceutical composition comprising the antibody, antigen binding fragment thereof radioconjugates or ADCs of the disclosure and a pharmaceutically acceptable carrier.

    [1059] For therapeutic use, the anti-PSMA antibody, antigen binding fragment thereof, radioconjugates or ADCs of the disclosure may be prepared as pharmaceutical compositions containing an effective amount of the antibody as an active ingredient in a pharmaceutically acceptable carrier.

    [1060] “Carrier” refers to a diluent, adjuvant, excipient, or vehicle with which the antibody of the invention is administered. Such vehicles may be liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. For example, 0.4% saline and 0.3% glycine may be used. These solutions are sterile and generally free of particulate matter. They may be sterilized by conventional, well-known sterilization techniques (e.g., filtration). The compositions may contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions such as pH adjusting and buffering agents, stabilizing, thickening, lubricating and coloring agents, etc. The concentration of the antibodies, antigen binding fragments thereof, radioconjugates or ADCs of the disclosure in such pharmaceutical formulation may vary from less than about 0.5%, usually to at least about 1% to as much as 15 or 20% by weight and may be selected primarily based on required dose, fluid volumes, viscosities, etc., according to the mode of administration selected. Suitable vehicles and formulations, inclusive of other human proteins, e.g., human serum albumin, are described, for example, in e.g., Remington: The Science and Practice of Pharmacy, 21st Edition, Troy, D. B. ed., Lipincott Williams and Wilkins, Philadelphia, Pa. 2006, Part 5, Pharmaceutical Manufacturing pp 691-1092, See especially pp. 958-989.

    [1061] A pharmaceutically acceptable carrier can include a buffer, excipient, stabilizer, or preservative. The term “pharmaceutically acceptable,” as used herein with regard to pharmaceutical compositions, means approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in animals and/or in humans.

    [1062] Examples of pharmaceutically acceptable carriers are solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible, such as salts, buffers, antioxidants, saccharides, aqueous or non-aqueous carriers, preservatives, wetting agents, surfactants or emulsifying agents, or combinations thereof. The amounts of pharmaceutically acceptable carrier(s) in the pharmaceutical compositions may be determined experimentally based on the activities of the carrier(s) and the desired characteristics of the formulation, such as stability and/or minimal oxidation.

    [1063] Pharmaceutical compositions may comprise buffers such as acetic acid, citric acid, formic acid, succinic acid, phosphoric acid, carbonic acid, malic acid, aspartic acid, histidine, boric acid, Tris buffers, HEPPSO, HEPES, neutral buffered saline, phosphate buffered saline and the like; carbohydrates such as glucose, mannose, sucrose or dextrans, mannitol; proteins; polypeptides or amino acids such as glycine; antioxidants; chelating agents such as EDTA or glutathione; adjuvants (e.g., aluminum hydroxide); antibacterial and antifungal agents; and preservatives.

    [1064] Pharmaceutical compositions of the present disclosure can be formulated for a variety of means of parenteral or non-parenteral administration. In one embodiment, the compositions can be formulated for infusion or intravenous administration. Pharmaceutical compositions disclosed herein can be provided, for example, as sterile liquid preparations, e.g., isotonic aqueous solutions, emulsions, suspensions, dispersions, or viscous compositions, which may be buffered to a desirable pH. Formulations suitable for oral administration can include liquid solutions, capsules, sachets, tablets, lozenges, and troches, powders liquid suspensions in an appropriate liquid and emulsions.

    Method of Treatment and Uses

    [1065] Also provided is the use of any of the disclosed antibody, antigen binding fragment thereof, radioconjugates, ADCs or pharmaceutical composition for the treatment of cancer.

    [1066] In some embodiments, the disclosure provides methods of treating a PSMA expressing cancer in a subject with any of the antibody, antigen binding fragment thereof or pharmaceutical composition of the disclosure.

    [1067] In some embodiments, the disclosure provides methods of treating a PSMA expressing cancer in a subject with any of the antibody drug conjugate of the disclosure.

    [1068] In some embodiments, the disclosure provides methods of treating a PSMA expressing cancer in a subject with any of the radioimmunoconjugate of the disclosure.

    [1069] “Treat,” “treating,” or “treatment” of a disease or disorder such as cancer refers to accomplishing one or more of the following: reducing the severity and/or duration of the disorder, delaying the progression of the disorder, slowing the progression of the disorder, inhibiting worsening of symptoms characteristic of the disorder being treated, limiting or preventing recurrence of the disorder in subjects that have previously had the disorder, or limiting or preventing recurrence of symptoms in subjects that were previously symptomatic for the disorder. As used herein, the terms “delaying the progression of” or “slowing the progression of” shall include (a) delaying or slowing the development of one or more symptoms or complications of the disease, condition or disorder; (b) delaying or slowing the development of one or more new/additional symptoms or complications of the disease, condition or disorder; and/or (c) delaying or slowing the progression of the disease, condition or disorder to a later stage or more serious form of said disease, condition or disorder.

    [1070] “Subject” includes any human or nonhuman animal. “Nonhuman animal” includes all vertebrates, e.g., mammals and non-mammals. The term “mammal” as used herein, encompasses any mammal. Examples of mammals include, but are not limited to, non-human primates, cows, horses, sheep, pigs, cats, dogs, mice, rats, rabbits, guinea pigs, monkeys, humans, etc. The terms “subject” and “patient” can be used interchangeably herein. In some embodiments, the subject or patient is human.

    [1071] A “therapeutically effective amount” refers to an amount effective, at doses and for periods of time necessary, to achieve a desired therapeutic result. A therapeutically effective amount may vary depending on factors such as the disease state, age, sex, and weight of the individual.

    [1072] In some embodiments, the medical condition is a PSMA expressing cancer.

    [1073] In some embodiments, the medical condition is a disease or disorder of the prostate. In some embodiments, the disease or disorder is a prostate-related disease or disorder. In some embodiments, the disease or disorder is prostate cancer. In some embodiments, the prostate cancer is a primary prostate cancer. In some embodiments, the prostate cancer is a metastatic prostate cancer. In another embodiment, the prostate cancer is a castration-resistant cancer. In another embodiment, the prostate cancer is a metastatic castration-resistant cancer (mCRPC). In one embodiment, the disease or disorder of the prostate is a prostate intraepithelial neoplasia. In some embodiments, the disease or disorder of the prostate is a prostate tumor. In some embodiments, the prostate tumor is a solid tumor.

    [1074] In certain embodiments, the disease or disorder is a clear cell renal carcinoma. In certain embodiments, the disease or disorder is a renal cell carcinoma (RCC). In some embodiments, the RCC is a kidney clear cell carcinoma. In some embodiments, the RCC is a kidney papillary cell carcinoma. In certain embodiments, the disease or disorder is a metastatic lesion of a RCC. In certain embodiments, the disease or disorder is a bladder cancer. In certain embodiments, the disease or disorder is a breast cancer. In certain embodiments, the disease or disorder is a kidney cancer. In certain embodiments, the disease or disorder is a neovascular disorder. In certain embodiments, the disease or disorder is a cancer characterized by solid tumor growth. In some embodiments, the neovascular disorder is a clear cell renal carcinoma. In certain embodiments, the disease or disorder is a colorectal cancer. In certain embodiments, the disease or disorder is a breast cancer. In certain embodiments, the disease or disorder is a bladder cancer. In certain embodiments, the disease or disorder is a lung cancer. In certain embodiments, the disease or disorder is a pancreatic cancer. In certain embodiments, the disease or disorder is a non-prostate cancers. In certain embodiments, the disease or disorder is a renal cancer. In certain embodiments, the disease or disorder is a urothelial cancer. In certain embodiments, the disease or disorder is a lung cancer. In certain embodiments, the disease or disorder is a colon cancer. In certain embodiments, the disease or disorder is a breast cancer. In certain embodiments, the disease or disorder is a liver adenocarcinoma.

    [1075] The cancer can be a hyperproliferative condition or disorder, a solid tumor, a neovasculature, a soft tissue tumor, or a metastatic lesion. “Cancer” is meant to include all types of cancerous growths or oncogenic processes, metastatic tissues or malignantly transformed cells, tissues, or organs, irrespective of histopathology type or stage of invasiveness. Examples of cancers include solid tumors, hematological malignancies, soft tissue tumors, and metastatic lesions. Exemplary solid tumors include malignancies, e.g., sarcomas, and carcinomas (including adenocarcinomas and squamous cell carcinomas) of the various organ systems, such as those affecting prostate, liver, lung, breast, lymphoid, gastrointestinal (e.g., colon), genitourinary tract (e.g., renal, urothelial cells), prostate and pharynx. Adenocarcinomas include malignancies such as most colon cancers, a rectal cancer, a renal-cell carcinoma, a liver cancer, a non-small cell carcinoma of the lung, a cancer of the small intestine and a cancer of the esophagus. Squamous cell carcinomas include malignancies, e.g., in the lung, esophagus, skin, head and neck region, oral cavity, anus, and cervix.

    [1076] Radioimmunoconjugates carry radiation directly to, for example, cells, etc., targeted by the targeting ligand. Preferably, the radioimmunoconjugates carry alpha-emitting radiometal ions, such as .sup.225Ac. Upon targeting, alpha particles from the alpha-emitting radiometal ions, e.g., .sup.225Ac and daughters thereof, are delivered to the targeted cells and cause a cytotoxic effect thereto, thereby selectively targeting neoplastic cells for radiotherapy and/or treating the neoplastic disease or disorder.

    [1077] In some embodiments, the disclosure provides methods of treating a PSMA expressing cancer in a subject comprising administering to the subject an antibody, or an antigen binding domain that specifically binds to PSMA wherein the antibody, or an antigen binding domain that binds PSMA comprises:

    [1078] a heavy chain variable region (VH) comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:4, a VH CDR2 having an amino acid sequence of and SEQ ID NO:5 and a VH CDR3 having an amino acid sequence of SEQ ID NO:6; and a light chain variable region (VL) comprising a VL CDR1 having an amino acid sequence of SEQ ID NO:7, a VL CDR2 having an amino acid sequence of and SEQ ID NO:8 and a VL CDR3 having an amino acid sequence of SEQ ID NO:9; or

    [1079] a heavy chain variable region (VH) having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 52, and/or a light chain variable region (VL) having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 53.

    [1080] In some embodiments, the disclosure provides methods of treating PSMA expressing cancer comprising administering to the subject an antibody, or an antigen binding domain that specifically binds to PSMA wherein the antibody, or an antigen binding domain that binds PSMA comprises:

    [1081] a heavy chain variable region (VH) comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:10, a VH CDR2 having an amino acid sequence of and SEQ ID NO:11 and a VH CDR3 having an amino acid sequence of SEQ ID NO: 12; and a light chain variable region (VL) comprising a VL CDR1 having an amino acid sequence of SEQ ID NO: 13, a VL CDR2 having an amino acid sequence of and SEQ ID NO: 14 and a VL CDR3 having an amino acid sequence of SEQ ID NO: 15; or

    [1082] a heavy chain variable region (VH) having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 54, and/or a light chain variable region (VL) having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 55.

    [1083] In some embodiments, the disclosure provides methods of treating a PSMA expressing cancer in a subject with a radioimmunoconjugate having the following structure:

    ##STR00073##

    (also referred to herein as TOPA-[C7]-phenylthiourea-PSMB1154 Antibody Conjugate),

    [1084] wherein M.sup.+ is actinium-225(.sup.225Ac), and

    [1085] wherein the mAb has binding specificity for PSMA; for example,

    [1086] (i) wherein the mAb is an PSMB1154 antibody comprising a heavy chain (HC) variable region comprising the amino acid sequences of SEQ ID NO: 4 and SEQ ID NO: 5 and SEQ ID NO: 6 and a light chain (LC) variable region comprising the amino acid sequences of SEQ ID NO: 7 and SEQ ID NO: 8 and SEQ ID NO: 9; and/or

    [1087] (ii) wherein the mAb comprises a heavy chain variable region (VH) having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98%, or 100% sequence identity to the amino acid sequence of SEQ ID NO: 52, and/or a light chain variable region (VL) having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98%, or 100% sequence identity to the amino acid sequence of SEQ ID NO: 53.

    [1088] In some embodiments, the disclosure provides methods of treating a PSMA expressing cancer in a subject with a radioimmunoconjugate having the following structure:

    ##STR00074##

    [1089] (i) wherein the mAb is an PSMB1183 antibody comprising a heavy chain (HC) variable region comprising the amino acid sequences of SEQ ID NO: 10 and SEQ ID NO: 11 and SEQ ID NO: 12 and a light chain (LC) variable region comprising the amino acid sequences of SEQ ID NO: 13 and SEQ ID NO: 14 and SEQ ID NO: 15; and/or

    [1090] (ii) wherein the mAb comprises a heavy chain variable region (VH) having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98%, or 100% sequence identity to the amino acid sequence of SEQ ID NO: 54, and/or a light chain variable region (VL) having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98%, or 100% sequence identity to the amino acid sequence of SEQ ID NO: 55.

    [1091] Also provided are methods of detecting PSMA in a sample comprising obtaining the sample, contacting the sample with the anti-PSMA antibody, the antigen binding fragment thereof or the radioconjugate of the disclosure, and detecting the antibody or radioconjugate bound to PSMA in the sample.

    [1092] The disclosure provides a method of detecting PSMA in a sample, comprising obtaining the sample, contacting the sample with the anti-PSMA antibody, antigen binding fragment thereof or the radioconjugate comprising the anti-PSMA antibody or antigen binding fragment and detecting the antibody bound to PSMA in the sample.

    [1093] The disclosure also provides methods of diagnosing a subject with a PSMA expressing cancer wherein the PSMA expressing cancer. In some embodiments the PSMA expressing cancer is prostate cancer.

    [1094] In some embodiments, the disclosure provides methods of detecting PSMA in a sample or methods of diagnosing a PSMA expressing cancer in a subject comprising administering to the subject:

    [1095] (a) an anti-PSMA antibody or antigen binding fragment thereof which comprises a heavy chain variable region (VH) comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:4, a VH CDR2 having an amino acid sequence of and SEQ ID NO:5 and a VH CDR3 having an amino acid sequence of SEQ ID NO:6; a light chain variable region (VL) comprising a VL CDR1 having an amino acid sequence of SEQ ID NO:7, a VL CDR2 having an amino acid sequence of and SEQ ID NO:8 and a VL CDR3 having an amino acid sequence of SEQ ID NO:9; and

    [1096] (b) a radiometal ion used as an imaging agent coordinated to a chelator moiety, wherein the radiometal ion is .sup.111In and the chelator is 1,4,7,10-tetraazacyclododecane-1,4,7,10,tetraacetic acid (DOTA) or a pharmaceutically acceptable salt thereof.

    [1097] In some embodiments, the disclosure provides methods of detecting PSMA in a sample or methods of diagnosing a PSMA expressing cancer in a subject comprising administering to the subject:

    [1098] (a) an anti-PSMA antibody or antigen binding fragment thereof which comprises

    [1099] a heavy chain variable region (VH) comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:10, a VH CDR2 having an amino acid sequence of and SEQ ID NO:11 and a VH CDR3 having an amino acid sequence of SEQ ID NO: 12; a light chain variable region (VL) comprising a VL CDR1 having an amino acid sequence of SEQ ID NO: 13, a VL CDR2 having an amino acid sequence of and SEQ ID NO: 14 and a VL CDR3 having an amino acid sequence of SEQ ID NO: 15;

    [1100] (b) a radiometal ion used as an imaging agent coordinated to a chelator moiety, wherein the radiometal ion is .sup.111In and the chelator is 1,4,7,10-tetraazacyclododecane-1,4,7,10,tetraacetic acid (DOTA) or a pharmaceutically acceptable salt thereof.

    [1101] In some embodiments, the sample may be derived from urine, blood, serum, plasma, saliva, ascites, circulating cells, circulating tumor cells, cells that are not tissue associated (i.e., free cells), tissues (e.g., surgically resected tumor tissue, biopsies, including fine needle aspiration), histological preparations, and the like.

    [1102] The antibodies, ADCs and radioconjugates of the disclosure may be in a variety of forms. These include for example liquid, semi-solid, and solid dosage forms, but the preferred form depends on the intended mode of administration and therapeutic application. Typical preferred compositions are in the form of injectable or infusible solutions. The preferred mode of administration is parenteral (e.g. intravenous, intramuscular, intraperitoneal, subcutaneous). In a preferred embodiment, the compositions of the invention are administered intravenously as a bolus or by continuous infusion over a period of time. In another preferred embodiment, they are injected by intramuscular, subcutaneous, intra-articular, intrasynovial, intratumoral, peritumoral, intralesional, or perilesional routes, to exert local as well as systemic therapeutic effects.

    [1103] The antibodies, ADCs and radioconjugates of the disclosure may be used in a variety of assays to detect PSMA in the sample. Exemplary assays are western blot analysis, radioimmunoassay, surface plasmon resonance, immunoprecipitation, equilibrium dialysis, immunodiffusion, electrochemiluminescence (ECL) immunoassay, immunohistochemistry, fluorescence-activated cell sorting (FACS), ELISA assay, or radioimaging using SPECT/CT, CAT, CT, or PET/CT.

    Kits

    [1104] Described herein are kits comprising the antibody, antigen binding fragment, radioconjugates, ADCs composition, or the pharmaceutical composition of the disclosure.

    [1105] The terms “kit” and “article of manufacture” are used as synonyms.

    [1106] In some embodiments, the disclosure provides a kit comprising the antibody or antigen binding fragment thereof that binds PSMA.

    [1107] In some embodiments, the disclosure provides a kit comprising the radioconjugates, ADCs or pharmaceutical composition.

    [1108] The kit may be used for therapeutic uses and as diagnostic kits.

    [1109] The kit may be used to detect the presence of PSMA in a sample.

    [1110] In some embodiments, the kit comprises the anti-PSMA antibody or antigen binding fragment of the disclosure and reagents for detecting the PSMA binding protein. In some embodiments, the kit comprises the radioconjugates of the disclosure and reagents for detecting the PSMA binding protein. The kit can include one or more other elements including: instructions for use; other reagents, e.g., a label, a therapeutic agent, or an agent useful for chelating, or otherwise coupling, an antibody to a label or therapeutic agent, or a radioprotective composition; devices or other materials for preparing the antibody for administration; pharmaceutically acceptable carriers; and devices or other materials for administration to a subject.

    [1111] In some embodiments, the kit comprises the disclosed antibody, antigen binding fragment thereof radioconjugates, ADCs or pharmaceutical composition in a container and instructions for use of the kit.

    [1112] In some embodiments, the antibody or antigen binding fragment thereof that binds PSMA in the kit is labeled.

    [1113] In some embodiments, the kit comprises the disclosed antibody, antigen binding fragment thereof, radioconjugates, ADCs or pharmaceutical composition a container and instructions for use of the kit.

    [1114] In some embodiments, the kit comprises an antibody, antigen binding fragment thereof that binds PSMA, wherein the antibody or antigen binding fragment comprises:

    the VH of SEQ ID NO: 52 and the VL of SEQ ID NO: 53;

    the VH of SEQ ID NO: 54 and the VL of SEQ ID NO: 55;

    the VH of SEQ ID NO: 56 and the VL of SEQ ID NO: 57;

    the VH of SEQ ID NO: 58 and the VL of SEQ ID NO: 59;

    the VH of SEQ ID NO: 60 and the VL of SEQ ID NO: 61;

    the VH of SEQ ID NO: 62 and the VL of SEQ ID NO: 63;

    the VH of SEQ ID NO: 64 and the VL of SEQ ID NO: 65;

    the VH of SEQ ID NO: 66 and the VL of SEQ ID NO: 67; or

    the VH of SEQ ID NO: 278 and the VL of SEQ ID NO: 279.

    [1115] In some embodiments, the kit comprises the antibody or antigen binding fragment thereof that binds PSMA comprising a VH of SEQ ID NO: 52 and a VL of SEQ ID NO: 53.

    [1116] In some embodiments, the kit comprises an antibody or antigen binding fragment thereof that binds PSMA comprising the amino acid sequence of SEQ ID NOs: 84, 85, 86, 88, 89, 90, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 268, 269, 282, 284, or 288.

    [1117] In some embodiments, the kit comprises an antibody or antigen binding fragment thereof that binds PSMA comprising the amino acid sequence selected from the group consisting of (a) SEQ ID NO: 84 and SEQ ID NO: 85; (b) SEQ ID NO: 86 and SEQ ID NO: 85; (c) SEQ ID NO: 88 and SEQ ID NO: 89; (d) SEQ ID NO: 90 and SEQ ID NO: 89; (e) SEQ ID NO: 92 and SEQ ID NO: 93; f) SEQ ID NO: 94 and SEQ ID NO: 95; g) SEQ ID NO: 96 and SEQ ID NO: 97; h) SEQ ID NO: 98 and SEQ ID NO: 99; i) SEQ ID NO: 100 and SEQ ID NO: 101; j) SEQ ID NO: 102 and SEQ ID NO: 103; k) SEQ ID NO: 268 and SEQ ID NO: 269; l) SEQ ID NO: 284 and SEQ ID NO: 269; m) SEQ ID NO: 282 and n) SEQ ID NO: 288.

    [1118] In some embodiments, the kit comprises a radioimmunoconjugate having the following structure:

    ##STR00075##

    (also referred to herein as TOPA-[C7]-phenylthiourea-PSMA Antibody Conjugate),

    [1119] wherein M.sup.+ is actinium-225(.sup.225Ac), and

    [1120] wherein the mAb has binding specificity for PSMA; for example,

    [1121] (i) wherein the mAb is an PSMB1154 antibody comprising a heavy chain (HC) variable region comprising the amino acid sequences of SEQ ID NO: 4 and SEQ ID NO: 5 and SEQ ID NO: 6 and a light chain (LC) variable region comprising the amino acid sequences of SEQ ID NO: 7 and SEQ ID NO: 8 and SEQ ID NO: 9; and/or

    [1122] (ii) wherein the mAb comprises a heavy chain variable region (VH) having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98%, or 100% sequence identity to the amino acid sequence of SEQ ID NO: 52, and/or a light chain variable region (VL) having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98%, or 100% sequence identity to the amino acid sequence of SEQ ID NO: 53.

    [1123] In some embodiments, the kit comprises a radioimmunoconjugate having the following structure:

    ##STR00076##

    also referred to herein as TOPA-[C7]-phenylthiourea-PSMA Antibody Conjugate),
    wherein M.sup.+ is actinium-225(.sup.225Ac), and

    [1124] wherein the mAb has binding specificity for PSMA; for example,

    [1125] (i) wherein the mAb is an PSMB1183 antibody comprising a heavy chain (HC) variable region comprising the amino acid sequences of SEQ ID NO: 10 and SEQ ID NO: 11 and SEQ ID NO: 12 and a light chain (LC) variable region comprising the amino acid sequences of SEQ ID NO: 13 and SEQ ID NO: 14 and SEQ ID NO: 15; and/or

    [1126] (ii) wherein the mAb comprises a heavy chain variable region (VH) having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98%, or 100% sequence identity to the amino acid sequence of SEQ ID NO: 54, and/or a light chain variable region (VL) having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98%, or 100% sequence identity to the amino acid sequence of SEQ ID NO: 55.

