NATURAL KILLER CELLS WITH ENHANCED IMMUNE RESPONSE
20250122475 ยท 2025-04-17
Inventors
Cpc classification
A61K40/15
HUMAN NECESSITIES
A61K35/17
HUMAN NECESSITIES
Y02A50/30
GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
International classification
A61K35/17
HUMAN NECESSITIES
Abstract
The invention relates to a specialized subpopulation of natural killer cells that have enhanced effector functions and the potential to kill malignant tumor cells or infected cells when the natural killer cells are exposed to an antibody bound to the tumor cells or the infected cells.
Claims
1-19. (canceled)
20. A composition comprising natural killer cells that do not express substantial FcR (g.sup.NK cells).
21. The composition of claim 20, wherein the g.sup.NK cells express no detectable FcR.
22. The composition of claim 20, wherein the g.sup.NK cells express KIR2DL2/3, CD16,MKp30, NKp46 or a combination thereof.
23. The composition of claim 20, wherein the g.sup.NK cells produce significantly greater amounts of a cytokine than natural killer cells that do express FcR.
24. The composition of claim 23, wherein the cytokine is interferon-gamma (IFN-), tumor necrosis factor- (TNF-), or a combination thereof.
25. The composition of claim 20, wherein the g.sup.NK cells produce significantly greater amounts of a chemokine.
26. The composition of claim 25, wherein the chemokine is MIP-1, MIP-1 or a combination thereof.
27. The composition of claim 20, comprising a physiologically acceptable carrier.
28. A method of treating a subject suspected of having cancer, comprising administering the composition of claim 20 to the subject to thereby treat the subject.
29. A method of treating a subject suspected of having a microbial infection, comprising administering the composition of claim 20 to the subject to thereby treat the subject.
30. A method of treating a subject suspected of having a viral infection, comprising administering the composition of claim 20 to the subject to thereby treat the subject.
31. The method of any of claims 28-30, further comprising isolating g.sup.NK cells from the subject.
32. The method of claim 31, further comprising culturing the g.sup.NK cells in a cell culture medium.
33. The method of claim 31, wherein IL-12, IL-15, IL-18, IL-2, and/or CCL5 is administered to the subject prior to isolating the g.sup.NK cells.
34. The method of any of claims 28-30, wherein a cell receptor is activated in the g.sup.NK cells upon contact with an antibody.
35. The method of claim 34, wherein the antibody is on a cell in the subject.
36. The method of claim 35, wherein the cell is a cancer cell or an infected cell.
37. The method of any of claims 28-30, further comprising administering a composition of one or more therapeutic antibody.
38. A method of identifying g.sup.NK cells comprising: identifying a subset of natural killer cells in a population of lymphocytes that do not express substantial FcR to thereby identify g.sup.NK cells.
39. The method of claim 38, further comprising obtaining lymphocytes from a subject.
40. The method of claim 38, comprising identifying cells that do not express substantial FcR, but do express at least one marker for natural killer cells.
41. The method of claim 40, comprising administering a therapeutic antibody to the subject when g.sup.NK cells are identified in a sample from a subject.
42. The method of claim 40, comprising avoiding unnecessary treatment of a subject when gNK cells are not identified in a sample from a subject.
Description
BRIEF DESCRIPTION OF THE FIGURES
[0011]
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
DETAILED DESCRIPTION
[0024] As described herein, the invention relates to a previously unknown population of NK cells that are deficient for the signaling adaptor -chain, yet display enhanced Fc receptor-dependent activity. Compared to conventional NK cells that express the -chain, -deficient NK cells (herein termed .sup.NK cells or g.sup.NK cells) produce significantly greater amounts of cytokines (IFN- and TNF-) and chemokines (MIP-1 and MIP-1) upon stimulation through the Fc receptor CD16. Analyses of healthy donor samples indicate that g.sup.NK cells can mediate enhanced anti-cancer activity upon encountering antibody-coated tumor cells in patients receiving therapeutic anti-tumor mAb. Interestingly, g.sup.NK cells have been found in only one third of the healthy human donors analyzed.
Natural Killer Cells
[0025] Natural killer (NK) cells are innate lymphocytes important for mediating anti-viral and anti-cancer immunity through cytokine and chemokine secretion, and through the release of cytotoxic granules (Vivier et al. Science 331(6013):44-49 (2011); Caligiuri, Blood 112(3):461-469 (2008); Roda et al., Cancer Res. 66(1):517-526 (2006)).
[0026] While significant advances have been made in cancer treatment by use of antibodies directed against cancer antigens, the responsiveness of patients to such antibodies varies. Investigation of such variable responses has typically focused on the direct inhibitory effects of these antibodies on the tumor cells (e.g. inhibition of growth factor receptors and the subsequent induction of apoptosis) and the in vivo effects of these antibodies may be more complex and may involve the host immune system. For example, the mechanism of action of such anti-cancer antibodies may include one or more of the following: antibody-dependent cellular cytotoxicity (ADCC), antibody-dependent cytokine/chemokine production, and complement-dependent cytotoxicity (CMC).
[0027] Antibody-dependent cellular cytotoxicity and antibody-dependent cytokine/chemokine production are primarily mediated by the specialized subset of lymphocytes, natural killer (NK) cells. NK cells are effector cells that comprise the third largest population of lymphocytes and are important for host immuno-surveillance against tumor and pathogen-infected cells.