    [1127] In some embodiments, the kit comprises a radioimmunoconjugate comprising a radiometal ion used as an imaging agent coordinated to a chelator moiety, wherein the radiometal ion is .sup.111In and the chelator is p-SCN-Bn-DOTA (S-2-(4-Isothiocyanatobenzyl)-1,4,7,10-tetraazacyclododecane tetraacetic acid) of formula

    ##STR00077##

    [1128] or a pharmaceutically acceptable salt thereof; and

    [1129] an anti-PSMA antibody or antigen binding fragment thereof which comprises

    [1130] a heavy chain variable region (VH) comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:4, a VH CDR2 having an amino acid sequence of and SEQ ID NO:5 and a VH CDR3 having an amino acid sequence of SEQ ID NO:6; a light chain variable region (VL) comprising a VL CDR1 having an amino acid sequence of SEQ ID NO:7, a VL CDR2 having an amino acid sequence of and SEQ ID NO:8 and a VL CDR3 having an amino acid sequence of SEQ ID NO:9; and/or

    [1131] a heavy chain variable region (VH) having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 52, a light chain variable region (VL) having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 53.

    [1132] In some embodiments, the kit comprises a radioimmunoconjugate comprising a radiometal ion used as an imaging agent coordinated to a chelator moiety, wherein the radiometal ion is .sup.111In and the chelator is p-SCN-Bn-DOTA (S-2-(4-Isothiocyanatobenzyl)-1,4,7,10-tetraazacyclododecane tetraacetic acid) of formula

    ##STR00078##

    [1133] or a pharmaceutically acceptable salt thereof; and

    [1134] an anti-PSMA antibody or antigen binding fragment thereof which comprises

    [1135] a heavy chain variable region (VH) comprising a VH CDR1 having an amino acid sequence of SEQ ID NO: 14, a VH CDR2 having an amino acid sequence of and SEQ ID NO: 15 and a VH CDR3 having an amino acid sequence of SEQ ID NO: 16; a light chain variable region (VL) comprising a VL CDR1 having an amino acid sequence of SEQ ID NO: 17, a VL CDR2 having an amino acid sequence of and SEQ ID NO: 18 and a VL CDR3 having an amino acid sequence of SEQ ID NO: 19; and/or

    [1136] a heavy chain variable region (VH) having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 54, a light chain variable region (VL) having at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to the amino acid sequence of SEQ ID NO: 55.

    EXAMPLES

    Example 1. Antigen Generation

    [1137] Human prostate-specific membrane antigen (PSMA) is a type II transmembrane zinc metallopeptidase that has a unique three part structure: a 19 a.a. intracellular domain, a 24 a.a. transmembrane domain, and a 707 a.a. extracellular domain. It is known to overexpress in the epithelium of nearly all primary and metastatic prostate cancer cells versus normal cells and is thus an attractive target for targeted therapies such as ADCs and radio-conjugates.

    [1138] To identify antibodies binding to this target, extracellular domains (ECD) of human PSMA and cyno PSMA were used as primary immunogen during antibody discovery. Human PSMA ECD was produced based on Uniprot Accession #Q04609 sequence. The ECD construct was designed with a 6×His-tag sequence (SEQ ID NO: 339) at the N-terminus (Protein AA ID PSMW39; SEQ ID NO: 1). The PSMA ECD from Macacafascicularis was produced based on NCBI Accession #EHH56646.1, fused to an Avi tag and 6×His-tag (SEQ ID NO: 339) at the N-terminus (Protein AA ID PSMW1; SEQ ID NO: 2). The extracellular domain (ECD) of PSMA from Mus musculus was produced based on Uniprot Accession #035409, fused to an Avi tag and 6×His-tag (SEQ ID NO: 339) at the N-terminus to facilitate purification (Protein AA ID PSMW29; SEQ ID NO: 3). The cynomolgus and murine ECD expression constructs were used to transiently transfect HEK293-6E cells using PEI MAX (transfection grade linear polyethylenimine hydrochloride, Polysciences). Briefly, transfected cells were incubated for six days at 37 □C with 5% CO.sub.2 in a shake flask and harvested when the viability had dropped to 80%. The human ECD expression construct was used to stably transfect Expi-CHO using Expifectamine-CHO (ThermoFisher Scientific) according to the recommendations of the manufacturer. Briefly, stable transfectants were selected with G418 (Thermo Fisher Scientific; Cat/#10131027). Monoclones expressing the highest levels of human PSMA ECD protein were identified by ELISA (R&D Systems; Cat #DY4234-05). High PSMW39-expressing monoclones were cultured in Dynamis media (Thermo Fisher Scientific; Cat/#A2661501) supplemented with 5% Cell Boost 5 (Hyclone; Cat/#SH30865.01) and incubated at 37° C., 125 rpm and 5% CO.sub.2 until the cell viability dropped below 80%. On days 2, 4, 7, 9 and 11, 6 mL of 20% D-glucose (2 g/L final conc.) and 6 mL of 200 mM L-glutamine (2 mM final conc.) was added as feed to each of the flasks. For the purification of all recombinant PSMA proteins, cells were removed via centrifugation and His-tagged PSMA proteins were purified from the supernatant via immobilized metal affinity chromatography using His 60 Ni Superflow Resin (Clonetech, Cat #635662) followed by Superdex 200 preparative size exclusion chromatography (SEC) (GE Healthcare) and formulated into 1×DPBS, pH 7.2 containing 1 mM CaCl.sub.2, 0.5 mM MgCl.sub.2, and 0.5 mM ZnCl.sub.2. The isolation of the homodimeric species was confirmed via analytical size exclusion chromatography. The amino acid sequences of the recombinant antigens are shown in Table 3.

    TABLE-US-00006 TABLE 3 SEQ Protein ID AA ID Description NO: Amino Acid Sequence PSMW39 Human 1 HHHHHHKSSNEATNITPKHNMKAFLDELKAENIKKFLYNF PSMA TQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLS ECD YPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFS (Lys44- AFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIA Ala750), RYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSY N-6xHis PDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRR GIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGS LKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLR GAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFG TLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQ ERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSP DEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFF QRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKF YDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVL RKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASK FSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPF YRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGE VKRQIYVAAFTVQAAAETLSEVA PSMW1 Avi-6xHis- 2 GLNDIFEAQKIEWHEHHHHHHGSKSSSEATNITPKHNMKA GS-cyno FLDELKAENIKKFLHNFTQIPHLAGTEQNFQLAKQIQSQWK PSMA EFGLDSVELTHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLF ECD EPPPAGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDF FKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGATGV ILYSDPDDYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAG DPLTPGYPANEYAYRRGMAEAVGLPSIPVHPIGYYDAQKL LEKMGGSASPDSSWRGSLKVPYNVGPGFTGNFSTQKVKM HIHSTSEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGI DPQSGAAVVHEIVRSFGMLKKEGWRPRRTILFASWDAEEF GLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCT PLMYSLVYNLTKELESPDEGFEGKSLYESWTKKSPSPEFSG MPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSSY PLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELA NSVVLPFDCRDYAVVLRKYADKIYNISMKHPQEMKTYSVS FDSLFSAVKNFTEIASKFSERLRDFDKSNPILLRMMNDQLM FLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDA LFDIESKVDPSQAWGEVKRQISIATFTVQAAAETLSEVA PSMW29 Avi-6xHis- 3 GLNDIFEAQKIEWHEHHHHHHGSKPSNEATGNVSHSGMKK GS-mouse EFLHELKAENIKKFLYNFTRTPHLAGTQNNFELAKQIHDQW PSMA KEFGLDLVELSHYDVLLSYPNKTHPNYISIINEDGNEIFKTSL (45-752) SEQPPPGYENISDVVPPYSAFSPQGTPEGDLVYVNYARTED FFKLEREMKISCSGKIVIARYGKVFRGNMVKNAQLAGAKG MILYSDPADYFVPAVKSYPDGWNLPGGGVQRGNVLNLNG AGDPLTPGYPANEHAYRHELTNAVGLPSIPVHPIGYDDAQK LLEHMGGPAPPDSSWKGGLKVPYNVGPGFAGNFSTQKVK MHIHSYTKVTRIYNVIGTLKGALEPDRYVILGGHRDAWVF GGIDPQSGAAVVHEIVRSFGTLKKKGRRPRRTILFASWDAE EFGLLGSTEWAEEHSRLLQERGVAYINADSSIEGNYTLRVD CTPLMYSLVYNLTKELQSPDEGFEGKSLYDSWKEKSPSPEF IGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWKTNKVS SYPLYHSVYETYELVVKFYDPTFKYHLTVAQVRGAMVFEL ANSIVLPFDCQSYAVALKKYADTIYNISMKHPQEMKAYMI SFDSLFSAVNNFTDVASKFNQRLQELDKSNPILLRIMNDQL MYLERAFIDPLGLPGRPFYRHIIYAPSSHNKYAGESFPGIYD ALFDISSKVNASKAWNEVKRQISIATFTVQAAAETLREVA

    Example 2. Generation of Anti-PSMA Antibodies

    [1139] Antibody Generation Using Transgenic Ablexis® Mice

    [1140] Ablexis® kappa, lambda, and kappa/lambda hybrid mice were used for antibody discovery. Ablexis® mice generate antibodies having human variable domains linked to human CH1 and CL domains, chimeric human/mouse hinge regions, and mouse Fc regions. Antibodies produced by the Kappa Mouse lack sequence derived from mouse VH, DH and JH exons and mouse Vκ, Jκ and Cκ exons. The endogenous mouse Igλ is active in the Kappa Mouse. The human Igκ chains comprise approximately 90-95% of the naïve repertoire and mouse Igλ chains comprise approximately 5-10% of the naïve repertoire in this strain. Antibodies produced by the Lambda Mouse lack sequence derived from mouse VH, DH and JH exons and mouse Vλ, Jλ and Cλ exons. The endogenous mouse Igκ is active in the Lambda Mouse. The human Igλ chains comprise approximately 40% of the naïve repertoire and mouse Igκ chains comprise approximately 60% of the naïve repertoire. The preparation and use of Ablexis®, and the genomic modifications carried by such mice, is described in WO11/123708.

    [1141] For antibody discovery, Ablexis kappa/lambda hybrid mice were immunized with recombinant human PSMA antigen (PSMW39.002) and cynomolgus PSMA antigen (PSMW1.009) in combination with CL413 adjuvant (InvivoGen, VAC-C413-5). Briefly, mice were boosted on Days 0, 7, 14, 21, and 28 before being bled on Day 35 for serological analysis. Serology was performed on human PSMA (+) cells C4-2B (AG000002300) and a human PSMA knockout cell line (AG000002521). In total, 8 mice were selected for hybridoma fusion and finally boosted on Day 56 with PSMW39.002 or an equimolar mixture of PSMW39.002 and PSMW1.009. This preparation also included recombinant anti-mouse CD40 mAb (R&D Systems, MAB440) to stimulate B cell expansion. On Day 60, spleen and draining lymph nodes were harvested from these mice, pooled and homogenized into a single-cell suspension. Stable hybridomas were generated by PEG-mediated fusion of mouse myeloma cell line FO with the pooled mouse homogenate, followed by HAT selection.

    [1142] Supernatants from these hybridomas were screened against PSMA (+) C4-2B cells by MSD. From this primary screen, 440 positive samples were identified and re-arrayed for confirmatory screening. Confirmatory screening was performed by ELISA as well as Fluorescence-activated cell sorting (FACS) to validate binding to PSMA protein and C4-2B cells, respectively. To ensure specificity, samples were also screened against an irrelevant negative control sample TfRW2. Based on the screening results, 96 samples were advanced past confirmatory screening from the 440 samples identified and submitted for V region recovery.

    V Region Cloning

    [1143] Total cellular RNA was prepared from 5×10.sup.6 hybridoma cells using RNEASY Plus mini-kit (Qiagen) according to manufacturer protocol. cDNA was subsequently synthesized from total RNA using the SMARTER cDNA synthesis kit (Clontech, Mount View, Calif.) essentially according to manufacturer's instructions. Briefly, to facilitate first strand cDNA synthesis reaction, a modified oligo(dT) primer (SMART CDS primer IIA) was used to transcribe all mRNAs in conjunction with a reverse transcriptase (SMARTScribe RT) which also adds an oligonucleotide cap (Smarter II A) on the 3′ end of the cDNA when it reaches the 5′ end of mRNA. Subsequent amplification of the VH and VL fragments was performed using a 2-step PCR amplification using 5′ primers targeting the Smarter IIA cap and 3′ primers targeting consensus regions in CH1 or CL. Each 50 μl PCR reaction in the first step consisted of 20 μM of forward and reverse primer mixes, 25 μl of PRIMESTAR Max DNA polymerase premix, 2 μl of unpurified cDNA, and 21 μl of double-distilled H.sub.2O. The PCR components were mixed on ice in thin-walled PCR tubes and transferred to a thermacycler preheated to 94° C. The cycling program consisted of the following steps: (i) 94° C. for 3 min; (ii) 35 cycles (94° C. for 30 Sec, 55° C. for 1 min, 68° C. for 1 min); (iii) 72° C. for 7 min. The PCR reaction fragments were then gel purified and subjected to another round of PCR (cycling conditions same as PCR #1) using VL and VH 2nd round primers that also contained an additional 15 bp region complementary to our in-house proprietary expression vectors for human light chain (Lonza-huIgk or Lonza-huIgλ) and heavy chain (Lonza-huIgG1) constant regions. The subsequent PCR fragments were gel purified and VL and VH fragments subcloned in-frame in Lonza-huIgk/huIgλ and Lonza-huIgG1 vectors, respectively, using In-Fusion® HD Cloning kit (Takara Bio), according to manufacturer recommendations. The expression vectors were then purified using Qiaprep Miniprep Kit (Qiagen) and submitted to Genewiz for sanger sequencing, resulting in 126 unique VL and VH sequence pairs which were further narrowed down to 96 pairs based on an in-silico developability assessment risk analysis.

    ExpiCHO Transfection and Purification

    [1144] The 96 unique VH/VL pairs reformatted as huIgG1 were transiently produced using ExpiCHO-S™ system (ThermoFisher Scientific) according to manufacturer's recommendation. Briefly, ExpiCHO-S™ cells were maintained in suspension in ExpiCHO™ expression medium (ThermoFisher Scientific, Cat #A29100) in an orbital shaking incubator set at 37° C., 8% CO2 and 125 RPM. The cells were passaged and diluted prior to transfection to 6.0×10.sup.6 cells/ml, maintaining cell viability at 95.0% or better. Transient transfections were done using the ExpiFectamine™ CHO transfection kit (ThermoFisher Scientific, Cat #A29131). For each ml of diluted cells to be transfected, 0.5 μg of encoding DNA (HC:LC=1:3) and 0.5 μg of pAdVAntage DNA (Promega, Cat #E1711) was used and diluted into OptiPRO™ SFM complexation medium (ThermoFisher Scientific, Cat #12309019). ExpiFectamine™ CHO reagent was used at a 1:4 ratio (v/v, DNA:reagent) and diluted into OptiPRO™. The diluted DNA and transfection reagent were combined for one minute, allowing DNA/lipid complex formation, and then added to the cells. After overnight incubation, ExpiCHO™ feed and ExpiFectamine™ CHO enhancers were added to the cells as per the manufacturer's Standard protocol. Cells were incubated with orbital shaking (125 rpm) at 37° C. for seven days post-transfection prior to harvesting the culture broth. The culture supernatant from the transiently transfected ExpiCHOS™ cells was clarified by centrifugation (30 min, 3000 rcf) followed by two sterile filtration steps, first through a 0.45 μm filter and then through a 0.2 μm filter (PES membrane, Corning; Corning, N.Y.).

    Purification of Anti-PSMA Antibodies

    [1145] Antibodies were purified from the clarified supernatants using Mabselect SuRe Protein A columns equilibrated with 1×D-PBS, pH 7.2 prior. Unbound proteins were removed by washing extensively with 1×DPBS, pH 7.2. Bound protein was eluted with 0.1 M Na-acetate, pH 3.5. Peak fractions were neutralized with 2.5 M Tris pH 7.5 and pooled. The neutralized fraction pools were then dialyzed into 1×DPBS. The protein concentration for each elution pool was determined by measuring absorbance at OD280 nm and calculated using absorbance extinction coefficient based on the amino acid sequence.

    Sequences of PSMA Antibodies

    [1146] Sequences of representative PSMA antibodies are provided in Tables 4-19. Table 4 shows the Kabat HCDR1, HCDR2 and HCDR3 of selected anti-PSMA selected antibodies. Table 5 shows the Kabat LCDR1, LCDR2 and LCDR3 of the selected anti-PSMA antibodies. Table 6 shows the Chothia HCDR1, HCDR2 and HCDR3 of selected anti-PSMA antibodies. Table 7 shows the Chothia LCDR1, LCDR2 and LCDR3 of selected anti-PSMA antibodies. Table 8 shows the ABM HCDR1, HCDR2 and HCDR3 of selected anti-PSMA antibodies. Table 9 shows the ABM LCDR1, LCDR2 and LCDR3 of selected anti-PSMA antibodies. Table 10 shows the IMTG HCDR1, HCDR2 and HCDR3 of selected anti-PSMA antibodies. Table 11 shows the IMTG LCDR1, LCDR2 and LCDR3 of selected anti-PSMA antibodies. Table 12 shows the VH and VL amino acid sequences of selected anti-PSMA antibodies. Table 13 shows the VH nucleic acid sequences of selected anti-PSMA antibodies. Table 14 shows the VL nucleic acid sequences of selected anti-PSMA antibodies. Table 15 shows the HC amino acid sequences of selected anti-PSMA antibodies. Table 16 shows the LC amino acid sequences of selected anti-PSMA antibodies. Table 17 shows the HC nucleotide sequences of selected anti-PSMA antibodies. Table 18 shows the LC nucleotide sequences of selected anti-PSMA antibodies. Table 19 summarizes the SEQ ID NO: assigned to the selected anti-PSMA antibodies.

    TABLE-US-00007 TABLE 4 HCDRs of selected anti-PSMA antibodies using Kabat delineation HCDR1 HCDR2 HCDR3 HCDR1 SEQ ID SEQ ID HCDR3 SEQ ID mAb sequence NO: HCDR2 sequence NO: sequence NO: PSMB1154 RYGMH 4 LISYDGSNRYYAD 5 ERESSGWFEG 6 SVKG YFDY PSMB2945 RYGMH 4 LISYDGSNRYYAD 5 ERESSGWFEG 6 SVKG YFDY PSMB1183 SYYWN 10 RIYSSGNTDYNPSL 11 GRGANVGLF 12 KS DY PSMB3003 SYYWN 10 RIYSSGNTDYNPSL 11 GRGANVGLF 12 KS DY PSMB1157 GYGMH 16 VISYDGSNRYYAD 17 DGNWGSLDL 18 SVKG YFDL PSMB1156 SYGMH 22 VISYDGSNKYYAD 23 EHYDSSGYYH 24 SVKG GYYGMDV PSMB1088 SYDMH 28 VISFDGSNKYYVD 29 TYYDILTGYS 30 SVKG HYSYGMDV PSMB1098 TYGMH 34 FISYDGSNKYYAD 35 RDNLRFLEWF 36 SVKG MDV PSMB1113 IYSMN 40 SISSSSSYIFYADSV 41 SSYGADY 42 KG PSMB1195 SYSLN 46 SISSSSSYISYADA 47 DRGFLEDYYY 48 VKG YYGMDV

    TABLE-US-00008 TABLE 5 LCDRs of selected anti-PSMA antibodies using Kabat delineation LCDR1 LCDR2 LCDR3 SEQ ID LCDR2 SEQ ID LCDR3 SEQ ID mAb LCDR1 sequence NO: sequence NO: sequence NO: PSMB1154 GGNNIGSKSVH 7 DNSDRPS 8 QVWDSSSDH 9 VV PSMB2945 GGNNIGSKSVH 7 DNSDRPS 8 QVWDSSSDH 9 VV PSMB1183 TGSNSNIGANYD 13 GNINRPL 14 QSYDFSLSGS 15 VH V PSMB3003 TGSNSNIGANYD 13 GNINRPL 14 QSYDFSLSGS 15 VH V PSMB1157 TGSSSNIGADYD 19 VNNNRPS 20 QSYDNTLSG 21 VH VV PSMB1156 SGSSSNIGSNYV 25 SNNQRPS 26 AARDDSLSG 27 Y YV PSMB1088 RASQGISNYLA 31 ATSTLQS 32 QKYNSAPFT 33 PSMB1098 RASQSVRSNLA 37 GASTRAT 38 HQYNDWPP 39 YT PSMB1113 RASQDITNFLA 43 TASTLQS 44 QKYNSAPLT 45 PSMB1195 RASQGISNWLA 49 VASSLQS 50 QQAYSFPLT 51

    TABLE-US-00009 TABLE 6 HCDRs of selected anti-PSMA antibodies using Chothia delineation HCDR1 HCDR2 HCDR3 HCDR1 SEQ ID HCDR2 SEQ ID SEQ ID mAb sequence NO: sequence NO: HCDR3 sequence NO: PSMB1154 GFTLSRY 124 SYDGSN 125 ERESSGWFEGYFDY 6 PSMB2945 GFTLSRY 124 SYDGSN 125 ERESSGWFEGYFDY 6 PSMB1183 GGSISSY 130 YSSGN 131 GRGANVGLFDY 12 PSMB3003 GGSISSY 130 YSSGN 131 GRGANVGLFDY 12 PSMB1157 VRTFSGY 136 SYDGSN 125 DGNWGSLDLYFDL 18 PSMB1156 GFTFTSY 142 SYDGSN 125 EHYDSSGYYHGYYG 24 MDV PSMB1088 GFTFSSY 148 SFDGSN 149 TYYDILTGYSHYSYG 30 MDV PSMB1098 GFTFSTY 154 SYDGSN 125 RDNLRFLEWFMDV 36 PSMB1113 GFTLSIY 160 SSSSSY 161 SSYGADY 42 PSMB1195 GFTFSSY 166 SSSSSY 167 DRGFLEDYYYYYGM 48 DV

    TABLE-US-00010 TABLE 7 LCDRs of selected anti-PSMA antibodies using Chothia delineation LCDR1 LCDR2 LCDR3 SEQ ID LCDR2 SEQ ID LCDR3 SEQ ID mAb LCDR1 sequence NO: sequence NO: sequence NO: PSMB1154 GGNNIGSKSVH 7 DNSDRPS 8 QVWDSSSDH 9 VV PSMB2945 GGNNIGSKSVH 7 DNSDRPS 8 QVWDSSSDH 9 VV PSMB1183 TGSNSNIGANY 13 GNINRPL 14 QSYDFSLSG 15 DVH SV PSMB3003 TGSNSNIGANY 13 GNINRPL 14 QSYDFSLSG 15 DVH SV PSMB1157 TGSSSNIGADYD 19 VNNNRPS 20 QSYDNTLSG 21 VH VV PSMB1156 SGSSSNIGSNYV 25 SNNQRPS 26 AARDDSLSG 27 Y YV PSMB1088 RASQGISNYLA 31 ATSTLQS 32 QKYNSAPFT 33 PSMB1098 RASQSVRSNLA 37 GASTRAT 38 HQYNDWPP 39 YT PSMB1113 RASQDITNFLA 43 TASTLQS 44 QKYNSAPLT 45 PSMB1195 RASQGISNWLA 49 VASSLQS 50 QQAYSFPLT 51

    TABLE-US-00011 TABLE 8 HCDRs of selected anti-PSMA antibodies using ABM delineation HCDR1 HCDR2 HCDR3 HCDR3 HCDR1 SEQ ID HCDR2 SEQ ID SEQ mAb sequence NO: sequence NO: sequence ID NO: PSMB1154 GFTLSRYG 172 LISYDGSN 173 ERESSGWFEG 6 MH RY YFDY PSMB2945 GFTLSRYG 172 LISYDGSN 173 ERESSGWFEG 6 MH RY YFDY PSMB1183 GGSISSYYW 178 RIYSSGNT 179 GRGANVGLFD 12 N D Y PSMB3003 GGSISSYYW 178 RIYSSGNT 179 GRGANVGLFD 12 N D Y PSMB1157 VRTFSGYG 184 VISYDGSN 185 DGNWGSLDLY 18 MH RY FDL PSMB1156 GFTFTSYGM 190 VISYDGSN 191 EHYDSSGYYH 24 H KY GYYGMDV PSMB1088 GFTFSSYDM 196 VISFDGSN 197 TYYDILTGYSH 30 H KY YSYGMDV PSMB1098 GFTFSTYGM 202 FISYDGSN 203 RDNLRFLEWF 36 H KY MDV PSMB1113 GFTLSIYSM 208 SISSSSSYIF 209 SSYGADY 42 N PSMB1195 GFTFSSYSL 214 SISSSSSYIS 215 DRGFLEDYYY 48 N YYGMDV

    TABLE-US-00012 TABLE 9 LCDRs of selected anti-PSMA antibodies using ABM delineation LCDR1 LCDR2 LCDR3 LCDR1 SEQ LCDR2 SEQ LCDR3 SEQ se- ID se- ID se- ID mAb quence NO: quence NO: quence NO: PSMB1154 GGNNI  7 DNSD 8 QVWDSS 9 GSKSVH RPS SDHW PSMB2945 GGNNIG  7 DNSD 8 QVWDSS 9 SKSVH RPS SDHW PSMB1183 TGSNSN 13 GNIN 14 QSYDFSL 15 IGANYD RPL SGSV VH PSMB3003 TGSNSN 13 GNIN 14 QSYDFSL 15 IGANYD RPL SGSV VH PSMB1157 TGSSSN 19 VNNN 20 QSYDNT 21 IGADYD RPS LSGW VH PSMB1156 SGSSS 25 SNNQ 26 AARDDS 27 NIGSN RPS LSGYV YVY PSMB1088 RASQGIL 31 ATST 32 QKYNSA 33 SNYA LQS PFT PSMB1098 RASQSV 37 GAST 38 HQYND 39 RSNLA RAT WPPYT PSMB1113 RASQDI 43 TAST 44 QKYNSA 45 TNFLA LQS PLT PSMB1195 RASQGI 49 VASS 50 QQAYSF 51 SNWL LQS

    TABLE-US-00013 TABLE 10 HCDRs of selected anti-PSMA antibodies using IMTG delineation HCDR1 HCDR2 HCDR3 HCDR1 SEQ HCDR2 SEQ HCDR3 SEQ se- ID se- ID se- ID mAb quence NO: quence NO: quence NO: PSMB1154 GFTL 220 ISYDG 221 ARERESSGW 222 SRYG SNR FEGYFDY PSMB2945 GFTL 220 ISYDG 221 ARERESSGW 222 SRYG SNR FEGYFDY PSMB1183 GGSI 226 IYSS 227 ARGRGAN 228 SSYY GNT VGLFDY PSMB3003 GGSI 226 IYSS 227 ARGRGAN 228 SSYY GNT VGLFDY PSMB1157 VRTF 232 ISYDG 233 ARDGNWG 234 SGYG SNR SLDLYFDL PSMB1156 GFTF 238 ISYDG 239 AREHYDS 240 TSYG SNK SGYYHGYY GMDV PSMB1088 GFTF 244 ISFDG 245 ARTYYDI 246 SSYD SNK LTGYSHYS YGMDV PSMB1098 GFTF 250 ISYDG 251 AGRDNLRFL 252 STYG SNK EWFMDV PSMB1113 GFTL 256 ISSSS 257 ARSSYGADY 258 SIYS SYI PSMB1195 GFTF 262 ISSSS 263 ARDRGFL 264 SSYS SYI EDYYYYY GMDV

    TABLE-US-00014 TABLE 11 LCDRs of selected anti-PSMA antibodies using IMTG delineation LCDR1 LCDR1 LCDR2 LCDR2 LCDR3 LCDR3 se- SEQ se- SEQ ID se- SEQ mAb quence ID NO: quence NO: quence ID NO: PSMB1154 NIGSKS 223 DNS NA QVWDSS 9 SDHW PSMB2945 NIGSKS 223 DNS NA QVWDSS 9 SDHW PSMB1183 NSNIG 229 GNI NA QSYDFS 15 ANYD LSGSV PSMB3003 NSNIG 229 GNI NA QSYDFS 15 ANYD LSGSV PSMB1157 SSNIGA 235 VNN NA QSYDN 21 DYD TLSGW PSMB1156 SSNIG 241 SNN NA AARDDS 27 SNY LSGYV PSMB1088 QGISNY 247 ATS NA QKYNS 33 APFT PSMB1098 QSVRSN 253 GAS NA HQYND 39 WPPYT PSMB1113 QDITNF 259 TAS NA QKYNS 45 APLT PSMB1195 QGISNW 265 VAS NA QQAYS 51 FPLT NA = Not Applicable.

    TABLE-US-00015 TABLE 12 VH and VL amino acid sequence of selected anti-PSMA antibodies VH VL VH amino SEQ VL amino SEQ acid ID VL acid ID Antibody VH name sequence NO: name sequence NO: PSMB1154 VD0000 EVQLVESGGGEVQP 52 VD0000 QLVLTQPPSVS 53 60663_V GRSLRLTCAVSGFTL VAPGQTARITC H SRYGMHWVRQAPG GGNNIGSKSVH KGLEWAALISYDGS 60661 WYQQKPGQAP NRYYADSVKGRFTI VL VLVVYDNSDRP SRDNSKNTVFLQMN SGIPERFSGSNS SLRAEDTAVYYCAR GNTATLTISRVE ERESSGWFEGYFDY VGDEADYYCQ WGQGTTVTVSS VWDSSSDHVVF GGGTKLTVL PSMB2945 VD0000 EVQLVESGGGEVQP 52 VD0000 QLVLTQPPSVS 53 60663_V GRSLRLTCAVSGFTL 60661 VAPGQTARITC H SRYGMHWVRQAPG VL GGNNIGSKSVH KGLEWAALISYDGS WYQQKPGQAP NRYYADSVKGRFTI VLVVYDNSDRP SRDNSKNTVFLQMN SGIPERFSGSNS SLRAEDTAVYYCAR GNTATLTISRVE ERESSGWFEGYFDY VGDEADYYCQ WGQGTTVTVSS VWDSSSDHVVF GGGTKLTVL PSMB1183 VD0000 QVQLQESGPGLVKS 54 VD0000 QSALTQPPSVS 55 45910_V SETLSLTCTVSGGSIS 60769 GAPGQRVTISC H SYYWNWIRQPAGK VL TGSNSNIGANY GLEWIGRIYSSGNTD DVHWYQHLPG YNPSLKSRVTMSVD TAPKLLIYGNIN TSKNQFSLKLISVTA RPLGVPDRFSG ADTAVYYCARGRG SRSGTSASLAIT ANVGLFDYWGQGT GLQAEDEADY LVTVSS YCQSYDFSLSG SVFGVGTKLTV L PSMB3003 VD0000 QVQLQESGPGLVKS 54 VD0000 QSALTQPPSVS 55 45910_V SETLSLTCTVSGGSIS 60769 GAPGQRVTISC H SYYWNWIRQPAGK VL TGSNSNIGANY GLEWIGRIYSSGNTD DVHWYQHLPG YNPSLKSRVTMSVD TAPKLLIYGNIN TSKNQFSLKLISVTA RPLGVPDRFSG ADTAVYYCARGRG SRSGTSASLAIT ANVGLFDYWGQGT GLQAEDEADY LVTVSS YCQSYDFSLSG SVFGVGTKLTV L PSMB1157 VD0000 EVQLVESGGGVVQP 56 VD0000 QSVLTQPPSVS 57 46232_V GRSLRLSCAASVRTF 58301 GAPGQRVTISC H SGYGMHWVRQVPG VL TGSSSNIGADY KGLEWVAVISYDGS DVHWYQQLPG NRYYADSVKGRFTI TAPKLLIYVNN SRDNSKNTLYLQMN NRPSGVPDRFS SLRTEDTAVYYCAR GSRSGTSASLAI DGNWGSLDLYFDL TGLQADDEAD WGRGTLVTVSS YYCQSYDNTLS GVVFGGGTKLT VL PSMB1156 VD0000 EVQLVESGGGVVQP 58 VD0000 QAVLTQPPSAS 59 46205_V GRSLRLSCAASGFTF 60670 GTPGQRVTISCS H TSYGMHWVRQAPG VL GSSSNIGSNYV KGLEWVAVISYDGS YWYQLLPGTAP NKYYADSVKGRFTI KLLIYSNNQRPS SRDNSKNTLYLQMN GVPDRFSGSKS SLRAEDTAVYYCAR GTSASLAISGLR EHYDSSGYYHGYY SEDEADYYCAA GMDVWGQGTTVTV RDDSLSGYVFG SS TGTKLTVL PSMB1088 VD0000 EVQLVESGGGVVQP 60 VD0000 EIVMTQSPSSLS 61 60756_V GRSLRLSCAASGFTF 60755 ASVGDRVTITC H SSYDMHWVRQAPG VL RASQGISNYLA KGLEWVTVISFDGS WYQQKPGKVP NKYYVDSVKGRFTI KLLIYATSTLQS SRDNSKNTLYLQMN GVPSRFSGSGS SLRAEDTAVYYCAR GTDFILTISSLQP TYYDILTGYSHYSY EDVANYYCQK GMDVWGQGTTVTV YNSAPFTFGPG SS TKVEIK PSMB1098 VD0000 QVQLVESGGGVVQP 62 VD0000 EIVMTQSPATLS 63 58433_V GRSLRLSCAASGFTF 60599 VSPGERATLSC H STYGMHWVRQAPG VL RASQSVRSNLA KGLEWVAFISYDGS WYQQKPGQAP NKYYADSVKGRFTI RLLIYGASTRAT SRDNSKHTLYLQMN GIPARFSGSGSG SLRAEDTAVYYCAG TEFTLTISSLQSE RDNLRFLEWFMDV DFAVYYCHQY WGQGTTVTVSS NDWPPYTFGQG TKVEIK PSMB1113 VD0000 EVQLVESGGGLVKP 64 VD0000 EIVMTQSPSSLS 65 58464_V GGSLRLSCAASGFTL 60669 ASVGDRVTITC H SIYSMNWVRQAPGK VL RASQDITNFLA GLEWVSSISSSSSYIF WYQQKPGKVP YADSVKGRFTISRD KLLIYTASTLQS NAKNSLFLQMNSLR GVPSRFSGSGS AEDTAVYYCARSSY GTDFTLTISSLQ GADYWGQGTLVTV PEDVATYYCQK SS YNSAPLTFGGG TKLEIK PSMB1195 VD0000 EVQLVESGGGLVKP 66 VD0000 DIVMTQSPSSVS 67 60752_V GGSLRLSCAASGFTF 60787_ ASVGDRVTITC H SSYSLNWVRQAPGK VL RASQGISNWLA GLEWVSSISSSSSYIS WYQQKPGKAP YADAVKGRFTISRD KLLIYVASSLQS NAKNSLYLQMNSLR GVPSRFSGSGS AEDTAVYYCARDR GTDFSLTISSLQ GFLEDYYYYYGMD PEDFATYYCQQ VWGQGTTVTVSS AYSFPLTFGGG TKVEIK

    TABLE-US-00016 TABLE 13 VH nucleic acid sequence of selected anti-PSMA antibodies VH SEQ Antibody VH name VH nucleic acid sequence ID NO: PSMB1154 VD00006066 GAGGTGCAGCTGGTTGAATCTGGTGGCGGAGAAG 68 3_VH TGCAGCCTGGCAGATCTCTGAGACTGACCTGTGC TGTGTCCGGCTTCACCCTGTCCAGATACGGAATG CACTGGGTCCGACAGGCCCCTGGCAAAGGATTGG AATGGGCCGCTCTGATCTCCTACGACGGCTCCAA TAGGTACTACGCCGACTCCGTGAAGGGCAGATTC ACCATCTCTCGGGACAACTCCAAGAACACCGTGT TTCTGCAGATGAACTCCCTGAGAGCCGAGGACAC CGCCGTGTACTACTGTGCCAGAGAGCGGGAATCC TCCGGCTGGTTCGAGGGCTACTTCGACTATTGGG GCCAGGGCACCACAGTGACCGTTTCTTCT PSMB2945 VD00006066 GAGGTGCAGCTGGTTGAATCTGGTGGCGGAGAAG 68 3_VH TGCAGCCTGGCAGATCTCTGAGACTGACCTGTGC TGTGTCCGGCTTCACCCTGTCCAGATACGGAATG CACTGGGTCCGACAGGCCCCTGGCAAAGGATTGG AATGGGCCGCTCTGATCTCCTACGACGGCTCCAA TAGGTACTACGCCGACTCCGTGAAGGGCAGATTC ACCATCTCTCGGGACAACTCCAAGAACACCGTGT TTCTGCAGATGAACTCCCTGAGAGCCGAGGACAC CGCCGTGTACTACTGTGCCAGAGAGCGGGAATCC TCCGGCTGGTTCGAGGGCTACTTCGACTATTGGG GCCAGGGCACCACAGTGACCGTTTCTTCT PSMB1183 VD00004591 CAGGTGCAGCTGCAAGAGTCTGGACCTGGCCTGG 70 0_VH TCAAGTCCTCCGAGACACTGTCTCTGACCTGCAC CGTGTCTGGCGGCTCCATCTCCTCCTACTACTGGA ACTGGATCAGACAGCCTGCCGGCAAAGGCCTGGA ATGGATCGGCAGAATCTACTCCTCCGGCAACACC GACTACAACCCCAGCCTGAAGTCCAGAGTGACCA TGTCCGTGGACACCTCCAAGAACCAGTTCTCCCT GAAGCTGATCTCCGTGACCGCCGCTGATACCGCC GTGTACTATTGTGCTAGAGGCAGAGGCGCCAACG TGGGCCTGTTTGATTATTGGGGCCAGGGCACCCT GGTCACCGTTTCTTCT PSMB3003 VD00004591 CAGGTGCAGCTGCAAGAGTCTGGACCTGGCCTGG 70 0_VH TCAAGTCCTCCGAGACACTGTCTCTGACCTGCAC CGTGTCTGGCGGCTCCATCTCCTCCTACTACTGGA ACTGGATCAGACAGCCTGCCGGCAAAGGCCTGGA ATGGATCGGCAGAATCTACTCCTCCGGCAACACC GACTACAACCCCAGCCTGAAGTCCAGAGTGACCA TGTCCGTGGACACCTCCAAGAACCAGTTCTCCCT GAAGCTGATCTCCGTGACCGCCGCTGATACCGCC GTGTACTATTGTGCTAGAGGCAGAGGCGCCAACG TGGGCCTGTTTGATTATTGGGGCCAGGGCACCCT GGTCACCGTTTCTTCT PSMB1157 VD00004623 GAGGTGCAGCTGGTTGAATCTGGTGGCGGAGTGG 72 2_VH TGCAGCCTGGCAGATCTCTGAGACTGTCTTGTGC CGCTTCCGTGCGGACCTTCTCTGGCTACGGAATG CACTGGGTCCGACAGGTGCCAGGCAAAGGACTG GAATGGGTGGCCGTGATCTCCTACGATGGCTCCA ATCGGTACTACGCCGACTCCGTGAAGGGCAGATT CACCATCTCTCGGGACAACTCCAAGAACACCCTG TACCTGCAGATGAACTCCCTGCGGACCGAGGATA CCGCCGTGTACTACTGTGCCAGAGATGGCAACTG GGGCTCCCTGGACCTGTACTTCGATCTCTGGGGA CGGGGCACCCTGGTCACAGTCTCTTCT PSMB1156 VD00004620 GAGGTGCAGCTGGTTGAATCTGGTGGCGGAGTGG 74 5_VH TGCAGCCTGGCAGATCTCTGAGACTGTCTTGTGC CGCCTCCGGCTTCACCTTCACCAGCTACGGAATG CACTGGGTCCGACAGGCCCCTGGCAAAGGATTGG AATGGGTGGCCGTGATCTCCTACGACGGCTCCAA CAAGTACTACGCCGACTCCGTGAAGGGCAGATTC ACCATCTCTCGGGACAACTCCAAGAACACCCTGT ACCTGCAGATGAACTCCCTGAGAGCCGAGGACAC CGCCGTGTACTACTGTGCCAGAGAGCACTACGAC TCCTCCGGCTACTACCACGGCTACTATGGCATGG ATGTGTGGGGCCAGGGCACCACAGTGACAGTCTC TTCC PSMB1088 VD00006075 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGCGTG 76 6_VH GTCCAGCCTGGGAGGTCCCTGAGACTCTCCTGTG CAGCCTCTGGATTCACCTTCAGTAGTTATGACATG CACTGGGTCCGCCAGGCTCCAGGCAAGGGGCTGG AGTGGGTGACAGTTATATCATTTGATGGAAGTAA TAAATACTATGTAGACTCCGTGAAGGGCCGATTC ACCATCTCCAGAGACAATTCCAAGAATACGCTGT ATCTGCAAATGAACAGCCTGAGAGCTGAGGACAC GGCTGTGTATTACTGTGCGAGAACGTATTACGAT ATTTTGACTGGTTATTCCCACTACTCCTACGGTAT GGACGTCTGGGGCCAAGGGACCACGGTCACCGTC TCCTCA PSMB1098 VD00005843 CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCGTG 78 3_VH GTCCAGCCTGGGAGGTCCCTGAGACTCTCCTGTG CAGCCTCTGGATTCACCTTCAGTACCTATGGCATG CACTGGGTCCGCCAGGCTCCAGGCAAGGGGCTGG AGTGGGTGGCATTTATATCATATGATGGAAGTAA TAAATACTATGCAGACTCCGTGAAGGGCCGATTC ACCATCTCCAGAGACAATTCCAAGCACACGCTAT ATCTGCAAATGAACAGCCTGAGAGCTGAGGACAC GGCTGTGTATTACTGTGCGGGGAGAGACAACCTA CGATTTTTGGAGTGGTTTATGGACGTCTGGGGCC AAGGGACCACGGTCACCGTCTCTTCA PSMB1113 VD00005846 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGCCTG 80 4_VH GTCAAGCCGGGGGGGTCCCTGAGACTCTCCTGTG CAGCCTCTGGATTCACCCTCAGTATTTATAGCATG AACTGGGTCCGCCAGGCTCCAGGGAAGGGGCTG GAGTGGGTCTCATCCATTAGCAGTAGTAGTAGTT ACATATTCTACGCAGACTCAGTGAAGGGCCGATT CACCATCTCCAGAGACAACGCCAAGAACTCACTC TTTCTGCAAATGAACAGCCTGAGAGCCGAGGACA CGGCTGTGTATTACTGTGCGAGATCCTCCTACGGT GCGGACTACTGGGGCCAGGGAACCCTGGTCACCG TCTCTTCA PSMB1195 VD00006075 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGCCTG 82 2_VH GTCAAGCCTGGGGGGTCCCTGAGACTCTCCTGTG CAGCCTCTGGATTCACCTTCAGCAGCTATAGCCT GAACTGGGTCCGCCAGGCTCCAGGGAAGGGGCT GGAGTGGGTCTCATCCATTAGTAGTAGTAGTAGT TACATATCCTACGCAGACGCAGTGAAGGGCCGAT TCACCATCTCCAGAGACAACGCCAAGAACTCACT GTATCTGCAAATGAACAGCCTGAGAGCCGAGGAC ACGGCTGTGTATTACTGTGCGAGAGATCGGGGAT TTTTGGAGGATTACTACTACTACTACGGTATGGA CGTCTGGGGCCAAGGGACCACGGTCACCGTCTCC TCA

    TABLE-US-00017 TABLE 14 VL nucleic acid sequence of selected anti-PSMA antibodies VL VL SEQ Antibody name VL nucleic acid sequence ID NO: PSMB1154 VD000 CAGCTGGTTCTGACCCAGCCTCCTTCTGTGTCTGTGGCTCC 69 060661 TGGCCAGACCGCCAGAATTACCTGTGGCGGCAACAACATC _VL GGCTCCAAGTCCGTGCACTGGTATCAGCAGAAGCCTGGAC AGGCTCCTGTGCTGGTGGTGTACGACAACTCTGACCGGCC TTCTGGCATCCCTGAGAGATTCTCCGGCTCCAACAGCGGC AATACCGCCACACTGACCATCTCCAGAGTGGAAGTGGGCG ACGAGGCCGACTACTACTGCCAAGTGTGGGACTCCTCCTC CGATCATGTGGTGTTTGGCGGCGGAACAAAGCTGACAGTG CTG PSMB2945 VD000 CAGCTGGTTCTGACCCAGCCTCCTTCTGTGTCTGTGGCTCC 69 060661 TGGCCAGACCGCCAGAATTACCTGTGGCGGCAACAACAT _VL CGGCTCCAAGTCCGTGCACTGGTATCAGCAGAAGCCTGGA CAGGCTCCTGTGCTGGTGGTGTACGACAACTCTGACCGGC CTTCTGGCATCCCTGAGAGATTCTCCGGCTCCAACAGCGG CAATACCGCCACACTGACCATCTCCAGAGTGGAAGTGGGC GACGAGGCCGACTACTACTGCCAAGTGTGGGACTCCTCCT CCGATCATGTGGTGTTTGGCGGCGGAACAAAGCTGACAGT GCTG PSMB1183 VD000 CAGTCTGCTCTGACCCAGCCTCCTTCTGTGTCTGGCGCTCC 71 060769 TGGCCAGAGAGTGACCATCTCTTGTACCGGCTCCAACTCC _VL AACATCGGCGCCAACTACGACGTGCACTGGTATCAGCATC TGCCCGGCACAGCTCCCAAGCTGCTGATCTACGGCAACAT CAACAGACCCCTGGGCGTGCCCGACCGGTTTTCTGGAAGC AGATCTGGCACCTCTGCCAGCCTGGCTATTACCGGACTGC AGGCTGAGGACGAGGCCGACTACTACTGCCAGTCCTACGA CTTCTCCCTGTCCGGCTCCGTGTTTGGCGTGGGCACAAAGC TGACAGTCCTG PSMB3003 VD000 CAGTCTGCTCTGACCCAGCCTCCTTCTGTGTCTGGCGCTCC 71 060769 TGGCCAGAGAGTGACCATCTCTTGTACCGGCTCCAACTCC _VL AACATCGGCGCCAACTACGACGTGCACTGGTATCAGCATC TGCCCGGCACAGCTCCCAAGCTGCTGATCTACGGCAACAT CAACAGACCCCTGGGCGTGCCCGACCGGTTTTCTGGAAGC AGATCTGGCACCTCTGCCAGCCTGGCTATTACCGGACTGC AGGCTGAGGACGAGGCCGACTACTACTGCCAGTCCTACGA CTTCTCCCTGTCCGGCTCCGTGTTTGGCGTGGGCACAAAGC TGACAGTCCTG PSMB1157 VD000 CAGTCTGTGCTGACCCAGCCTCCTTCTGTGTCTGGCGCTCC 73 058301 TGGCCAGAGAGTGACCATCTCCTGTACCGGCTCCTCCTCT _VL AACATCGGCGCTGACTACGACGTGCACTGGTATCAGCAGC TGCCTGGCACAGCTCCCAAACTGCTGATCTACGTGAACAA CAACCGGCCTTCTGGCGTGCCCGACAGATTCTCTGGAAGC AGATCTGGCACCTCTGCCAGCCTGGCTATTACCGGACTGC AGGCCGATGACGAGGCCGACTACTACTGCCAGTCCTACGA CAACACCCTGTCCGGCGTTGTGTTTGGCGGCGGAACAAAG CTGACAGTCCTG PSMB1156 VD000 CAGGCTGTTCTGACCCAGCCTCCTTCTGCTTCTGGCACCCC 75 060670 TGGACAGAGAGTGACCATCTCTTGCTCCGGCTCCTCCTCC _VL AACATCGGCTCCAACTACGTGTACTGGTACCAGCTGCTGC CCGGCACCGCTCCTAAGCTGCTGATCTACTCCAACAACCA GCGGCCTTCTGGCGTGCCCGATAGATTCTCCGGCTCTAAG TCTGGCACCTCTGCCAGCCTGGCTATCTCCGGACTGAGAT CTGAGGACGAGGCCGACTACTACTGCGCCGCCAGAGATG ATTCCCTGTCCGGCTATGTGTTTGGCACCGGCACCAAGCT GACAGTGTTG PSMB1088 VD000 GAAATAGTGATGACGCAGTCTCCATCCTCCCTGTCTGCAT 77 060755 CTGTAGGAGACAGAGTCACCATCACTTGCCGGGCGAGTCA _VL GGGCATTAGCAATTATTTAGCCTGGTATCAGCAGAAACCA GGGAAAGTTCCTAAGCTCCTGATCTATGCCACATCCACTTT GCAATCAGGGGTCCCATCTCGGTTCAGTGGCAGTGGATCT GGGACAGATTTCATTCTCACCATCAGCAGCCTGCAGCCTG AAGATGTTGCAAACTATTACTGTCAAAAGTATAACAGTGC CCCATTCACTTTCGGCCCTGGGACCAAGGTGGAGATCAAA PSMB1098 VD000 GAAATAGTGATGACGCAGTCTCCAGCCACCCTGTCTGTGT 79 060599 CTCCAGGGGAAAGAGCCACCCTCTCCTGCAGGGCCAGTCA _VL GAGTGTAAGGAGCAACTTAGCCTGGTACCAGCAGAAACCT GGCCAGGCTCCCAGGCTCCTCATCTATGGTGCATCCACCA GGGCCACTGGTATCCCAGCCAGGTTCAGTGGCAGTGGGTC TGGGACAGAGTTCACTCTCACCATCAGCAGCCTGCAGTCT GAAGATTTTGCAGTTTATTACTGTCACCAGTATAATGACTG GCCTCCGTACACTTTTGGCCAAGGGACCAAGGTGGAAATC AAA PSMB1113 VD000 GAAATAGTGATGACGCAGTCTCCATCCTCCCTGTCTGCAT 81 060669 CTGTAGGAGACAGAGTCACCATCACTTGCCGGGCGAGTCA _VL GGACATTACCAATTTTTTAGCCTGGTATCAGCAGAAACCA GGGAAAGTTCCTAAACTCCTGATTTATACTGCATCCACTTT GCAATCAGGGGTCCCATCTCGGTTCAGTGGCAGTGGATCT GGGACAGATTTCACTCTCACCATCAGCAGCCTGCAGCCTG AAGATGTTGCGACTTATTACTGTCAAAAGTATAACAGTGC CCCACTCACTTTCGGCGGAGGGACCAAGCTGGAGATCAAA PSMB1195 VD000 GACATCGTGATGACCCAGTCTCCATCTTCCGTGTCTGCATC 83 060787 TGTAGGAGACAGAGTCACCATCACTTGTCGGGCGAGTCAA _VL GGTATTAGCAACTGGTTAGCCTGGTATCAGCAGAAACCAG GGAAAGCCCCTAAGCTCCTGATCTATGTTGCATCCAGTTT GCAAAGTGGGGTTCCATCAAGGTTCAGCGGCAGTGGATCT GGGACAGATTTCTCTCTCACCATCAGCAGCCTGCAGCCTG AAGATTTTGCAACTTACTATTGTCAACAGGCTTACAGTTTC CCTCTCACTTTCGGCGGAGGGACCAAGGTGGAGATCAAA

    TABLE-US-00018 TABLE 15 HC amino acid sequence of selected anti-PSMA antibodies HC HC PROTEIN PEPTIDE SEQ ID Antibody ID NO: HC AMINO ACID SEQUENCE PSMB1154 DCH0000 84 EVQLVESGGGEVQPGRSLRLTCAVSGFTLSRYGMHW 13726 VRQAPGKGLEWAALISYDGSNRYYADSVKGRFTISR DNSKNTVFLQMNSLRAEDTAVYYCARERESSGWFEG YFDYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGT AALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ SSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVD KKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDT LMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHN AKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKC KVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMT KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP VLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEAL HNHYTQKSLSLSPGK PSMB2945 DCH0000 86 EVQLVESGGGEVQPGRSLRLTCAVSGFTLSRYGMHW 18816 VRQAPGKGLEWAALISYDGSNRYYADSVKGRFTISR DNSKNTVFLQMNSLRAEDTAVYYCARERESSGWFEG YFDYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGT AALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ SSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVD KKVEPKSCDKTHTCPPCPAPEAAGGPSVFLFPPKPKD TLYITREPEVTCVVVSVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYK CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEM TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP PVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEA LHNHYTQKSLSLSPGK PSMB1183 DCH0000 88 QVQLQESGPGLVKSSETLSLTCTVSGGSISSYYWNWI 13720 RQPAGKGLEWIGRIYSSGNTDYNPSLKSRVTMSVDTS KNQFSLKLISVTAADTAVYYCARGRGANVGLFDYW GQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGC LVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYS LSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK SCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRT PEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKP REEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNK ALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVS LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYT QKSLSLSPGK PSMB3003 DCH0000 90 QVQLQESGPGLVKSSETLSLTCTVSGGSISSYYWNWI 21551 RQPAGKGLEWIGRIYSSGNTDYNPSLKSRVTMSVDTS KNQFSLKLISVTAADTAVYYCARGRGANVGLFDYW GQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGC LVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYS LSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK SCDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLYITRE PEVTCVVVSVSHEDPEVKFNWYVDGVEVHNAKTKP REEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNK ALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVS LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYT QKSLSLSPGK PSMB1157 DCH0000 92 EVQLVESGGGVVQPGRSLRLSCAASVRTFSGYGMHW 13724 VRQVPGKGLEWVAVISYDGSNRYYADSVKGRFTISR DNSKNTLYLQMNSLRTEDTAVYYCARDGNWGSLDL YFDLWGRGTLVTVSSASTKGPSVFPLAPSSKSTSGGT AALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ SSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVD KKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDT LMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHN AKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKC KVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMT KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP VLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEAL HNHYTQKSLSLSPGK PSMB1156 DCH0000 94 EVQLVESGGGVVQPGRSLRLSCAASGFTFTSYGMHW 13725 VRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISR DNSKNTLYLQMNSLRAEDTAVYYCAREHYDSSGYY HGYYGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKS TSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTF PAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSN TKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPP KPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG VEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPS REEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENN YKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSV MHEALHNHYTQKSLSLSPGK PSMB1088 DCH0000 96 EVQLVESGGGVVQPGRSLRLSCAASGFTFSSYDMHW 17968 VRQAPGKGLEWVTVISFDGSNKYYVDSVKGRFTISR DNSKNTLYLQMNSLRAEDTAVYYCARTYYDILTGYS HYSYGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKS TSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTF PAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSN TKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPP KPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG VEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPS REEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENN YKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSV MHEALHNHYTQKSLSLSPGK PSMB1098 DCH0000 98 QVQLVESGGGVVQPGRSLRLSCAASGFTFSTYGMHW 19327 VRQAPGKGLEWVAFISYDGSNKYYADSVKGRFTISR DNSKHTLYLQMNSLRAEDTAVYYCAGRDNLRFLEW FMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGT AALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ SSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVD KKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDT LMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHN AKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKC KVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMT KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP VLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEAL HNHYTQKSLSLSPGK PSMB1113 DCH0000 100 EVQLVESGGGLVKPGGSLRLSCAASGFTLSIYSMNW 19326 VRQAPGKGLEWVSSISSSSSYIFYADSVKGRFTISRDN AKNSLFLQMNSLRAEDTAVYYCARSSYGADYWGQG TLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVK DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS VVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD KTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP APIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTC LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF FLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQK SLSLSPGK PSMB1195 DCH0000 102 EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSLNWV 17970 RQAPGKGLEWVSSISSSSSYISYADAVKGRFTISRDNA KNSLY LQMNSLRAEDTAVYYCARDRGFLEDYYYYY GMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGT AALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ SSGLYSL SSVVTVPSSSLGTQTYICNVNHKPSNTKVD KKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDT LMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHN AKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKC KVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMT KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP VLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEAL HNHYTQKSLSLSPGK

    TABLE-US-00019 TABLE 16 LC amino acid sequences of selected anti-PSMA antibodies. LC LC PROTEIN PEPTIDE SEQID ANTIBODY ID NO: LC AMINO ACID SEQUENCE PSMB1154 DCH00001 85 QLVLTQPPSVSVAPGQTARITCGGNNIGSKSVHW 0369 YQQKPGQAPVLVVYDNSDRPSGIPERFSGSNSGN TATLTISRVEVGDEADYYCQVWDSSSDHVVFGG GTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVC LISDFYPGAVTVAWKADSSPVKAGVETTTPSKQS NNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTV EKTVAPTECS PSMB2945 DCH00001 85 QLVLTQPPSVSVAPGQTARITCGGNNIGSKSVHW 0369 YQQKPGQAPVLVVYDNSDRPSGIPERFSGSNSGN TATLTISRVEVGDEADYYCQVWDSSSDHVVFGG GTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVC LISDFYPGAVTVAWKADSSPVKAGVETTTPSKQS NNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTV EKTVAPTECS PSMB1183 DCH00001 89 QSALTQPPSVSGAPGQRVTISCTGSNSNIGANYDV 0389 HWYQHLPGTAPKLLIYGNINRPLGVPDRFSGSRSG TSASLAITGLQAEDEADYYCQSYDFSLSGSVFGVG TKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCL ISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSN NKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVE KTVAPTECS PSMB3003 DCH00001 89 QSALTQPPSVSGAPGQRVTISCTGSNSNIGANYDV 0389 HWYQHLPGTAPKLLIYGNINRPLGVPDRFSGSRSG TSASLAITGLQAEDEADYYCQSYDFSLSGSVFGVG TKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCL ISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSN NKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVE KTVAPTECS PSMB1157 DCH00001 93 QSVLTQPPSVSGAPGQRVTISCTGSSSNIGADYDV 0372 HWYQQLPGTAPKLLIYVNNNRPSGVPDRFSGSRS GTSASLAITGLQADDEADYYCQSYDNTLSGVVFG GGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLV CLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQ SNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGST VEKTVAPTECS PSMB1156 DCH00001 95 QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNYVY 0371 WYQLLPGTAPKLLIYSNNQRPSGVPDRFSGSKSGT SASLAISGLRSEDEADYYCAARDDSLSGYVFGTG TKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCL ISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSN NKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVE KTVAPTECS PSMB1088 DCH00001 97 EIVMTQSPSSLSASVGDRVTITCRASQGISNYLAW 0211 YQQKPGKVPKLLIYATSTLQSGVPSRFSGSGSGTD FILTISSLQPEDVANYYCQKYNSAPFTFGPGTKVEI KRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYP REAKVQWKVDNALQSGNSQESVTEQDSKDSTYS LSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKS FNRGEC PSMB1098 DCH00001 99 EIVMTQSPATLSVSPGERATLSCRASQSVRSNLAW 0229 YQQKP GQAPRLLIYGASTRATGIPARFSGSGSGTE FTLTISSLQSEDFAVYYCHQYNDWPPYTFGQGTK VEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNF YPREAKVQWKVDNALQSGNSQESVTEQDSKDST YSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVT KSFNRGEC PSMB1113 DCH00001 101 EIVMTQSPSSLSASVGDRVTITCRASQDITNFLAW 0258 YQQKPGKVPKLLIYTASTLQSGVPSRFSGSGSGTD FTLTISSLQPEDVATYYCQKYNSAPLTFGGGTKLE IKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYP REAKVQWKVDNALQSGNSQESVTEQDSKDSTYS LSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKS FNRGEC PSMB1195 DCH00001 103 DIVMTQSPSSVSASVGDRVTITCRASQGISNWLA 0366 WYQQKPGKAPKLLIYVASSLQSGVPSRFSGSGSG TDFSLTISSLQPEDFATYYCQQAYSFPLTFGGGTK VEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNF YPREAKVQWKVDNALQSGNSQESVTEQDSKDST YSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVT KSFNRGEC

    TABLE-US-00020 TABLE 17 HC nucleotide sequences of selected anti-PSMA antibodies. HC NUCLEOTIDE Antibody SEQ ID NO: HC NUCLEIC ACID SEQUENCE PSMB1154 104 GAGGTGCAGCTGGTTGAATCTGGTGGCGGAGAAGTGCAGC CTGGCAGATCTCTGAGACTGACCTGTGCTGTGTCCGGCTTC ACCCTGTCCAGATACGGAATGCACTGGGTCCGACAGGCCC CTGGCAAAGGATTGGAATGGGCCGCTCTGATCTCCTACGAC GGCTCCAATAGGTACTACGCCGACTCCGTGAAGGGCAGAT TCACCATCTCTCGGGACAACTCCAAGAACACCGTGTTTCTG CAGATGAACTCCCTGAGAGCCGAGGACACCGCCGTGTACT ACTGTGCCAGAGAGCGGGAATCCTCCGGCTGGTTCGAGGG CTACTTCGACTATTGGGGCCAGGGCACCACAGTGACCGTTT CTTCTGCCTCCACCAAGGGCCCATCGGTCTTCCCCCTGGCA CCCTCCTCCAAGAGCACCTCTGGGGGCACAGCGGCCCTGG GCTGCCTGGTCAAGGACTACTTCCCCGAACCGGTGACGGTG TCGTGGAACTCAGGCGCCCTGACCAGCGGCGTGCACACCTT CCCGGCTGTCCTACAGTCCTCAGGACTCTACTCCCTCAGCA GCGTGGTGACCGTGCCCTCCAGCAGCTTGGGCACCCAGACC TACATCTGCAACGTGAATCACAAGCCCAGCAACACCAAGG TGGACAAGAAAGTTGAGCCCAAATCTTGTGACAAAACTCA CACATGCCCACCGTGCCCAGCACCTGAACTCCTGGGGGGA CCGTCAGTCTTCCTCTTCCCCCCAAAACCCAAGGACACCCT CATGATCTCCCGGACCCCTGAGGTCACATGCGTGGTGGTGG ACGTGAGCCACGAAGACCCTGAGGTCAAGTTCAACTGGTA CGTGGACGGCGTGGAGGTGCATAATGCCAAGACAAAGCCG CGGGAGGAGCAGTACAACAGCACGTACCGTGTGGTCAGCG TCCTCACCGTCCTGCACCAGGACTGGCTGAATGGCAAGGA GTACAAGTGCAAGGTGTCCAACAAAGCCCTCCCAGCCCCC ATCGAGAAAACCATCTCCAAAGCCAAAGGGCAGCCCCGAG AACCACAGGTGTACACCCTGCCCCCATCCCGGGAGGAGAT GACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGC TTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATG GGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCT GGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCG TGGACAAGAGCAGATGGCAGCAGGGGAACGTCTTCTCATG CTCCGTGATGCATGAGGCTCTGCACAACCACTACACGCAGA AGTCTCTCTCCCTGTCTCCGGGAAAA PSMB2945 106 GAGGTGCAGCTGGTTGAATCTGGTGGCGGAGAAGTGCAGC CTGGCAGATCTCTGAGACTGACCTGTGCTGTGTCCGGCTTC ACCCTGTCCAGATACGGAATGCACTGGGTCCGACAGGCCC CTGGCAAAGGATTGGAATGGGCCGCTCTGATCTCCTACGAC GGCTCCAATAGGTACTACGCCGACTCCGTGAAGGGCAGAT TCACCATCTCTCGGGACAACTCCAAGAACACCGTGTTTCTG CAGATGAACTCCCTGAGAGCCGAGGACACCGCCGTGTACT ACTGTGCCAGAGAGCGGGAATCCTCCGGCTGGTTCGAGGG CTACTTCGACTATTGGGGCCAGGGCACCACAGTGACCGTTT CTTCTGCCTCCACCAAGGGCCCATCGGTCTTCCCCCTGGCA CCCTCCTCCAAGAGCACCTCTGGGGGCACAGCGGCCCTGG GCTGCCTGGTCAAGGACTACTTCCCCGAACCGGTGACGGTG TCGTGGAACTCAGGCGCCCTGACCAGCGGCGTGCACACCTT CCCGGCTGTCCTACAGTCCTCAGGACTCTACTCCCTCAGCA GCGTGGTGACCGTGCCCTCCAGCAGCTTGGGCACCCAGACC TACATCTGCAACGTGAATCACAAGCCCAGCAACACCAAGG TGGACAAGAAAGTTGAGCCCAAATCTTGTGACAAAACTCA CACATGCCCACCGTGCCCAGCACCTGAAGCCGCCGGGGGA CCGTCAGTCTTCCTCTTCCCCCCAAAACCCAAGGACACCCT CTACATCACCCGGGAGCCTGAGGTCACATGCGTGGTGGTG AGCGTGAGCCACGAAGACCCTGAGGTCAAGTTCAACTGGT ACGTGGACGGCGTGGAGGTGCATAATGCCAAGACAAAGCC GCGGGAGGAGCAGTACAACAGCACGTACCGTGTGGTCAGC GTCCTCACCGTCCTGCACCAGGACTGGCTGAATGGCAAGG AGTACAAGTGCAAGGTGTCGAACAAAGCCCTCCCAGCCCC CATCGAGAAAACCATCTCCAAAGCCAAAGGGCAGCCCCGA GAACCACAGGTGTACACCCTGCCCCCATCCCGGGAGGAGA TGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGG CTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAAT GGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGC TGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACC GTGGACAAGAGCAGATGGCAGCAGGGGAACGTCTTCTCAT GCTCCGTGATGCATGAGGCTCTGCACAACCACTACACGCAG AAGTCTCTCTCCCTGTCTCCGGGAAAA PSMB1183 108 CAGGTGCAGCTGCAAGAGTCTGGACCTGGCCTGGTCAAGT CCTCCGAGACACTGTCTCTGACCTGCACCGTGTCTGGCGGC TCCATCTCCTCCTACTACTGGAACTGGATCAGACAGCCTGC CGGCAAAGGCCTGGAATGGATCGGCAGAATCTACTCCTCC GGCAACACCGACTACAACCCCAGCCTGAAGTCCAGAGTGA CCATGTCCGTGGACACCTCCAAGAACCAGTTCTCCCTGAAG CTGATCTCCGTGACCGCCGCTGATACCGCCGTGTACTATTG TGCTAGAGGCAGAGGCGCCAACGTGGGCCTGTTTGATTATT GGGGCCAGGGCACCCTGGTCACCGTTTCTTCTGCCTCCACC AAGGGCCCATCGGTCTTCCCCCTGGCACCCTCCTCCAAGAG CACCTCTGGGGGCACAGCGGCCCTGGGCTGCCTGGTCAAG GACTACTTCCCCGAACCGGTGACGGTGTCGTGGAACTCAGG CGCCCTGACCAGCGGCGTGCACACCTTCCCGGCTGTCCTAC AGTCCTCAGGACTCTACTCCCTCAGCAGCGTGGTGACCGTG CCCTCCAGCAGCTTGGGCACCCAGACCTACATCTGCAACGT GAATCACAAGCCCAGCAACACCAAGGTGGACAAGAAAGTT GAGCCCAAATCTTGTGACAAAACTCACACATGCCCACCGTG CCCAGCACCTGAACTCCTGGGGGGACCGTCAGTCTTCCTCT TCCCCCCAAAACCCAAGGACACCCTCATGATCTCCCGGACC CCTGAGGTCACATGCGTGGTGGTGGACGTGAGCCACGAAG ACCCTGAGGTCAAGTTCAACTGGTACGTGGACGGCGTGGA GGTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTAC AACAGCACGTACCGTGTGGTCAGCGTCCTCACCGTCCTGCA CCAGGACTGGCTGAATGGCAAGGAGTACAAGTGCAAGGTG TCCAACAAAGCCCTCCCAGCCCCCATCGAGAAAACCATCTC CAAAGCCAAAGGGCAGCCCCGAGAACCACAGGTGTACACC CTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCA GCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATC GCCGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACT ACAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTCCTTC TTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGATGGC AGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCT CTGCACAACCACTACACGCAGAAGTCTCTCTCCCTGTCTCC GGGAAAA PSMB3003 110 CAGGTGCAGCTGCAAGAGTCTGGACCTGGCCTGGTCAAGT CCTCCGAGACACTGTCTCTGACCTGCACCGTGTCTGGCGGC TCCATCTCCTCCTACTACTGGAACTGGATCAGACAGCCTGC CGGCAAAGGCCTGGAATGGATCGGCAGAATCTACTCCTCC GGCAACACCGACTACAACCCCAGCCTGAAGTCCAGAGTGA CCATGTCCGTGGACACCTCCAAGAACCAGTTCTCCCTGAAG CTGATCTCCGTGACCGCCGCTGATACCGCCGTGTACTATTG TGCTAGAGGCAGAGGCGCCAACGTGGGCCTGTTTGATTATT GGGGCCAGGGCACCCTGGTCACCGTTTCTTCTGCCTCCACC AAGGGCCCATCGGTCTTCCCCCTGGCACCCTCCTCCAAGAG CACCTCTGGGGGCACAGCGGCCCTGGGCTGCCTGGTCAAG GACTACTTCCCCGAACCGGTGACGGTGTCGTGGAACTCAGG CGCCCTGACCAGCGGCGTGCACACCTTCCCGGCTGTCCTAC AGTCCTCAGGACTCTACTCCCTCAGCAGCGTGGTGACCGTG CCCTCCAGCAGCTTGGGCACCCAGACCTACATCTGCAACGT GAATCACAAGCCCAGCAACACCAAGGTGGACAAGAAAGTT GAGCCCAAATCTTGTGACAAAACTCACACATGCCCACCGTG CCCAGCACCTGAAGCCGCCGGGGGACCGTCAGTCTTCCTCT TCCCCCCAAAACCCAAGGACACCCTCTACATCACCCGGGA GCCTGAGGTCACATGCGTGGTGGTGAGCGTGAGCCACGAA GACCCTGAGGTCAAGTTCAACTGGTACGTGGACGGCGTGG AGGTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTA CAACAGCACGTACCGTGTGGTCAGCGTCCTCACCGTCCTGC ACCAGGACTGGCTGAATGGCAAGGAGTACAAGTGCAAGGT GTCGAACAAAGCCCTCCCAGCCCCCATCGAGAAAACCATC TCCAAAGCCAAAGGGCAGCCCCGAGAACCACAGGTGTACA CCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGT CAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACA TCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAA CTACAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTCCT TCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGATGG CAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGC TCTGCACAACCACTACACGCAGAAGTCTCTCTCCCTGTCTC CGGGAAAA PSMB1157 112 GAGGTGCAGCTGGTTGAATCTGGTGGCGGAGTGGTGCAGC CTGGCAGATCTCTGAGACTGTCTTGTGCCGCTTCCGTGCGG ACCTTCTCTGGCTACGGAATGCACTGGGTCCGACAGGTGCC AGGCAAAGGACTGGAATGGGTGGCCGTGATCTCCTACGAT GGCTCCAATCGGTACTACGCCGACTCCGTGAAGGGCAGATT CACCATCTCTCGGGACAACTCCAAGAACACCCTGTACCTGC AGATGAACTCCCTGCGGACCGAGGATACCGCCGTGTACTA CTGTGCCAGAGATGGCAACTGGGGCTCCCTGGACCTGTACT TCGATCTCTGGGGACGGGGCACCCTGGTCACAGTCTCTTCT GCCTCCACCAAGGGCCCATCGGTCTTCCCCCTGGCACCCTC CTCCAAGAGCACCTCTGGGGGCACAGCGGCCCTGGGCTGC CTGGTCAAGGACTACTTCCCCGAACCGGTGACGGTGTCGTG GAACTCAGGCGCCCTGACCAGCGGCGTGCACACCTTCCCG GCTGTCCTACAGTCCTCAGGACTCTACTCCCTCAGCAGCGT GGTGACCGTGCCCTCCAGCAGCTTGGGCACCCAGACCTACA TCTGCAACGTGAATCACAAGCCCAGCAACACCAAGGTGGA CAAGAAAGTTGAGCCCAAATCTTGTGACAAAACTCACACA TGCCCACCGTGCCCAGCACCTGAACTCCTGGGGGGACCGTC AGTCTTCCTCTTCCCCCCAAAACCCAAGGACACCCTCATGA TCTCCCGGACCCCTGAGGTCACATGCGTGGTGGTGGACGTG AGCCACGAAGACCCTGAGGTCAAGTTCAACTGGTACGTGG ACGGCGTGGAGGTGCATAATGCCAAGACAAAGCCGCGGGA GGAGCAGTACAACAGCACGTACCGTGTGGTCAGCGTCCTC ACCGTCCTGCACCAGGACTGGCTGAATGGCAAGGAGTACA AGTGCAAGGTGTCCAACAAAGCCCTCCCAGCCCCCATCGA GAAAACCATCTCCAAAGCCAAAGGGCAGCCCCGAGAACCA CAGGTGTACACCCTGCCCCCATCCCGGGAGGAGATGACCA AGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTAT CCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGC CGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTC CGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACA AGAGCAGATGGCAGCAGGGGAACGTCTTCTCATGCTCCGT GATGCATGAGGCTCTGCACAACCACTACACGCAGAAGTCT CTCTCCCTGTCTCCGGGAAAA PSMB1156 114 GAGGTGCAGCTGGTTGAATCTGGTGGCGGAGTGGTGCAGC CTGGCAGATCTCTGAGACTGTCTTGTGCCGCCTCCGGCTTC ACCTTCACCAGCTACGGAATGCACTGGGTCCGACAGGCCCC TGGCAAAGGATTGGAATGGGTGGCCGTGATCTCCTACGAC GGCTCCAACAAGTACTACGCCGACTCCGTGAAGGGCAGAT TCACCATCTCTCGGGACAACTCCAAGAACACCCTGTACCTG CAGATGAACTCCCTGAGAGCCGAGGACACCGCCGTGTACT ACTGTGCCAGAGAGCACTACGACTCCTCCGGCTACTACCAC GGCTACTATGGCATGGATGTGTGGGGCCAGGGCACCACAG TGACAGTCTCTTCCGCCTCCACCAAGGGCCCATCGGTCTTC CCCCTGGCACCCTCCTCCAAGAGCACCTCTGGGGGCACAGC GGCCCTGGGCTGCCTGGTCAAGGACTACTTCCCCGAACCGG TGACGGTGTCGTGGAACTCAGGCGCCCTGACCAGCGGCGT GCACACCTTCCCGGCTGTCCTACAGTCCTCAGGACTCTACT CCCTCAGCAGCGTGGTGACCGTGCCCTCCAGCAGCTTGGGC ACCCAGACCTACATCTGCAACGTGAATCACAAGCCCAGCA ACACCAAGGTGGACAAGAAAGTTGAGCCCAAATCTTGTGA CAAAACTCACACATGCCCACCGTGCCCAGCACCTGAACTCC TGGGGGGACCGTCAGTCTTCCTCTTCCCCCCAAAACCCAAG GACACCCTCATGATCTCCCGGACCCCTGAGGTCACATGCGT GGTGGTGGACGTGAGCCACGAAGACCCTGAGGTCAAGTTC AACTGGTACGTGGACGGCGTGGAGGTGCATAATGCCAAGA CAAAGCCGCGGGAGGAGCAGTACAACAGCACGTACCGTGT GGTCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTGAATG GCAAGGAGTACAAGTGCAAGGTGTCCAACAAAGCCCTCCC AGCCCCCATCGAGAAAACCATCTCCAAAGCCAAAGGGCAG CCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGG AGGAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGT CAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAG AGCAATGGGCAGCCGGAGAACAACTACAAGACCACGCCTC CCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAG CTCACCGTGGACAAGAGCAGATGGCAGCAGGGGAACGTCT TCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCACTAC ACGCAGAAGTCTCTCTCCCTGTCTCCGGGAAAA PSMB1088 116 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGCGTGGTCCAGC CTGGGAGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTC ACCTTCAGTAGTTATGACATGCACTGGGTCCGCCAGGCTCC AGGCAAGGGGCTGGAGTGGGTGACAGTTATATCATTTGAT GGAAGTAATAAATACTATGTAGACTCCGTGAAGGGCCGAT TCACCATCTCCAGAGACAATTCCAAGAATACGCTGTATCTG CAAATGAACAGCCTGAGAGCTGAGGACACGGCTGTGTATT ACTGTGCGAGAACGTATTACGATATTTTGACTGGTTATTCC CACTACTCCTACGGTATGGACGTCTGGGGCCAAGGGACCA CGGTCACCGTCTCCTCAGCCTCCACCAAGGGCCCATCGGTC TTCCCCCTGGCACCCTCCTCCAAGAGCACCTCTGGGGGCAC AGCGGCCCTGGGCTGCCTGGTCAAGGACTACTTCCCCGAAC CGGTGACGGTGTCGTGGAACTCAGGCGCCCTGACCAGCGG CGTGCACACCTTCCCGGCTGTCCTACAGTCCTCAGGACTCT ACTCCCTCAGCAGCGTGGTGACCGTGCCCTCCAGCAGCTTG GGCACCCAGACCTACATCTGCAACGTGAATCACAAGCCCA GCAACACCAAGGTGGACAAGAAAGTTGAGCCCAAATCTTG TGACAAAACTCACACATGCCCACCGTGCCCAGCACCTGAA CTCCTGGGGGGACCGTCAGTCTTCCTCTTCCCCCCAAAACC CAAGGACACCCTCATGATCTCCCGGACCCCTGAGGTCACAT GCGTGGTGGTGGACGTGAGCCACGAAGACCCTGAGGTCAA GTTCAACTGGTACGTGGACGGCGTGGAGGTGCATAATGCC AAGACAAAGCCGCGGGAGGAGCAGTACAACAGCACGTACC GTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTG AATGGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGCCC TCCCAGCCCCCATCGAGAAAACCATCTCCAAAGCCAAAGG GCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCC GGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCTGCCT GGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGG GAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCACGC CTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGC AAGCTCACCGTGGACAAGAGCAGATGGCAGCAGGGGAACG TCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCAC TACACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAA PSMB1098 118 CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCGTGGTCCAGC CTGGGAGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTC ACCTTCAGTACCTATGGCATGCACTGGGTCCGCCAGGCTCC AGGCAAGGGGCTGGAGTGGGTGGCATTTATATCATATGAT GGAAGTAATAAATACTATGCAGACTCCGTGAAGGGCCGAT TCACCATCTCCAGAGACAATTCCAAGCACACGCTATATCTG CAAATGAACAGCCTGAGAGCTGAGGACACGGCTGTGTATT ACTGTGCGGGGAGAGACAACCTACGATTTTTGGAGTGGTTT ATGGACGTCTGGGGCCAAGGGACCACGGTCACCGTCTCTTC AGCCTCCACCAAGGGCCCATCGGTCTTCCCCCTGGCACCCT CCTCCAAGAGCACCTCTGGGGGCACAGCGGCCCTGGGCTG CCTGGTCAAGGACTACTTCCCCGAACCGGTGACGGTGTCGT GGAACTCAGGCGCCCTGACCAGCGGCGTGCACACCTTCCC GGCTGTCCTACAGTCCTCAGGACTCTACTCCCTCAGCAGCG TGGTGACCGTGCCCTCCAGCAGCTTGGGCACCCAGACCTAC ATCTGCAACGTGAATCACAAGCCCAGCAACACCAAGGTGG ACAAGAAAGTTGAGCCCAAATCTTGTGACAAAACTCACAC ATGCCCACCGTGCCCAGCACCTGAACTCCTGGGGGGACCGT CAGTCTTCCTCTTCCCCCCAAAACCCAAGGACACCCTCATG ATCTCCCGGACCCCTGAGGTCACATGCGTGGTGGTGGACGT GAGCCACGAAGACCCTGAGGTCAAGTTCAACTGGTACGTG GACGGCGTGGAGGTGCATAATGCCAAGACAAAGCCGCGGG AGGAGCAGTACAACAGCACGTACCGTGTGGTCAGCGTCCT CACCGTCCTGCACCAGGACTGGCTGAATGGCAAGGAGTAC AAGTGCAAGGTCTCCAACAAAGCCCTCCCAGCCCCCATCG AGAAAACCATCTCCAAAGCCAAAGGGCAGCCCCGAGAACC ACAGGTGTACACCCTGCCCCCATCCCGGGAGGAGATGACC AAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTA TCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCAG CCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACT CCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGAC AAGAGCAGATGGCAGCAGGGGAACGTCTTCTCATGCTCCG TGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAG CCTCTCCCTGTCTCCGGGTAAA PSMB1113 120 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGCCTGGTCAAGC CGGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTC ACCCTCAGTATTTATAGCATGAACTGGGTCCGCCAGGCTCC AGGGAAGGGGCTGGAGTGGGTCTCATCCATTAGCAGTAGT AGTAGTTACATATTCTACGCAGACTCAGTGAAGGGCCGATT CACCATCTCCAGAGACAACGCCAAGAACTCACTCTTTCTGC AAATGAACAGCCTGAGAGCCGAGGACACGGCTGTGTATTA CTGTGCGAGATCCTCCTACGGTGCGGACTACTGGGGCCAGG GAACCCTGGTCACCGTCTCTTCAGCCTCCACCAAGGGCCCA TCGGTCTTCCCCCTGGCACCCTCCTCCAAGAGCACCTCTGG GGGCACAGCGGCCCTGGGCTGCCTGGTCAAGGACTACTTCC CCGAACCGGTGACGGTGTCGTGGAACTCAGGCGCCCTGAC CAGCGGCGTGCACACCTTCCCGGCTGTCCTACAGTCCTCAG GACTCTACTCCCTCAGCAGCGTGGTGACCGTGCCCTCCAGC AGCTTGGGCACCCAGACCTACATCTGCAACGTGAATCACA AGCCCAGCAACACCAAGGTGGACAAGAAAGTTGAGCCCAA ATCTTGTGACAAAACTCACACATGCCCACCGTGCCCAGCAC CTGAACTCCTGGGGGGACCGTCAGTCTTCCTCTTCCCCCCA AAACCCAAGGACACCCTCATGATCTCCCGGACCCCTGAGGT CACATGCGTGGTGGTGGACGTGAGCCACGAAGACCCTGAG GTCAAGTTCAACTGGTACGTGGACGGCGTGGAGGTGCATA ATGCCAAGACAAAGCCGCGGGAGGAGCAGTACAACAGCAC GTACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACT GGCTGAATGGCAAGGAGTACAAGTGCAAGGTCTCCAACAA AGCCCTCCCAGCCCCCATCGAGAAAACCATCTCCAAAGCC AAAGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCC CATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGAC CTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGG AGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGA CCACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCT ACAGCAAGCTCACCGTGGACAAGAGCAGATGGCAGCAGGG GAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACA ACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAA PSMB1195 122 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGCCTGGTCAAGC CTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTC ACCTTCAGCAGCTATAGCCTGAACTGGGTCCGCCAGGCTCC AGGGAAGGGGCTGGAGTGGGTCTCATCCATTAGTAGTAGT AGTAGTTACATATCCTACGCAGACGCAGTGAAGGGCCGAT TCACCATCTCCAGAGACAACGCCAAGAACTCACTGTATCTG CAAATGAACAGCCTGAGAGCCGAGGACACGGCTGTGTATT ACTGTGCGAGAGATCGGGGATTTTTGGAGGATTACTACTAC TACTACGGTATGGACGTCTGGGGCCAAGGGACCACGGTCA CCGTCTCCTCAGCCTCCACCAAGGGCCCATCGGTCTTCCCC CTGGCACCCTCCTCCAAGAGCACCTCTGGGGGCACAGCGG CCCTGGGCTGCCTGGTCAAGGACTACTTCCCCGAACCGGTG ACGGTGTCGTGGAACTCAGGCGCCCTGACCAGCGGCGTGC ACACCTTCCCGGCTGTCCTACAGTCCTCAGGACTCTACTCC CTCAGCAGCGTGGTGACCGTGCCCTCCAGCAGCTTGGGCAC CCAGACCTACATCTGCAACGTGAATCACAAGCCCAGCAAC ACCAAGGTGGACAAGAAAGTTGAGCCCAAATCTTGTGACA AAACTCACACATGCCCACCGTGCCCAGCACCTGAACTCCTG GGGGGACCGTCAGTCTTCCTCTTCCCCCCAAAACCCAAGGA CACCCTCATGATCTCCCGGACCCCTGAGGTCACATGCGTGG TGGTGGACGTGAGCCACGAAGACCCTGAGGTCAAGTTCAA CTGGTACGTGGACGGCGTGGAGGTGCATAATGCCAAGACA AAGCCGCGGGAGGAGCAGTACAACAGCACGTACCGTGTGG TCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTGAATGGC AAGGAGTACAAGTGCAAGGTCTCCAACAAAGCCCTCCCAG CCCCCATCGAGAAAACCATCTCCAAAGCCAAAGGGCAGCC CCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGAG GAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCA AAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAG CAATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCC GTGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCT CACCGTGGACAAGAGCAGATGGCAGCAGGGGAACGTCTTC TCATGCTCCGTGATGCATGAGGCTCTGCACAACCACTACAC GCAGAAGAGCCTCTCCCTGTCTCCGGGTAAA

    TABLE-US-00021 TABLE 18 LC nucleotide sequences of selected anti-PSMA antibodies. LC NUCLEOTIDE ANTIBODY SEQ ID NO: LC NUCLEIC ACID SEQUENCE PSMB1154 105 CAGCTGGTTCTGACCCAGCCTCCTTCTGTGTCTGTGGCTCCT GGCCAGACCGCCAGAATTACCTGTGGCGGCAACAACATCG GCTCCAAGTCCGTGCACTGGTATCAGCAGAAGCCTGGACA GGCTCCTGTGCTGGTGGTGTACGACAACTCTGACCGGCCTT CTGGCATCCCTGAGAGATTCTCCGGCTCCAACAGCGGCAAT ACCGCCACACTGACCATCTCCAGAGTGGAAGTGGGCGACG AGGCCGACTACTACTGCCAAGTGTGGGACTCCTCCTCCGAT CATGTGGTGTTTGGCGGCGGAACAAAGCTGACAGTGCTGG GTCAGCCCAAGGCTGCACCCAGTGTCACTCTGTTCCCGCCC TCCTCTGAGGAGCTTCAAGCCAACAAGGCCACACTGGTGTG TCTCATAAGTGACTTCTACCCGGGAGCCGTGACAGTGGCCT GGAAGGCCGATAGCAGCCCCGTCAAGGCGGGAGTCGAAAC CACCACACCCTCCAAACAAAGCAACAACAAGTACGCGGCC AGCAGCTATCTGAGCCTGACGCCTGAGCAGTGGAAGTCCC ACAGAAGCTACAGCTGCCAGGTCACGCATGAAGGGAGCAC CGTGGAGAAGACAGTGGCCCCTACAGAATGTTCA PSMB2945 105 CAGCTGGTTCTGACCCAGCCTCCTTCTGTGTCTGTGGCTCCT GGCCAGACCGCCAGAATTACCTGTGGCGGCAACAACATCG GCTCCAAGTCCGTGCACTGGTATCAGCAGAAGCCTGGACA GGCTCCTGTGCTGGTGGTGTACGACAACTCTGACCGGCCTT CTGGCATCCCTGAGAGATTCTCCGGCTCCAACAGCGGCAAT ACCGCCACACTGACCATCTCCAGAGTGGAAGTGGGCGACG AGGCCGACTACTACTGCCAAGTGTGGGACTCCTCCTCCGAT CATGTGGTGTTTGGCGGCGGAACAAAGCTGACAGTGCTGG GTCAGCCCAAGGCTGCACCCAGTGTCACTCTGTTCCCGCCC TCCTCTGAGGAGCTTCAAGCCAACAAGGCCACACTGGTGTG TCTCATAAGTGACTTCTACCCGGGAGCCGTGACAGTGGCCT GGAAGGCCGATAGCAGCCCCGTCAAGGCGGGAGTCGAAAC CACCACACCCTCCAAACAAAGCAACAACAAGTACGCGGCC AGCAGCTATCTGAGCCTGACGCCTGAGCAGTGGAAGTCCC ACAGAAGCTACAGCTGCCAGGTCACGCATGAAGGGAGCAC CGTGGAGAAGACAGTGGCCCCTACAGAATGTTCA PSMB1183 109 CAGTCTGCTCTGACCCAGCCTCCTTCTGTGTCTGGCGCTCCT GGCCAGAGAGTGACCATCTCTTGTACCGGCTCCAACTCCAA CATCGGCGCCAACTACGACGTGCACTGGTATCAGCATCTGC CCGGCACAGCTCCCAAGCTGCTGATCTACGGCAACATCAAC AGACCCCTGGGCGTGCCCGACCGGTTTTCTGGAAGCAGATC TGGCACCTCTGCCAGCCTGGCTATTACCGGACTGCAGGCTG AGGACGAGGCCGACTACTACTGCCAGTCCTACGACTTCTCC CTGTCCGGCTCCGTGTTTGGCGTGGGCACAAAGCTGACAGT CCTGGGTCAGCCCAAGGCTGCACCCAGTGTCACTCTGTTCC CGCCCTCCTCTGAGGAGCTTCAAGCCAACAAGGCCACACTG GTGTGTCTCATAAGTGACTTCTACCCGGGAGCCGTGACAGT GGCCTGGAAGGCCGATAGCAGCCCCGTCAAGGCGGGAGTC GAAACCACCACACCCTCCAAACAAAGCAACAACAAGTACG CGGCCAGCAGCTATCTGAGCCTGACGCCTGAGCAGTGGAA GTCCCACAGAAGCTACAGCTGCCAGGTCACGCATGAAGGG AGCACCGTGGAGAAGACAGTGGCCCCTACAGAATGTTCA PSMB3003 109 CAGTCTGCTCTGACCCAGCCTCCTTCTGTGTCTGGCGCTCCT GGCCAGAGAGTGACCATCTCTTGTACCGGCTCCAACTCCAA CATCGGCGCCAACTACGACGTGCACTGGTATCAGCATCTGC CCGGCACAGCTCCCAAGCTGCTGATCTACGGCAACATCAAC AGACCCCTGGGCGTGCCCGACCGGTTTTCTGGAAGCAGATC TGGCACCTCTGCCAGCCTGGCTATTACCGGACTGCAGGCTG AGGACGAGGCCGACTACTACTGCCAGTCCTACGACTTCTCC CTGTCCGGCTCCGTGTTTGGCGTGGGCACAAAGCTGACAGT CCTGGGTCAGCCCAAGGCTGCACCCAGTGTCACTCTGTTCC CGCCCTCCTCTGAGGAGCTTCAAGCCAACAAGGCCACACTG GTGTGTCTCATAAGTGACTTCTACCCGGGAGCCGTGACAGT GGCCTGGAAGGCCGATAGCAGCCCCGTCAAGGCGGGAGTC GAAACCACCACACCCTCCAAACAAAGCAACAACAAGTACG CGGCCAGCAGCTATCTGAGCCTGACGCCTGAGCAGTGGAA GTCCCACAGAAGCTACAGCTGCCAGGTCACGCATGAAGGG AGCACCGTGGAGAAGACAGTGGCCCCTACAGAATGTTCA PSMB1157 113 CAGTCTGTGCTGACCCAGCCTCCTTCTGTGTCTGGCGCTCCT GGCCAGAGAGTGACCATCTCCTGTACCGGCTCCTCCTCTAA CATCGGCGCTGACTACGACGTGCACTGGTATCAGCAGCTGC CTGGCACAGCTCCCAAACTGCTGATCTACGTGAACAACAAC CGGCCTTCTGGCGTGCCCGACAGATTCTCTGGAAGCAGATC TGGCACCTCTGCCAGCCTGGCTATTACCGGACTGCAGGCCG ATGACGAGGCCGACTACTACTGCCAGTCCTACGACAACAC CCTGTCCGGCGTTGTGTTTGGCGGCGGAACAAAGCTGACAG TCCTGGGTCAGCCCAAGGCTGCACCCAGTGTCACTCTGTTC CCGCCCTCCTCTGAGGAGCTTCAAGCCAACAAGGCCACACT GGTGTGTCTCATAAGTGACTTCTACCCGGGAGCCGTGACAG TGGCCTGGAAGGCCGATAGCAGCCCCGTCAAGGCGGGAGT CGAAACCACCACACCCTCCAAACAAAGCAACAACAAGTAC GCGGCCAGCAGCTATCTGAGCCTGACGCCTGAGCAGTGGA AGTCCCACAGAAGCTACAGCTGCCAGGTCACGCATGAAGG GAGCACCGTGGAGAAGACAGTGGCCCCTACAGAATGTTCA PSMB1156 115 CAGGCTGTTCTGACCCAGCCTCCTTCTGCTTCTGGCACCCCT GGACAGAGAGTGACCATCTCTTGCTCCGGCTCCTCCTCCAA CATCGGCTCCAACTACGTGTACTGGTACCAGCTGCTGCCCG GCACCGCTCCTAAGCTGCTGATCTACTCCAACAACCAGCGG CCTTCTGGCGTGCCCGATAGATTCTCCGGCTCTAAGTCTGG CACCTCTGCCAGCCTGGCTATCTCCGGACTGAGATCTGAGG ACGAGGCCGACTACTACTGCGCCGCCAGAGATGATTCCCTG TCCGGCTATGTGTTTGGCACCGGCACCAAGCTGACAGTGTT GGGTCAGCCCAAGGCTGCACCCAGTGTCACTCTGTTCCCGC CCTCCTCTGAGGAGCTTCAAGCCAACAAGGCCACACTGGTG TGTCTCATAAGTGACTTCTACCCGGGAGCCGTGACAGTGGC CTGGAAGGCCGATAGCAGCCCCGTCAAGGCGGGAGTCGAA ACCACCACACCCTCCAAACAAAGCAACAACAAGTACGCGG CCAGCAGCTATCTGAGCCTGACGCCTGAGCAGTGGAAGTC CCACAGAAGCTACAGCTGCCAGGTCACGCATGAAGGGAGC ACCGTGGAGAAGACAGTGGCCCCTACAGAATGTTCA PSMB1088 117 GAAATAGTGATGACGCAGTCTCCATCCTCCCTGTCTGCATC TGTAGGAGACAGAGTCACCATCACTTGCCGGGCGAGTCAG GGCATTAGCAATTATTTAGCCTGGTATCAGCAGAAACCAGG GAAAGTTCCTAAGCTCCTGATCTATGCCACATCCACTTTGC AATCAGGGGTCCCATCTCGGTTCAGTGGCAGTGGATCTGGG ACAGATTTCATTCTCACCATCAGCAGCCTGCAGCCTGAAGA TGTTGCAAACTATTACTGTCAAAAGTATAACAGTGCCCCAT TCACTTTCGGCCCTGGGACCAAGGTGGAGATCAAACGTAC GGTGGCTGCACCATCTGTCTTCATCTTCCCGCCATCTGATG AGCAGTTGAAATCTGGAACTGCCTCTGTTGTGTGCCTGCTG AATAACTTCTATCCCAGAGAGGCCAAAGTACAGTGGAAGG TGGATAACGCCCTCCAATCGGGTAACTCCCAGGAGAGTGTC ACAGAGCAGGACAGCAAGGACAGCACCTACAGCCTCAGCA GCACCCTGACGCTGAGCAAAGCAGACTACGAGAAACACAA AGTCTACGCCTGCGAAGTCACCCATCAGGGCCTGAGCTCGC CCGTCACAAAGAGCTTCAACAGGGGAGAGTGT PSMB1098 119 GAAATAGTGATGACGCAGTCTCCAGCCACCCTGTCTGTGTC TCCAGGGGAAAGAGCCACCCTCTCCTGCAGGGCCAGTCAG AGTGTAAGGAGCAACTTAGCCTGGTACCAGCAGAAACCTG GCCAGGCTCCCAGGCTCCTCATCTATGGTGCATCCACCAGG GCCACTGGTATCCCAGCCAGGTTCAGTGGCAGTGGGTCTGG GACAGAGTTCACTCTCACCATCAGCAGCCTGCAGTCTGAAG ATTTTGCAGTTTATTACTGTCACCAGTATAATGACTGGCCTC CGTACACTTTTGGCCAAGGGACCAAGGTGGAAATCAAACG TACGGTGGCTGCACCATCTGTCTTCATCTTCCCGCCATCTGA TGAGCAGTTGAAATCTGGAACTGCCTCTGTTGTGTGCCTGC TGAATAACTTCTATCCCAGAGAGGCCAAAGTACAGTGGAA GGTGGATAACGCCCTCCAATCGGGTAACTCCCAGGAGAGT GTCACAGAGCAGGACAGCAAGGACAGCACCTACAGCCTCA GCAGCACCCTGACGCTGAGCAAAGCAGACTACGAGAAACA CAAAGTCTACGCCTGCGAAGTCACCCATCAGGGCCTGAGCT CGCCCGTCACAAAGAGCTTCAACAGGGGAGAGTGT PSMB1113 121 GAAATAGTGATGACGCAGTCTCCATCCTCCCTGTCTGCATC TGTAGGAGACAGAGTCACCATCACTTGCCGGGCGAGTCAG GACATTACCAATTTTTTAGCCTGGTATCAGCAGAAACCAGG GAAAGTTCCTAAACTCCTGATTTATACTGCATCCACTTTGC AATCAGGGGTCCCATCTCGGTTCAGTGGCAGTGGATCTGGG ACAGATTTCACTCTCACCATCAGCAGCCTGCAGCCTGAAGA TGTTGCGACTTATTACTGTCAAAAGTATAACAGTGCCCCAC TCACTTTCGGCGGAGGGACCAAGCTGGAGATCAAACGTAC GGTGGCTGCACCATCTGTCTTCATCTTCCCGCCATCTGATG AGCAGTTGAAATCTGGAACTGCCTCTGTTGTGTGCCTGCTG AATAACTTCTATCCCAGAGAGGCCAAAGTACAGTGGAAGG TGGATAACGCCCTCCAATCGGGTAACTCCCAGGAGAGTGTC ACAGAGCAGGACAGCAAGGACAGCACCTACAGCCTCAGCA GCACCCTGACGCTGAGCAAAGCAGACTACGAGAAACACAA AGTCTACGCCTGCGAAGTCACCCATCAGGGCCTGAGCTCGC CCGTCACAAAGAGCTTCAACAGGGGAGAGTGT PSMB1195 123 GACATCGTGATGACCCAGTCTCCATCTTCCGTGTCTGCATC TGTAGGAGACAGAGTCACCATCACTTGTCGGGCGAGTCAA GGTATTAGCAACTGGTTAGCCTGGTATCAGCAGAAACCAG GGAAAGCCCCTAAGCTCCTGATCTATGTTGCATCCAGTTTG CAAAGTGGGGTTCCATCAAGGTTCAGCGGCAGTGGATCTG GGACAGATTTCTCTCTCACCATCAGCAGCCTGCAGCCTGAA GATTTTGCAACTTACTATTGTCAACAGGCTTACAGTTTCCCT CTCACTTTCGGCGGAGGGACCAAGGTGGAGATCAAACGTA CGGTGGCTGCACCATCTGTCTTCATCTTCCCGCCATCTGATG AGCAGTTGAAATCTGGAACTGCCTCTGTTGTGTGCCTGCTG AATAACTTCTATCCCAGAGAGGCCAAAGTACAGTGGAAGG TGGATAACGCCCTCCAATCGGGTAACTCCCAGGAGAGTGTC ACAGAGCAGGACAGCAAGGACAGCACCTACAGCCTCAGCA GCACCCTGACGCTGAGCAAAGCAGACTACGAGAAACACAA AGTCTACGCCTGCGAAGTCACCCATCAGGGCCTGAGCTCGC CCGTCACAAAGAGCTTCAACAGGGGAGAGTGT

    TABLE-US-00022 TABLE 19 Summary of anti-PSMA antibody SEQ ID NOs. VH VL HC LC Amino Amino Amino Amino VH VL HC LC Acid Acid Acid Acid cDNA cDNA cDNA cDNA SEQ SEQ SEQ SEQ SEQ SEQ SEQ SEQ Antibody ID NO: ID NO: ID NO: ID NO: ID NO: ID NO: ID NO: ID NO: PSMB1154 52 53 84 85 68 69 104 105 PSMB2945 52 53 86 85 68 69 106 105 PSMB1183 54 55 88 89 70 71 108 109 PSMB3003 54 55 90 89 70 71 110 109 PSMB1157 56 57 92 93 72 73 112 113 PSMB1156 58 59 94 95 74 75 114 115 PSMB1088 60 61 96 97 76 77 116 117 PSMB1098 62 63 98 99 78 79 118 119 PSMB1113 64 65 100 101 80 81 120 121 PSMB1195 66 67 102 103 82 83 122 123

    Example 3. Characterization and Triage of Anti-PSMA Antibodies

    [1147] Analytical Characterization of Anti-PSMA Antibodies

    [1148] The protein concentration for the 96 purified mAb was determined by measuring the absorbance at 280 nm on a NANODROP1000 spectrophotometer or TRINEAN DROPSENSE96 multichannel spectrophotometer and calculated using the extinction coefficient based on the amino acid sequence.

    [1149] SE HPLC of the purified antibodies was performed by running samples on a TOSOH TSKgel BioAssist G3SWxl column, in 0.2 M Na Phosphate pH 6.8 at 1 mL/min on a Waters Alliance HPLC for 20 min. The column effluent was monitored by absorbance at 280 nm. For a molecule to be considered a therapeutic lead, it is critical that it can be produced in substantial amounts with high purity and high yield. Typically, purification losses are higher, and yields are lower with aggregation-prone proteins. The initial monomer percentage is generally considered a good surrogate indicator of the manufacturability of a protein. Table 20 summarizes the SEC data for a subset of selected mAbs—majority of which had >90% monomers post protein A purification suggesting good manufacturability.

    TABLE-US-00023 TABLE 20 Antibody Name SEC (% monomer post protein A) PSMB1154 98.1 PSMB1183 98.6 PSMB1157 90.0 PSMB1156 98.5 PSMB1098 96.4 PSMB1088 96.4 PSMB1113 96.7 PSMB1195 97.4

    Anti-PSMA Antibodies Binding to PSMA Antigen

    [1150] The binding affinity of purified anti-PSMA antibodies to the recombinant human ECD was determined by surface plasmon resonance (SPR) using a BIACORE 8K instrument. The antibodies were captured on a goat anti-Fc antibody-modified C1 chip and titrated with 3-fold serial dilutions of PSMA antigen spanning concentrations of 1 nM to 11.1 nM. The association and dissociation were monitored for 3 and 15 minutes, respectively, using a flow rate of 50 μL/min. Raw binding data was referenced by subtracting the analyte binding signals from blanks and analyzed using a 1:1 Langmuir binding model using the Biacore Insight evaluation software to obtain the kinetics which were used to calculate the binding affinity. The kinetic parameter of binding of selected antibodies are shown in Table 21. The anti-PSMA antibodies were found to bind human PSMA with picomolar to nanomolar affinities.

    TABLE-US-00024 TABLE 21 Antibody Name Kon (1/Ms) Koff (1/s) SPR KD (M) PSMB1154 1.74E+05 1.90E−04 1.09E−09 PSMB1183 4.32E+05 4.01E−04 9.28E−10 PSMB1157 1.94E+05 2.74E−04 1.42E−09 PSMB1156 3.06E+05 1.68E−04 5.48E−10 PSMB1098 5.27E+04 2.85E−05 5.40E−10 PSMB1088 2.94E+04 2.85E−05 9.70E−10 PSMB1113 5.73E+04 6.65E−05 1.16E−09 PSMB1195 1.07E+04 1.01E−04 9.45E−09

    FASCS Binding on C4-2B Cells

    [1151] The affinity of the purified antibodies was also determined on C4-2B, a cell line with high PSMA levels. Briefly, C4-2B cells were washed once with 1×PBS and incubated with 3 mls/T150 flask of cell dissociation buffer until detached, the cells were collected and strained through a 100 uM sieve. Cells were resuspended at 0.5×10e6 cells/mL in staining buffer (BD #554657) and seeded at 25,000 cells/well in V bottom plate (Corning 3894). To each well, 50 μl of Ab 4-fold serially diluted in staining buffer from 120 nM (60 nM final) were added at 2× final concentration. Control mAbs were added at 2 μg/ml, 1 μg/ml final (controls were: —secondary only and isotype control). All primary antibodies were incubated with the cells for 60 min at 4° C. After the primary incubation, 100 μl staining buffer were added to all wells and the cells were washed by pelleting by centrifugation at 300×g 5 min and buffer removed by flicking the plate. Then cells were similarly washed again with 200 μl staining buffer. 50 μl per well of goat anti human AF647 (Jackson 109-606-098) was then added at 2 μg/ml in staining buffer. After 30 minutes incubation at 4° C., the cells were washed as described above with 150 ul staining buffer, followed by a final wash with 200 ul running buffer (Running buffer is staining buffer plus 1 mM EDTA and 0.1% pluronic acid). Cells were resuspended in 30 ul/well running buffer with 1:1000 Sytox Blue viability stain (Invitrogen #S34857) and stored at 4° C. until read on the flow cytometer. Plates were read on an IntelliCyt IQue 3 instrument. Briefly, cells were gated on live cells, then populations were gated on singlets. Antibody binding was assessed by AF647 fluorescence at 647 nm. Data was analyzed in GeneData Screener with signal/background AF647 fluorescence plotted against antibody concentration. Curve fitting was done in a four-parameter fit to generate EC50 (qAC50, M) values shown in Table 22.

    TABLE-US-00025 TABLE 22 Antibody Name FACS EC50 [M] PSMB1154 3.06E−10 PSMB1183 1.56E−10 PSMB1157 3.81E−10 PSMB1156 6.33E−10 PSMB1098 2.46E−09 PSMB1088 1.24E−08 PSMB1113 2.52E−09 PSMB1195 1.38E−08

    Thermal Stability of Anti-PSMA Antibodies

    [1152] The thermal stability (conformational stability) of the anti-PSMA antibodies was determined by nanoDSF method using a Prometheus instrument. Measurements were made by loading sample into 24 well capillary from a 384 well sample plate. Duplicate runs were performed. The thermal scans span from 20° C. to 95° C. at a rate of 1.0° C./minute. The data was processed to obtain integrated data and first derivation analysis for 330 nm, 350 nm, Ratio 330/350, and scatter data from which thermal transitions, onset of unfolding, Tm and Tagg were obtained.

    [1153] “Tm” or “mid-point temperature” is the temperature midpoint of a thermal unfolding curve. It refers to the temperature where 50% of the amino acid sequence is in its native conformation and the other 50% is denatured. A thermal unfolding curve is typically plotted as a function of temperature. Tm is used to measure protein stability. In general, a higher Tm is an indication of a more stable protein. The Tm can be readily determined using methods well known to those skilled in the art such as Circular Dichroism Spectroscopy, Differential Scanning Calorimetry, Differential Scanning Fluorimetry (both intrinsic and extrinsic dye based), UV spectroscopy, FT-IR and Isothermal Calorimetry (ITC).

    [1154] “Tagg” refers to the temperature at which the protein starts to aggregate either through dimerization or oligomerization. The aggregation temperature detects the onset of aggregation, the temperature at which a protein will show a tendency to aggregate. Tagg can be determined by differential scanning calorimetry (DSC), Differential Scanning Fluorimetry (DSF) or by circular dichroism (CD). These techniques can detect small changes in the conformation of the protein and therefore detect the starting point of aggregation. Tagg values can be lower or higher than Tm. In cases where Tagg is lower than Tm, the protein either dimerizes and/or oligomerizes first and then starts unfolding later at higher temperatures than the Tagg. In cases where Tagg is higher than Tm, the protein starts to unfold first and then aggregates at a higher temperature than the Tm. Both events are commonly observed and depend on amino acid composition and protein conformation.

    [1155] Thermal unfolding parameters, Tm or midpoint temperature of thermal unfolding and Tagg or aggregation temperature of selected anti-PSMA antibodies are shown in Table 23.

    TABLE-US-00026 TABLE 23 Antibody Name Fab Tm (° C.) Tagg (° C.) PSMB1154 72.8 72.8 PSMB1183 71.3 71.7 PSMB1157 77.5 76.4 PSMB1156 76.5 77.2 PSMB1098 77.7 77.8 PSMB1088 75.9 76.7 PSMB1113 72.0 73.2 PSMB1195 80.0 79.6

    High Throughput Conjugation to MMAF

    [1156] mAbs were conjugated to a monomethyl auristatin F (MMAF) payload in a 96-well format to enable screening for optimal ADC candidates. 220 ug of each mAb (1 mg/mL in dPBS) was mixed with TCEP to a final concentration of 3 mM and incubated at 37° C. for 1r. Reduced mAbs were captured on protein A resin (Protein A HP Multitrap, GE) and washed 3× with 100 mM potassium phosphate containing 2 mM EDTA at pH 7.5 to remove TCEP.

    [1157] A mixture of maleimide-PEG4-vcPAB-MMAF and N-ethyl maleimide (60:40 molar ratio, 100 uM total in 100 mM potassium phosphate containing 2 mM EDTA at pH 7.5) was prepared and the resin with bound mAb was resuspended in 300 uL of the maleimide mixture. Samples were rotated for 1 hr at RT followed by quenching with N—Ac-L-Cys (2.6 mM final). Resin was washed with dPBS and then bound mAbs were eluted with 100 mM sodium acetate pH 3.5 into 0.2-0.25 volumes of 1 M Tris pH 8.0 to neutralize. ADC concentrations and DAR (panel average of 4.0±0.5) of the eluted ADCs were determined by UV-Vis spectrophotometry at 248 and 280 nm based on previous reports (Hamblett, et. al., (2004) Clinical Cancer Research, 10, 7063-7070; Cruz and Kayser (2009) Cancers 11(6), 870)

    Cytotoxicity Assessment on C4-2B Cells of Anti-PSMA Antibodies

    [1158] C4-2b cells, a cell line with high PSMA expression, were cultured in RPMI1640 containing GlutaMAX, 25 mM HEPES and 10% fetal bovine serum (FBS) and then plated in white 96 well plates at 3000 cells per well (60 uL/well). Twenty four hours after plating, cells were treated with varying concentrations of the ADCs and then incubated at 37 C, 5% CO2. Following 72h of treatment, cell viability was assessed by Cell Titer Glo (Promega), according to manufacturer's instructions. Relative luminescence units (RLU) were detected in an Envision plate reader (Molecular Devices) and then normalized to untreated controls. The concentration at which there was 50% toxicity was determined by fitting the values to a 3-point sigmoidal curve where the top was constrained to 100% and interpolating the X-value at Y=50%. Table 24 shows IC50 values for selected ADCs.

    TABLE-US-00027 TABLE 24 Antibody Name Cytotox (IC50) C4-2B, DAR ~4.0 PSMB1154 1.56E−11 PSMB1183 1.60E−11 PSMB1157 1.94E−11 PSMB1156 2.60E−11 PSMB1098 5.64E−11 PSMB1088 6.70E−11 PSMB1113 7.55E−11 PSMB1195 1.66E−10

    Example 4. Additional Characterization of Selected Anti-PSMA Antibodies

    [1159] Based on the results summarized in Table 20-24 and in conjunction with an in-silico sequence analysis, 4 mAbs (PSMB1154, PSMB1183, PSMB1157 and PSMB1156) from diverse CDR families were selected for further preclinical evaluation and triaged using additional biophysical characterization assays such as HIC, CIC and HUVEC to assess hydrophobicity, self-interaction and non-specificity, respectively, as well as for cytotoxicity/internalization in cell lines with range of PSMA receptor densities.

    Hydrophobic Interaction Chromatography (HIC)

    [1160] To assess surface their hydrophobicity, the anti-PSMA antibodies were evaluated by HIC (hydrophobic interaction chromatography) method. In summary samples were diluted 1:5 in high salt buffer A and approximately 10 ugs of sample was injected on a TOSOH TSKgel Butyl-NPR column on an Agilent HPLC instrument. HIC was run under a linear Amonium-S04 gradient from 1.1M-0M. UV280, and fluorescence (excitation at 280 nm and emission at 340 nm) signals were collected. The hydrophobicity propensity was evaluated as retention time relative to a control of known high hydrophobicity and reported as a hydrophobicity index (HI). Retention times and hydrophobicity index of selected anti-PSMA antibodies are shown in Table 25.

    TABLE-US-00028 TABLE 25 Characterization of anti-PSMA antibodies by HIC. Antibody Name Retention time (min) HI PSMB1183 3.576 0.69 PSMB1157 4.361 0.84 PSMB1156 3.348 0.64 PSMB1154 2.338 0.45 Low hydrophobicity control 2.758 0.53 high hydrophobicity control 5.219 1.00

    Cross Interaction Chromatography (CIC)

    [1161] To assess IgG cross-interaction potential the anti-PSMA antibodies were evaluated by CIC (cross interaction chromatography) method. In summary, samples were diluted to 0.11 mg/ml in PBS and 15 uL of sample were injected on a Perfinity Custom IgG coupled column. HIC was run by eluting with PBS at 0.2 ml/min while monitoring A280, A214 and A254. The IgG cross-interaction propensity was evaluated as retention time relative to a control of known IgG cross-interaction. Retention times of selected anti-PSMA antibodies are shown in Table 26.

    TABLE-US-00029 TABLE 26 Characterization of anti-PSMA antibodies by CIC Antibody Name Retention time (min) PSMB1183 4.430 PSMB1157 4.638 PSMB1156 4.565 PSMB1154 4.372 Low CIC control 4.598 high CIC control 5.321, 10.380

    Serum Stability

    [1162] To assess stability in serum, the anti-PSMA antibodies were labeled with AlexaFluor488 (AF488) and incubated (Cone: 1 mg/mL) for 1 week in human serum at 37° C. Following incubation aggregation and fragmentation were evaluated by SEC-FDS (Size exclusion chromatography with fluorescence detection) method. Briefly, the incubated samples were injected on a TOSOH TSKgel BioAssist G3000SWXL on an Agilent 1260 Infinity II HPLC. SEC-FDS was run by eluting with PBS at 1 mL/min while monitoring A280 and fluorescence (494 nm (emission) & 520 nm (excitation)). Results for selected anti-PSMA antibodies incubated at 37° C. for 7 days and controls at time zero are shown in Table 27.

    TABLE-US-00030 TABLE 27 Serum stability testing of anti-PSMA antibodies by SEC-FDS Fragmentation (%) Aggregation (%) Antibody Name Time 0 37° C., 7 days Time 0 37° C., 7 days PSMB1154 0 0 0 0.6 PSMB1157 0 0 0 0.6 PSMB1183 0 0 0 0.2 ND: Not determined

    Medium Scale Conjugation to DAR 4 for MMAF

    [1163] Selected mAbs were conjugated to a monomethyl auristatin F (MMAF) payload to confirm results from initial screening. Briefly, 600 ug of each mAb (1.2 mg/mL in 1×dPBS) was adjusted to pH 7.5 by addition of 1M potassium phosphate containing 50 mM EDTA (1:10 volumes). pH adjusted mAb was mixed with TCEP to a final concentration of 0.6 mM and incubated at 37° C. for 1 hr. To quench the TCEP (Gololobov and Kasukhin (1991) Tetrahedron 48, 1353-1406; Kantner, et. al. (2017) ACS Omega 2, 5785-57) 5 mM 3-amino-propyl-azide was added to the reaction and incubated for 30 min at 37° C. A mixture of maleimide-PEG4-vcPAB-MMAF and N-ethyl maleimide (60:40 molar ratio, 108 uM total) was added to the reduced (TCEP neutralized) mAb and incubated for 1 hour at RT followed by quenching with N—Ac-L-Cys (2 mM final). ADCs were separated from reaction components and buffer exchanged into dPBS by diafiltration. ADC concentrations and DAR (panel average of 3.4±0.4) of the eluted ADCs were estimated by UV-Vis spectrophotometry at 248 and 280 nm based on previous reports of Hamblett et. al..sup.1, and Cruz and Kayser (Cruz and Kayser (2009) Cancers 11(6), 870). DAR was also calculated by liquid chromatography/mass spectroscopy. Deconvolution of the extracted charge state allowed for the identification and relative fraction (of total) for each light chain and heavy chain species present, as well as their respective degrees of labeling with either maleimide-PEG4-vcPAB-MMAF, N-ethyl maleimide, or (in the case of heavy chain) a combination of both. Total DAR (panel average of 3.4±0.5) for the ADC was calculated from the sum of light chain and heavy chain labeled only with maleimide-PEG4-vcPAB-MMAF. Size exclusion chromatography was carried out to determine percent monomeric fraction based on migration time relative to unlabeled mAbs.

    Medium Scale Conjugation to DAR 8 with DX8951 (Camptothecinoid)

    [1164] Selected mAbs were also conjugated via maleimide/thiol chemistry to an exatecan methansulfonate derived camptothecinoid DX8951, containing a Gly-Gly-Phe-Gly linker (SEQ ID NO: 340) to facilitate cleavage and release of the payload. Briefly, 350 ug of each mAb (1.1 mg/mL in dPBS) was adjusted to pH 8.0 by addition of 0.5M borate (1:10) and 0.5M EDTA. pH adjusted mAb was mixed with TCEP to a final concentration of 0.6 mM and incubated at 37° C. for 1 hr. To quench the TCEP (Gololobov and Kasukhin (1991) Tetrahedron 48, 1353-1406; Kantner, et. al. (2017) ACS Omega 2, 5785-57), 5 mM 3-amino-propyl-azide was added to the reaction and incubated for 30 min 37° C. MC-GGFG-DX8951 was added to the reduced mAb at 16-fold molar excess relative to mAb, and incubated for 1 hr at 37° C. ADCs were separated from reaction components and buffer exchanged into dPBS by diafiltration. Final molar concentration of ADC was determined by bicinchoninic acid assay, using unconjugated mAb as a standard. DAR was determined to be 8.0 for all ADCs by Liquid chromatography/mass spectroscopy as described in section 4.6. Size exclusion chromatography determined labeling to have minimal impact on aggregation, based on comparative analysis migration time relative to unlabeled mAbs.

    In Vitro Cytotoxicity Assessment on C4-2B, 22RV1, and HUVECs Using MMAF and DX8951 as Payload

    [1165] In vitro cytotoxicity of selected ADCs was also assessed in a panel of cell lines expressing various levels of PSMA, and a human endothelial cell line HUVEC which was used as a surrogate for non-specific killing. Briefly, C4-2B cells, expressing high levels of PSMA, were cultured in RPMI1640 containing GlutaMAX, 25 mM HEPES and 10% fetal bovine serum (FBS) and then plated in white 96 well plates at 3000 cells per well. HUVEC cells, known to be PSMA negative, were plated at 8000 cells per well in Medium 200 containing low serum growth supplement (Gibco #S-003-10).

    [1166] Twenty four hours after plating, cells were treated with varying concentrations of the ADCs and then set at 37 C, 5% CO2. Following 72h of treatment, cell viability was assessed by Cell Titer Glo (Promega), according to manufacturer's instructions. Relative luminescence units (RLU) were detected in an Envision plate reader (Perkin Elmer) and then normalized to untreated controls. The concentration at which there was 50% toxicity was determined by fitting the values to a 3-point sigmoidal curve where the top was constrained to 100% and interpolating the X-value at Y=50%. IC50 values for selected mAbs are shown in Table 28 below. All selected mAbs showed very potent (low IC50 values) killing on C4-2B cells and also excellent selectivity (high IC50 value on HUVEC versus C4-2B).

    TABLE-US-00031 TABLE 28 PSMA ADC potency is shown for a panel of PSMA mAbs conjugated to vcMMAF and treated on PSMA+ (C4- 2B) or PSMA− (HUVEC) cells. C4-2B IC50 HUVEC IC50 Ratio of HUVEC/ mAb DAR (nM) (nM) C4-2B IC50 PSMB1154 4 0.03 212 8450 PSMB1157 3.6 0.03 400 14769 PSMB1156 2.9 0.04 637 14859 PSMB1183 3.6 0.03 389 13919

    [1167] Cytotoxicity of PSMA ADCs conjugated to different payloads (MMAF or DX8951) were also evaluated in 22RV1 cells, a highly heterogeneous cell line expressing low levels of PSMA. 22RV1 cells were cultured in RPMI1640 containing GlutaMAX, 25 mM HEPES and 10% fetal bovine serum (FBS) and then plated in white 96 well plates at 5000 cells per well. Twenty-four hours after plating, cells were treated with varying concentrations of the ADCs and then set at 37 C, 5% CO2. Following 6d of treatment, cell viability was assessed by Cell Titer Glo (Promega), according to manufacturer's instructions. Relative luminescence units (RLU) were detected in an Envision plate reader (Perkin Elmer) and then normalized to untreated controls. The concentration at which there was 25% or 50% toxicity was determined by fitting the values to a 3-point sigmoidal curve where the top was constrained to 100% and interpolating the X-value at Y=75 or 50%. (The concentration at which cells are 75% viable or 25% toxic is referred to as the IC25. The concentration at which cells are 50% viable is referred to as the IC50.) Relative potency of PSMA ADCs conjugated to MMAF or DX8951 are shown in Table 29 below. Note that cells treated with PSMA ADCs conjugated to MMAF did not reach 50% toxicity and therefore the IC25 is shown instead.

    TABLE-US-00032 TABLE 29 Table shows relative potency for PSMA ADCs conjugated to either MMAF or DX8951 and treated on 22RV1 cells. MMAF DX8951 mAb DAR IC25 (nM) DAR IC50 (nM) PSMB1154 4 0.1 8 0.8 PSMB1157 3.6 0.4 8 2.2 PSMB1156 2.9 0.9 8 1.4 PSMB1183 3.6 N.D 8 0.7 Isotype control 4.3 >100 8 57.2

    Example 5. Generation and Characterization of a Biparatopic Antibody

    Biparatopic Antibody Generation

    [1168] It is generally believed that approaches that can lead to higher ADC delivery or lysosomal processing may lead to better ADC efficacy and may also lower the receptor density threshold that's needed to see efficacy, thus increasing the size of patient population that could benefit by this therapy. We hypothesized that one way we could achieve that is by creating biparatopic antibodies that targets two different regions of the PSMA receptor. So, to test this hypothesis, by using VL and VH region of antibodies belonging to two different epitope bins, several biparatopic antibodies were created. Briefly, several scFvs were created by fusing VL and VH regions of antibodies from different epitope bins using a “GGSEGKSSGSGSESKSTGGS” linker (SEQ ID NO: 308). So, to create a bispecific, scFv from one bin were fused to an engineered Fc region containing the C220S (mutate unpaired cysteine to serine) and knob mutation (1366W); and the Fab region from another bin to an engineered Fc containing the hole mutation (T366S, L368A and Y407V). All numberings are based on EU system.

    [1169] The sequence of selected biparatopic molecules is provided in Table 30. The genes corresponding to the bispecific antibodies were codon-optimized, synthesized and cloned into in-house proprietary plasmids using standard molecular biology techniques, and expressed and purified essentially according to procedures described in the following publication.

    TABLE-US-00033 TABLE 30 HCDRs of anti-PSMA biparatopic antibodies using Kabat delineation HCDR1 HCDR2 HCDR3 HCDR1 SEQ ID HCDR2 SEQ ID HCDR3 SEQ ID mAb Arm sequence NO: sequence NO: sequence NO: PSMB2819 Fab RYGMH   4 LISYDGSN   5 ERESSG   6 RYYADSV WFEGYF KG DY scFv SYYWS 272 RIYSSGST 273 VGVWP 274 NYNPSLK GAFDI S PSMB3002 Fab RYGMH   4 LISYDGSN   5 ERESSG   6 RYYADSV WFEGYF KG DY scFv SYYWS 272 RIYSSGST 273 VGVWP 274 NYNPSLK GAFDI S

    TABLE-US-00034 TABLE 31 LCDRs of anti-PSMA biparatopic antibodies using Kabat delineation LCDR1 LCDR2 LCDR3 LCDR1 SEQ ID LCDR2 SEQ ID LCDR3 SEQ ID mAb Arm sequence NO: sequence NO: sequence NO: PSMB2819 Fab GGNNIGS   7 DNSDRP   8 QVWDS   9 KSVH S SSDHV V scFv SGSSSNIG 275 SSNQRPS 276 AAWDD 277 SNTVN SLNGV V PSMB3002 Fab GGNNIGS   7 DNSDRP   8 QVWDS   9 KSVH S SSDHV V scFv SGSSSNIG 275 SSNQRPS 276 AAWDD 277 SNTVN SLNGV V

    TABLE-US-00035 TABLE 32 HCDRs of anti-PSMA biparatopic antibodies using Chothia delineation HCDR1 HCDR2 HCDR3 HCDR1 SEQ ID HCDR2 SEQ ID HCDR3 SEQ ID mAb Arm sequence NO: sequence NO: sequence NO: PSMB2819 Fab GFTLSRY 124 SYDGSN 125 ERESSGW   6 FEGYFDY scFv GGSIISY 290 YSSGS 291 VGVWPG 274 AFDI PSMB3002 Fab GFTLSRY 124 SYDGSN 125 ERESSGW   6   FEGYFDY scFv GGSIISY 290 YSSGS 291 VGVWPG 274 AFDI

    TABLE-US-00036 TABLE 33 LCDRs of anti-PSMA biparatopic antibodies using Chothia delineation LCDR1 LCDR2 LCDR3 LCDR1 SEQ ID LCDR2 SEQ ID LCDR3 SEQ ID mAb Arm sequence NO: sequence NO: sequence NO: PSMB2819 Fab GGNNIGS   7 DNSDRPS   8 QVWDSS   9 KSVH SDHW scFv SGSSSNIG 275 SSNQRPS 276 AAWDD 277 SNTVN SLNGW PSMB3002 Fab GGNNIGS   7 DNSDRPS   8 QVWDSS   9 KSVH SDHW scFv SGSSSNIG 275 SSNQRPS 276 AAWDD 277 SNTVN SLNGW

    TABLE-US-00037 TABLE 34 HCDRs of anti-PSMA biparatopic antibodies using ABM delineation HCDR1 HCDR2 HCDR3 HCDR1 SEQ ID HCDR2 SEQ ID HCDR3 SEQ ID mAb Arm sequence NO: sequence NO: sequence NO: PSMB2819 Fab GFTLSRY 172 LISYDGS 173 ERESSG   6 GMH NRY WFEGY FDY scFv GGSIISYY 296 RIYSSGS 297 VGVWP 274 WS TN GAFDI PSMB3002 Fab GFTLSRY 172 LISYDGS 173 ERESSG   6   GMH NRY WFEGY FDY scFv GGSIISYY 296 RIYSSGS 297 VGVWP 274 WS TN GAFDI

    TABLE-US-00038 TABLE 35 LCDRs of anti-PSMA biparatopic antibodies using ABM delineation LCDR1 LCDR2 LCDR3 LCDR1 SEQ ID LCDR2 SEQ ID LCDR3 SEQ ID mAb Arm sequence NO: sequence NO: sequence NO: PSMB2819 Fab GGNNIGS   7 DNSDRP   8 QVWDSS   9 KSVH S SDHW scFv SGSSSNIG 275 SSNQRPS 276 AAWDDS 277 SNTVN LNGW PSMB3002 Fab GGNNIGS   7 DNSDRP   8 QVWDSS   9 KSVH S SDHW scFv SGSSSNIG 275 SSNQRPS 276 AAWDDS 277 SNTVN LNGW

    TABLE-US-00039 TABLE 36 HCDRs of anti-PSMA biparatopic antibodies using IMTG delineation HCDR1 HCDR2 HCDR3 HCDR1 SEQ ID HCDR2 SEQ ID HCDR3 SEQ ID mAb Arm sequence NO: sequence NO: sequence NO: PSMB2819 Fab GFTLSR 220 ISYDGSN 221 ARERESS 222 YG R GWFEGY FDY scFv GGSIISY 302 IYSSGST 303 AKVGVW 304 Y PGAFDI PSMB3002 Fab GFTLSR 220 ISYDGSN 221 ARERESS 222 YG R GWFEGY FDY scFv GGSIISY 302 IYSSGST 303 AKVGVW 304 Y PGAFDI

    TABLE-US-00040 TABLE 37 LCDRs of anti-PSMA biparatopic antibodies using IMTG delineation LCDR1 LCDR2 LCDR3 LCDR1 SEQ ID LCDR2 SEQ ID LCDR3 SEQ ID mAb Arm sequence NO: sequence NO: sequence NO: PSMB2819 Fab NIGSKS 223 DNS NA QVWDSS   9 SDHW scFv SSNIGSN 305 SSN NA AAWDDS 277 T LNGW PSMB3002 Fab NIGSKS 223 DNS NA QVWDSS   9 SDHW scFv SSNIGSN 305 SSN NA AAWDDS 277 T LNGW NA = Not applicable

    TABLE-US-00041 TABLE 38 VH and VL amino acid and nucleic acid SEQ ID NOs of biparatopic anti-PSMA antibodies VH VH VL VL amino Nucleic amino nucleic acid acid acid acid SEQ ID SEQ ID SEQ ID SEQ ID Antibody Arm VH name NO: NO VL name NO: NO: PSMB2819 Fab VD000060663_  52 134 VD000060661_  53 135 VH VL scFv VD000045978_ 278 280 VD000045977_ 279 281 VH VL PSMB3002 Fab VD000060663_  52 134 VD000060661_  53 135 VH VL scFv VD000045978_ 278 280 VD000045977_ 279 281 VH VL

    TABLE-US-00042 (PSMB2819 and PSMB3002 Fab VH amino acid sequence) SEQ ID NO: 52 EVQLVESGGGEVQPGRSLRLTCAVSGFTLSRYGMHWVRQAPGKGLEWAALISYDGSN RYYADSVKGRFTISRDNSKNTVFLQMNSLRAEDTAVYYCARERESSGWFEGYFDYWG QGTTVTVSS (PSMB2819 and PSMB3002 Fab VL amino acid sequence) SEQ ID NO: 53 QLVLTQPPSVSVAPGQTARITCGGNNIGSKSVHWYQQKPGQAPVLVVYDNSDRPSGIPE RFSGSNSGNTATLTISRVEVGDEADYYCQVWDSSSDHVVFGGGTKLTVL (PSMB2819 and PSMB3002 scFv VH amino acid sequence) SEQ ID NO: 278 EVQLLESGPGLVKPSETLSLTCTVSGGSIISYYWSWIRQPAGKGLEWIGRIYSSGSTNYN PSLKSRVTMSVDTSKNQFSLKLSSVTAADTAVYYCAKVGVWPGAFDIWGQGTMVTVS S (PSMB2819 and PSMB3002 scFv VL amino acid sequence) SEQ ID NO: 279 QSVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLIYSSNQRPSGVP DRFSGSKSGTSASLAISGLQSEDEADYYCAAWDDSLNGVVFGGGTKLTVL (PSMB2819 and PSMB3002 Fab VH nucleotide sequence) SEQ ID NO: 134 GAGGTGCAATTGGTAGAGAGTGGCGGGGGAGAAGTCCAACCAGGCCGCAGTCTCA GACTTACTTGTGCCGTCTCAGGCTTTACCCTCAGCCGTTACGGTATGCACTGGGTTA GACAAGCTCCAGGGAAGGGACTTGAATGGGCCGCACTGATTTCCTATGATGGCTCC AACCGCTATTATGCCGACAGTGTGAAAGGACGCTTCACAATTTCAAGGGATAATTC AAAGAATACAGTCTTTCTTCAAATGAACTCTTTGCGAGCCGAGGATACAGCCGTTT ATTACTGTGCACGGGAAAGGGAGTCTAGTGGATGGTTTGAAGGGTATTTTGATTAT TGGGGTCAAGGGACCACAGTGACCGTAAGCTCA (PSMB2819 and PSMB3002 Fab VL nucleotide sequence) SEQ ID NO: 135 CAGCTTGTCCTCACCCAGCCACCTAGCGTTAGTGTCGCCCCCGGTCAAACTGCTCGC ATAACTTGTGGAGGCAACAACATTGGGAGCAAAAGCGTTCATTGGTACCAACAAA AACCAGGACAGGCCCCTGTTTTGGTAGTTTATGACAACTCTGATCGACCATCAGGG ATTCCCGAGCGGTTTTCTGGTAGTAATTCAGGGAATACTGCTACCCTGACTATCAGT CGCGTCGAAGTTGGCGACGAAGCTGACTATTATTGTCAAGTCTGGGACAGCAGCAG CGACCATGTGGTTTTTGGGGGAGGGACCAAACTTACCGTATTG (PSMB2819 and PSMB3002 scFv VH nucleotide sequence) SEQ ID NO: 280 GAAGTTCAGCTGTTGGAATCTGGACCTGGCCTGGTCAAGCCTTCCGAGACACTGTC TCTGACCTGTACCGTGTCCGGCGGCTCCATCATCTCCTACTACTGGTCCTGGATCAG ACAGCCTGCCGGCAAAGGACTGGAATGGATCGGCAGAATCTACTCCTCCGGCAGCA CCAACTACAACCCCAGCCTGAAGTCCCGCGTGACCATGTCTGTGGACACCTCCAAG AACCAGTTCTCCCTGAAGCTGTCCTCTGTGACCGCCGCTGATACCGCTGTGTACTAC TGCGCTAAAGTCGGAGTGTGGCCTGGCGCCTTTGATATCTGGGGACAGGGCACAAT GGTCACCGTGTCCTCT (PSMB2819 and PSMB3002 scFv VL nucleotide sequence) SEQ ID NO: 281 CAGTCCGTGCTGACCCAGCCTCCTTCTGCTTCTGGAACACCTGGCCAGAGAGTGAC CATCTCCTGCTCCGGCTCCTCCTCCAACATCGGCTCTAACACCGTGAACTGGTATCA GCAGCTGCCCGGCACAGCCCCTAAACTGCTGATCTACTCTTCCAACCAGCGGCCTTC TGGCGTGCCCGATAGATTCTCTGGCTCCAAGTCTGGCACCTCCGCTAGCCTGGCTAT TTCTGGCCTGCAGTCTGAGGACGAGGCCGATTACTACTGTGCCGCCTGGGATGATT CTCTGAACGGCGTTGTGTTTGGCGGAGGCACCAAATTGACAGTTCTT

    TABLE-US-00043 TABLE 39 HC and LC amino acid sequence and nucleic acid SEQ ID NOs of biparatopic HC HC LC LC amino nucleic amino nucleic acid acid acid acid SEQ SEQ SEQ SEQ Antibody Arm HC name ID NO: ID NO LC name ID NO: ID NO: PSMB2819 Fab DCH000015760 268 270 DCH000010369 269 271 scFv DCH000014009 282 283 PSMB3002 Fab DCH000021547 284 286 DCH000010369 269 271 scFv DCH000021548 288 289

    TABLE-US-00044 (PSMB2819 Fab HC amino acid sequence) SEQ ID NO: 268 EVQLVESGGGEVQPGRSLRLTCAVSGFTLSRYGMHWVRQAPGKGLEWAALISYDGSN RYYADSVKGRFTISRDNSKNTVFLQMNSLRAEDTAVYYCARERESSGWFEGYFDYWG QGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGV HTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTC PPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQP REPQVYTLPPSREEMTKNQVSLSCAVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD GSFFLVSKLTVDKSRWQQGNVFSCSVMHEALHNRFTQKSLSLSPGK (PSMB2819 and PSMB3002 Fab LC amino acid sequence) SEQ ID NO: 269 QLVLTQPPSVSVAPGQTARITCGGNNIGSKSVHWYQQKPGQAPVLVVYDNSDRPSGIPE RFSGSNSGNTATLTISRVEVGDEADYYCQVWDSSSDHVVFGGGTKLTVLGQPKAAPSV TLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAA SSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS (PSMB2819 scFv HC amino acid sequence) SEQ ID NO: 282 QSVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLIYSSNQRPSGVP DRFSGSKSGTSASLAISGLQSEDEADYYCAAWDDSLNGVVFGGGTKLTVLGGSEGKSS GSGSESKSTGGSEVQLLESGPGLVKPSETLSLTCTVSGGSIISYYWSWIRQPAGKGLEWI GRIYSSGSTNYNPSLKSRVTMSVDTSKNQFSLKLSSVTAADTAVYYCAKVGVWPGAFD IWGQGTMVTVSSEPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV VDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEY KCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLWCLVKGFYPSDIA VEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNH YTQKSLSLSPGK (PSMB3002 Fab HC amino acid sequence) SEQ ID NO: 284 EVQLVESGGGEVQPGRSLRLTCAVSGFTLSRYGMHWVRQAPGKGLEWAALISYDGSN RYYADSVKGRFTISRDNSKNTVFLQMNSLRAEDTAVYYCARERESSGWFEGYFDYWG QGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGV HTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTC PPCPAPEAAGGPSVFLFPPKPKDTLYITREPEVTCVVVSVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQP REPQVYTLPPSREEMTKNQVSLSCAVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD GSFFLVSKLTVDKSRWQQGNVFSCSVMHEALHNRFTQKSLSLSPGK (PSMB3002 scFv HC amino acid sequence) SEQ ID NO: 288 QSVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLIYSSNQRPSGVP DRFSGSKSGTSASLAISGLQSEDEADYYCAAWDDSLNGVVFGGGTKLTVLGGSEGKSS GSGSESKSTGGSEVQLLESGPGLVKPSETLSLTCTVSGGSIISYYWSWIRQPAGKGLEWI GRIYSSGSTNYNPSLKSRVTMSVDTSKNQFSLKLSSVTAADTAVYYCAKVGVWPGAFD IWGQGTMVTVSSEPKSSDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLYITREPEVTCVV VSVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEY KCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLWCLVKGFYPSDIA VEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNH YTQKSLSLSPGK (PSMB2819 Fab HC nucleic acid sequence) SEQ ID NO: 270 GAGGTGCAATTGGTAGAGAGTGGCGGGGGAGAAGTCCAACCAGGCCGCAGTCTCA GACTTACTTGTGCCGTCTCAGGCTTTACCCTCAGCCGTTACGGTATGCACTGGGTTA GACAAGCTCCAGGGAAGGGACTTGAATGGGCCGCACTGATTTCCTATGATGGCTCC AACCGCTATTATGCCGACAGTGTGAAAGGACGCTTCACAATTTCAAGGGATAATTC AAAGAATACAGTCTTTCTTCAAATGAACTCTTTGCGAGCCGAGGATACAGCCGTTT ATTACTGTGCACGGGAAAGGGAGTCTAGTGGATGGTTTGAAGGGTATTTTGATTAT TGGGGTCAAGGGACCACAGTGACCGTAAGCTCAGCCTCCACCAAGGGCCCATCGGT CTTCCCCCTGGCACCCTCCTCCAAGAGCACCTCTGGGGGCACAGCGGCCCTGGGCT GCCTGGTCAAGGACTACTTCCCCGAACCGGTGACGGTGTCGTGGAACTCAGGCGCC CTGACCAGCGGCGTGCACACCTTCCCGGCTGTCCTACAGTCCTCAGGACTCTACTCC CTCAGCAGCGTGGTGACCGTGCCCTCCAGCAGCTTGGGCACCCAGACCTACATCTG CAACGTGAATCACAAGCCCAGCAACACCAAGGTGGACAAGAAAGTTGAACCCAAA TCCTGTGACAAAACCCATACTTGTCCCCCTTGCCCCGCCCCAGAGTTGCTTGGCGGA CCTTCCGTGTTTCTGTTCCCTCCAAAGCCCAAGGACACTCTTATGATAAGCCGAACA CCAGAGGTCACATGCGTCGTCGTGGACGTAAGCCACGAGGATCCCGAAGTAAAATT TAACTGGTACGTGGATGGGGTGGAAGTACATAATGCAAAAACTAAGCCCAGAGAG GAACAATATAATTCTACCTACCGAGTGGTATCCGTCCTGACAGTGTTGCATCAGGA CTGGTTGAATGGAAAGGAGTATAAGTGCAAAGTGTCAAATAAGGCCCTGCCCGCTC CTATCGAGAAAACTATTTCCAAAGCTAAGGGCCAGCCTCGCGAACCTCAGGTCTAC ACCCTGCCACCTTCCAGAGAGGAGATGACCAAAAATCAAGTTTCATTGTCTTGTGC CGTAAAAGGATTTTACCCCTCCGATATAGCTGTCGAGTGGGAGAGTAATGGTCAAC CCGAGAATAATTACAAAACAACTCCACCCGTTCTCGATAGTGATGGGAGCTTCTTT CTCGTTTCCAAATTGACTGTTGATAAATCTAGGTGGCAGCAGGGCAATGTCTTTTCC TGCAGCGTGATGCACGAAGCCCTGCATAATCGCTTTACTCAAAAAAGCCTTAGTCT GTCCCCAGGTAAG (PSMB2819 and PSMB3002 Fab LC nucleic acid sequence) SEQ ID NO: 271 CAGCTTGTCCTCACCCAGCCACCTAGCGTTAGTGTCGCCCCCGGTCAAACTGCTCGC ATAACTTGTGGAGGCAACAACATTGGGAGCAAAAGCGTTCATTGGTACCAACAAA AACCAGGACAGGCCCCTGTTTTGGTAGTTTATGACAACTCTGATCGACCATCAGGG ATTCCCGAGCGGTTTTCTGGTAGTAATTCAGGGAATACTGCTACCCTGACTATCAGT CGCGTCGAAGTTGGCGACGAAGCTGACTATTATTGTCAAGTCTGGGACAGCAGCAG CGACCATGTGGTTTTTGGGGGAGGGACCAAACTTACCGTATTGGGTCAGCCCAAGG CTGCACCCAGTGTCACTCTGTTCCCGCCCTCCTCTGAGGAGCTTCAAGCCAACAAGG CCACACTGGTGTGTCTCATAAGTGACTTCTACCCGGGAGCCGTGACAGTGGCCTGG AAGGCCGATAGCAGCCCCGTCAAGGCGGGAGTGGAGACCACCACACCCTCCAAAC AAAGCAACAACAAGTACGCGGCCAGCAGCTATCTGAGCCTGACGCCTGAGCAGTG GAAGTCCCACAGAAGCTACAGCTGCCAGGTCACGCATGAAGGGAGCACCGTGGAG AAGACAGTGGCCCCTACAGAATGTTCA (PSMB2819 scFv HC nucleic acid sequence) SEQ ID NO: 283 CAGTCCGTGCTGACCCAGCCTCCTTCTGCTTCTGGAACACCTGGCCAGAGAGTGAC CATCTCCTGCTCCGGCTCCTCCTCCAACATCGGCTCTAACACCGTGAACTGGTATCA GCAGCTGCCCGGCACAGCCCCTAAACTGCTGATCTACTCTTCCAACCAGCGGCCTTC TGGCGTGCCCGATAGATTCTCTGGCTCCAAGTCTGGCACCTCCGCTAGCCTGGCTAT TTCTGGCCTGCAGTCTGAGGACGAGGCCGATTACTACTGTGCCGCCTGGGATGATT CTCTGAACGGCGTTGTGTTTGGCGGAGGCACCAAATTGACAGTTCTTGGCGGCTCC GAGGGCAAGAGCAGCGGCAGCGGCAGCGAGAGCAAGAGCACCGGCGGCAGCGAA GTTCAGCTGTTGGAATCTGGACCTGGCCTGGTCAAGCCTTCCGAGACACTGTCTCTG ACCTGTACCGTGTCCGGCGGCTCCATCATCTCCTACTACTGGTCCTGGATCAGACAG CCTGCCGGCAAAGGACTGGAATGGATCGGCAGAATCTACTCCTCCGGCAGCACCAA CTACAACCCCAGCCTGAAGTCCCGCGTGACCATGTCTGTGGACACCTCCAAGAACC AGTTCTCCCTGAAGCTGTCCTCTGTGACCGCCGCTGATACCGCTGTGTACTACTGCG CTAAAGTCGGAGTGTGGCCTGGCGCCTTTGATATCTGGGGACAGGGCACAATGGTC ACCGTGTCCTCTGAGCCCAAATCTAGCGACAAAACTCACACATGTCCACCGTGCCC AGCACCTGAACTGCTGGGGGGACCGTCAGTCTTCCTCTTCCCCCCAAAACCCAAGG ACACCCTCATGATCTCCCGGACCCCTGAGGTCACATGCGTGGTGGTGGACGTGAGC CACGAAGACCCTGAGGTCAAGTTCAACTGGTACGTGGACGGCGTGGAGGTGCATA ATGCCAAGACAAAGCCGCGGGAGGAGCAGTACAACAGCACGTACCGTGTGGTCAG CGTCCTCACCGTCCTGCACCAGGACTGGCTGAATGGCAAGGAGTACAAGTGCAAGG TCTCCAACAAAGCCCTCCCAGCCCCCATCGAGAAAACCATCTCCAAAGCCAAAGGG CAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGAGGAGATGACCA AGAACCAGGTCAGCCTGTGGTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCC GTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCG TGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGTCTA GATGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAAC CACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAA (PSMB3002 Fab HC nucleic acid sequence) SEQ ID NO: 286 GAGGTGCAATTGGTAGAGAGTGGCGGGGGAGAAGTCCAACCAGGCCGCAGTCTCA GACTTACTTGTGCCGTCTCAGGCTTTACCCTCAGCCGTTACGGTATGCACTGGGTTA GACAAGCTCCAGGGAAGGGACTTGAATGGGCCGCACTGATTTCCTATGATGGCTCC AACCGCTATTATGCCGACAGTGTGAAAGGACGCTTCACAATTTCAAGGGATAATTC AAAGAATACAGTCTTTCTTCAAATGAACTCTTTGCGAGCCGAGGATACAGCCGTTT ATTACTGTGCACGGGAAAGGGAGTCTAGTGGATGGTTTGAAGGGTATTTTGATTAT TGGGGTCAAGGGACCACAGTGACCGTAAGCTCAGCCTCCACCAAGGGCCCATCGGT CTTCCCCCTGGCACCCTCCTCCAAGAGCACCTCTGGGGGCACAGCGGCCCTGGGCT GCCTGGTCAAGGACTACTTCCCCGAACCGGTGACGGTGTCGTGGAACTCAGGCGCC CTGACCAGCGGCGTGCACACCTTCCCGGCTGTCCTACAGTCCTCAGGACTCTACTCC CTCAGCAGCGTGGTGACCGTGCCCTCCAGCAGCTTGGGCACCCAGACCTACATCTG CAACGTGAATCACAAGCCCAGCAACACCAAGGTGGACAAGAAAGTTGAGCCCAAA TCTTGTGACAAAACTCACACATGTCCACCGTGCCCAGCACCTGAAGCCGCCGGGGG ACCGTCAGTCTTCCTCTTCCCCCCAAAACCCAAGGACACCCTCTACATCACCCGGGA GCCTGAGGTCACATGCGTGGTGGTGAGCGTGAGCCACGAAGACCCTGAGGTCAAGT TCAACTGGTACGTGGACGGCGTGGAGGTGCATAATGCCAAGACAAAGCCGCGGGA GGAGCAGTACAACAGCACGTACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGG ACTGGCTGAATGGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGCCCTCCCAGCC CCCATCGAGAAAACCATCTCCAAAGCCAAAGGGCAGCCCCGAGAACCACAGGTGT ACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGTCCTGC GCCGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCA GCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCT TCCTCGTGAGCAAGCTCACCGTGGACAAGTCTAGATGGCAGCAGGGGAACGTCTTC TCATGCTCCGTGATGCATGAGGCTCTGCACAACCGGTTCACGCAGAAGAGCCTCTC CCTGTCTCCGGGAAAA (PSMB3002 scFv HC nucleic acid sequence) SEQ ID NO: 289 CAGTCCGTGCTGACCCAGCCTCCTTCTGCTTCTGGAACACCTGGCCAGAGAGTGAC CATCTCCTGCTCCGGCTCCTCCTCCAACATCGGCTCTAACACCGTGAACTGGTATCA GCAGCTGCCCGGCACAGCCCCTAAACTGCTGATCTACTCTTCCAACCAGCGGCCTTC TGGCGTGCCCGATAGATTCTCTGGCTCCAAGTCTGGCACCTCCGCTAGCCTGGCTAT TTCTGGCCTGCAGTCTGAGGACGAGGCCGATTACTACTGTGCCGCCTGGGATGATT CTCTGAACGGCGTTGTGTTTGGCGGAGGCACCAAATTGACAGTTCTTGGCGGCTCC GAGGGCAAGAGCAGCGGCAGCGGCAGCGAGAGCAAGAGCACCGGCGGCAGCGAA GTTCAGCTGTTGGAATCTGGACCTGGCCTGGTCAAGCCTTCCGAGACACTGTCTCTG ACCTGTACCGTGTCCGGCGGCTCCATCATCTCCTACTACTGGTCCTGGATCAGACAG CCTGCCGGCAAAGGACTGGAATGGATCGGCAGAATCTACTCCTCCGGCAGCACCAA CTACAACCCCAGCCTGAAGTCCCGCGTGACCATGTCTGTGGACACCTCCAAGAACC AGTTCTCCCTGAAGCTGTCCTCTGTGACCGCCGCTGATACCGCTGTGTACTACTGCG CTAAAGTCGGAGTGTGGCCTGGCGCCTTTGATATCTGGGGACAGGGCACAATGGTC ACCGTGTCCTCTGAGCCCAAATCTAGCGACAAAACTCACACATGCCCACCGTGCCC AGCACCTGAAGCCGCCGGGGGACCGTCAGTCTTCCTCTTCCCCCCAAAACCCAAGG ACACCCTCTACATCACCCGGGAGCCTGAGGTCACATGCGTGGTGGTGAGCGTGAGC CACGAAGACCCTGAGGTCAAGTTCAACTGGTACGTGGACGGCGTGGAGGTGCATA ATGCCAAGACAAAGCCGCGGGAGGAGCAGTACAACAGCACGTACCGTGTGGTCAG CGTCCTCACCGTCCTGCACCAGGACTGGCTGAATGGCAAGGAGTACAAGTGCAAGG TGTCGAACAAAGCCCTCCCAGCCCCCATCGAGAAAACCATCTCCAAAGCCAAAGGG CAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGAGGAGATGACCA AGAACCAGGTCAGCCTGTGGTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCC GTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCG TGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGC AGATGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAA CCACTACACGCAGAAGTCTCTCTCCCTGTCTCCGGGAAAA

    Example 6. HDX-MS Epitope Mapping of PSMW39 Against PSMB1154, PSMB1154-TOPA, and PSMB1183

    [1170] HDX-MS behaviors of PSMW39 (a N-terminal 6-His tagged human PSMA as shown in Table 3 as SEQ ID NO: 1) were monitored (a) in the presence (b) in the absence of PSMB1154, PSMB1154-TOPA or PSMB1183 for 10 time points (15, 50, 150, 500, and 1,500 s at pH 6.4 and 23° C.; 15, 50, 150, 500, and 1,500 s at pH 8.4 and 23° C.). These time points correspond to the exchange times from 1.5 s to 15,000 s at pH 7.4 at 23° C. The residue numbers were converted from those of PSMW39 to those of Q04609 (full length human PSMA, SEQ ID NO:336).

    [1171] The epitopes of PSMA (ΔG≤−1 kcal/mol) against PSMB1154 and PSMB1154-TOPA were virtually identical with residues 138-143 (IFNTSL; SEQ ID NO: 126), 271-276 (GYPANE; SEQ ID NO: 127), 279 (Y), 353-354 (TR), 377-383 (IIRDSWVF; SEQ ID NO: 128) and 564-566 (KFY). The epitopes of PSMA (G≤−1 kcal/mol) against PSMB1183 were residues 188-191 (LERD; SEQ ID NO: 132), 308-319 (KMGGSAPPDSSW; SEQ ID NO: 133), 327 (Y), and 353-354 (TR). The sequence coverage of PSMW39 was 98% (=693/713) when digested by pepsin—FPXII mixed bed column after quenched with 8 M urea, 1 M TCEP, pH 3.0.

    Example 7. TOPA-[C7]-Phenylthiourea-PSMB1154 Antibody Conjugate

    [1172] ##STR00079##

    (In the TOPA-[C7]-phenylthiourea-PSMB1154 Antibody Conjugate depicted above, the structure does not show the lysine residue of PSMB1154 that is linked to the phenylthiourea moiety.)

    TOPA-[C7]-Phenylthiourea Modification of mAb:

    [1173] PSMB1154 mAb (10 mg/ml) was diluted to 1 mg/ml in 1×DPBS buffer. Directly prior to conjugation, pH was adjusted to pH 9 with 1M sodium bicarbonate buffer (VWR 144-55-8) and confirmed with pH paper. An 8×molar excess of TOPA-[C7]-phenylisothiocyanate (50 mM stock dissolved in DMSO) was added to the PSMB1154 mAb, and the mixture of antibody and TOPA-[C7]-phenylisothiocyanate was incubated at room temperature without shaking for approximately 1 hour. The addition of TOPA-[C7]-phenylisothiocyanate was monitored by intact mass ESI-TOF LC-MS on an Agilent® G224 instrument until the CAR value reached 1.5-2.0 and was then quenched by addition of 1M Tris pH 8.5 (Teknova T1085) to a final concentration of 100 mM. Excess free chelator was removed by exchanging the reaction into 10 mM sodium acetate pH 5.2 using a 55 ml HiPrep 26/10 desalting column (17508701—Cytiva). To confirm no excess chelator remained, 3 rounds of sample dilution followed by concentration using a 50,000 MWCO Amicon concentrator device was performed. Sample was then concentrated to >10 mg/ml in preparation for radiolabeling. The final chelator:antibody ratio was determined by ESI-TOF as above. The conjugate was confirmed to be monomeric by analytical size exclusion chromatography on a Tosoh TSKgel G3000SWxl 7.8 mm×30 cm, 5 um column run at room temperature at 0.8 mL/min with 1×DPBS mobile phase.

    Example 8. Ac-225 Labeled TOPA-[C7]-Phenylthiourea-PSMB1154 Antibody Conjugate

    [1174] ##STR00080## ##STR00081##

    (In the Ac-225 labeled TOPA-[C7]-phenylthiourea-PSMB1154 Antibody Conjugate depicted above, the structure does not show the lysine residue of PSMB1154 that is linked to the phenylthiourea moiety.)
    Labeling of TOPA-[C7]-Phenylthiourea-PSMB1154 with Ac-225 in 3M NaOAc Buffer:

    [1175] To a solution of NaOAc (3 M in H.sub.2O, 40 μL) in a plastic vial was added sequentially Ac-225 (10 mCi/mL in 0.1 N HCl, 10 μL) and TOPA-[C7]-phenylthiourea-PSMB1154 (1 mg/mL in 10 mM NaOAc pH=5.5, 333 uL, 0.33 mg). After mixing, the pH was ˜6.5 by pH paper. The vial was left standing still at 37° C. for 2 hr.

    iTLC of the Labeling Reaction Mixture:

    [1176] 0.5 μL of the labeling reaction mixture was loaded onto an iTLC-SG, which was developed with 10 mM EDTA (pH 5-6). The dried iTLC-SGwas left at room temperature for >6 hours before it was scanned on a Bioscan AR-2000 radio-TLC scanner. Under the elution conditions described herein, TOPA-[C7]-phenylthiourea-PSMB 1154 bound Ac-225 stays at the origin and any free Ac-225 migrates with the solvent to the solvent front. Scanning of the iTLC showed 100% TOPA-[C7]-phenylthiourea-PSMB1154 bound Ac-225.

    Purification on PD10 Column:

    [1177] The PD-10 resin was conditioned in NaOAc buffer solution by passing 5 mL×3 of NaOAc buffer (25 mM NaOAc pH 5.5, 0.04% PS-20, 0.5% w/v sodium ascorbate) through the column. The entire labeling reaction mixture was applied to the reservoir of the column and the eluate collected. The reaction vial was then washed with 0.2 mL×3 NaOAc buffer and the washings pipetted into the reservoir of the PD-10 column and the eluate was collected. Application of NaOAc buffer into the reservoir of the PD-10 column continued until a total elution volume of 10 mL was reached. Elution fractions were collected in 10×1 mL fractions in prenumbered tubes. The radiochemical purity of fractions collected was checked by iTLC as above; fractions determined to be pure were further analyzed by DTPA challenge and HPLC.

    DTPA Challenge of the Purified .SUP.225.Ac-TOPA-[C7]-Phenylthiourea-PSMB1154:

    [1178] 10 μL of each pure fraction was mixed with 15 μL of 10 mM DTPA solution (pH 6.5) and incubated for 30 min at 37 C. 10 μL of the mixture was loaded onto an iTLC-SG, and analyzed as above. No radioactivity signal was observed at the solvent front of the iTLC-SG indicating that there is no free Ac-225 in the fractions following DTPA challenge.

    HPLC Analysis of the Purified .SUP.225.Ac-TOPA-[C7]-Phenylthiourea-PSMB1154:

    [1179] The pure fractions collected after PD-10 column were analyzed by HPLC. HPLC method: Tosoh TSKgel G3000SWxl 7.8 mm×30 cm, 5 μm column; column temperature: room temperature; the column was eluted with 1×DPBS buffer; flow rate: 0.7 mL/min; 20 min run; injection volume: 40 μL. After HPLC, fractions were collected in time intervals of 15 seconds. The collected HPLC fractions were left at room temperature for >6 hours and then the radioactivity in each of the collected fractions were counted in a gamma counter. The HPLC radio trace was constructed from the radioactivity in each HPLC fraction. HPLC radio trace showed a radioactive peak corresponding to monomeric TOPA-[C7]-phenylthiourea-PSMB 1154 peak on HPLC UV trace that was >99% of total counts per minute.

    Example 9. DOTA-Phenylthiourea-PSMB1154 Antibody Conjugate

    DOTA-Phenylthiourea Modification of mAb

    [1180] PSMB1154 (10 mg/ml) was diluted to 1 mg/ml in 1×DPBS buffer. The PSMB1154 stock was treated with Chelex 100 resin (BioRad 143-2832) to remove metal ions. 1-2 g of resin were added per mL of solution and rotated for 30 minutes at room temperature, followed by filtering to remove the resin. Chelex-treated buffers were prepared similarly. Directly prior to conjugation, the pH was adjusted to pH 9 with chelex-treated 1M sodium bicarbonate buffer (VWR 144-55-8) and confirmed with pH paper.

    [1181] A 100×molar excess of p-SCN-Bn-DOTA (Macrocyclics catalog #B-205) from a 50 mM stock dissolved in water was added to the PSMB1154 antibody, and the mixture of antibody and DOTA was incubated at room temperature without shaking for approximately 30 min. The addition of DOTA-phenylisothiocyanate was monitored by intact mass ESI-TOF LC-MS on an Agilent® G224 instrument until the chelator antibody ratio (CAR) reached 1.5-2.0 and was then quenched by addition of 1M Tris pH 7.5 to a final concentration of 100 mM. Excess free chelator was removed by exchanging the reaction into 50 mM sodium acetate pH 5.5 using Zeba 7K desalting columns equilibrated in Chelex-treated 50 mM NaOAc pH 5.5. To confirm no excess chelator remained, 3 rounds of sample dilution followed by concentration using a 50,000 MWCO Amicon concentrator device was performed. Sample was then concentrated to >9 mg/ml in preparation for radiolabeling. The final chelator:antibody ratio was determined by ESI-TOF as above. The conjugate was confirmed to be monomeric by analytical size exclusion chromatography on a Tosoh TSKgel G3000SWxl 7.8 mm×30 cm, 5 um column run at room temperature at 0.8 mL/min with 1×DPBS mobile phase.

    Example 10. In-111 Labeled DOTA-Phenylthiourea-PSMB1154 Antibody Conjugate

    [1182] Labeling of DOTA-Phenylthiourea-PSMB1154 with In-111

    [1183] In-111 chloride (2.5 mCi in 12.5 uL) was mixed with 87.5 uL of 50 mM HCl. 80 uL of the diluted stock (2 mCi) was combined with 800 μL HEPES buffer (0.5 M, pH 5.7), and 814 uL of this mixture (1.84 mCi) was added to 22 uL of DOTA-PSMB 1154 (9.3 mg/mL). The vial was left standing still at 37° C. for 1 hr.

    iTLC of the Labeling Reaction Mixture:

    [1184] 0.5 μL of the labeling reaction mixture was loaded onto an iTLC-SG, which was developed with 10 mM EDTA (pH 5-6). The dried iTLC-SG was scanned on a Bioscan AR-2000 radio-TLC scanner. Under the elution conditions described herein, DOTA-PSMB 1154 bound In-111 stays at the origin and any free In-111 migrates with the solvent to the solvent front. Scanning of the iTLC showed >95% DOTA-PSMB 1154 bound In-111.

    Purification on PD10 Column:

    [1185] The PD-10 resin was conditioned in NaOAc buffer solution by passing 5 mL×3 of NaOAc buffer (25 mM NaOAc pH 5.5, 0.04% PS-20, 0.5% w/v sodium ascorbate) through the column. The entire labeling reaction mixture was applied to the reservoir of the column and the eluate collected. The reaction vial was then washed with 0.2 mL×3 NaOAc buffer and the washings pipetted into the reservoir of the PD-10 column and the eluate was collected. Application of NaOAc buffer into the reservoir of the PD-10 column continued until a total elution volume of 10 mL was reached. Elution fractions were collected in 10×1 mL fractions in prenumbered tubes. The radiochemical purity of fractions collected was checked by iTLC as above; fractions determined to be pure were further analyzed by DTPA challenge and HPLC.

    DTPA Challenge of the Purified .SUP.111.In-DOTA-PSMB1154:

    [1186] 10 μL of each pure fraction was mixed with 15 μL of 10 mM DTPA solution (pH 6.5) and incubated for 30 min at 37 C. 10 μL of the mixture was loaded onto an iTLC-SG, and analyzed as above.

    HPLC Analysis of the Purified .SUP.111.In-DOTA-PSMB1154:

    [1187] The pure fractions collected after PD-10 column were analyzed by HPLC. HPLC method: Tosoh TSKgel G3000SWxl 7.8 mm×30 cm, 5 μm column; column temperature: room temperature; the column was eluted with 1×DPBS buffer; flow rate: 0.7 mL/min; 20 min run; injection volume: 40 μL. After HPLC, fractions were collected in time intervals of 15 seconds. The HPLC was equipped with an in-line radiodetector to generate a radio trace. The HPLC showed a radioactive peak corresponding to monomeric DOTA-PSMB1154 peak on HPLC UV that was >96% of the total signal.