[0028] Upon activation, NK cells produce cytokines and chemokines abundantly and at the same time exhibit potent cytolytic activity. Activation of NK cells can occur through the direct binding of NK cell receptors to ligands on the target cell, as seen with direct tumor cell killing, or through the crosslinking of the Fc receptor (CD16; FcRIII) by binding to the Fc portion of antibodies bound to an antigen-bearing cell. This CD16 engagement (CD16 crosslinking) initiates NK cell responses via intracellular signals that are generated through one, or both, of the CD16-associated adaptor chains, FcR or CD3. Triggering of CD16 leads to phosphorylation of the or chain, which in turn recruits tyrosine kinases, syk and ZAP-70, initiating a cascade of signal transduction leading to rapid and potent effector functions. The most well-known effector function is the release of cytoplasmic granules carrying toxic proteins to kill nearby target cells through the process of antibody-dependent cellular cytotoxicity. CD16 crosslinking also results in the production of cytokines and chemokines that, in turn, activate and orchestrate a series of immune responses.
[0029] This release of cytokines and chemokines can play a role in the anti-cancer activity of NK cells in vivo. NK cells also have small granules in their cytoplasm containing perforin and proteases (granzymes). Upon release from the NK cell, perforin forms pores in the cell membrane of targeted cells through which the granzymes and associated molecules can enter, inducing apoptosis. The fact that NK cells induce apoptosis rather than necrosis of target cells is significantnecrosis of a virus-infected cell would release the virions, whereas apoptosis leads to destruction of the virus inside the cells.
[0030] However, unlike T and B lymphocytes, NK cells are thought to have only a limited capacity for target recognition using germline-encoded activation receptors (Bottino et al., Curr Top Microbiol Immunol. 298:175-182 (2006); Stewart et al., Curr Top Microbiol Immunmol. 298:1-21 (2006)). NK cells express the activating Fc receptor CD16, which recognizes IgG-coated target cells, thereby broadening target recognition (Ravetch & Bolland, Annu Rev Immunol. 19:275-290 (2001); Lanier Nat Immunol. 9(5):495-502 (2008); Bryceson & Long, Curr Opin Immunol. 20(3):344-352 (2008)).
[0031] The expression and signal transduction activity of several NK cell activation receptors requires physically associated adaptors, which transduce signals through immunoreceptor tyrosine-based activation motifs (ITAMs). Among these adaptors, FcR and CD3 chains can associate with CD16 and natural cytotoxicity receptors (NCRs) as either disulfide-linked homo-dimers or hetero-dimers, and these chains have been thought to be expressed by all mature NK cells.
[0032] As described herein, a novel subset of human NK cells has been identified that is deficient for the FcR-chain, and displays specialized immune functions. These novel NK cells are referred to herein as g.sup.NK cells. The g.sup.NK cells express the signaling adaptor -chain abundantly, but are deficient in the expression of the signaling adaptor -chain. Compared to conventional NK cells, these -deficient g.sup.NK cells exhibit dramatically enhanced activity when activated by antibodies. For example, the g.sup.NK cells can be activated by antibody-mediated crosslinking of CD16 or by antibody-coated tumor cells.
[0033] The g.sup.NK cells described herein not only produce significantly greater amounts of cytokines (IFN- and TNF-) and chemokines (MIP-1, MIP-1 and RANTES), but also display higher degranulation responses. The g.sup.NK cells provide high expression of Granzyme B, a component of natural killer cell cytotoxic machinery. Moreover, the g.sup.NK cells have a prolonged lifespan, compared to conventional NK cells, and their presence is maintained long-term. They are functionally and phenotypically stable.
[0034] The g.sup.NK cell subset of natural killer cells is found only in about one-third of the population, and among the individuals with this subset, the percentage of g.sup.NK cells within the NK cell compartment is variable. Thus, the degree to which an individual has such a subset of NK cells identifies patients that will be, or are, responsive to antibody-based therapy.
[0035] One aspect of the invention is therefore a method of identifying a subject responsive to cancer therapy that involves detecting whether a percentage of the patient's natural killer cells fail to express FcR. Such failure to express FcR identifies a subject who will be responsive to antibody-based cancer therapy. In some embodiments, the method also includes detecting whether the patient's natural killer cells that fail to express FcR do express CD3.
[0036] Sequences for various FcR and CD3 proteins and nucleic acids are available from the National Center for Biotechnology Information (NCBI) database (see, e.g., the website at ncbi.nlm.nih.gov). For example, an amino acid sequence for FcR (Homo sapiens, also called the High affinity immunoglobulin gamma Fc receptor 1) is available in the NCBI database as accession number NP_004097.1 (GI:4758344), and is reproduced below as SEQ ID NO:1.
TABLE-US-00001 1 MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLT 41 LLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLK 61 HEKPPQ
[0037] An amino acid sequence for the human CD3 (Homo sapiens) is available in the NCBI database as accession number ABQ28690.1 (GI:146399947), and is reproduced below as SEQ ID NO:2.
TABLE-US-00002 1 AILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTAL 41 FLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKR 81 RG
[0038] As described herein, reduced or absence of expression of FcR is a surprisingly effective marker for the g.sup.NK cell subset of natural killer cells that produce significantly greater amounts of cytokines (IFN- and TNF-) and chemokines (MIP-1, MIP-1 and RANTES), higher degranulation responses and have a prolonged lifespan. The g.sup.NK cell subset of natural killer cells express CD3 abundantly. Thus, the g.sup.NK cell subset of natural killer cells can be identified by detecting natural killer cells that express CD3 bot exhibit substantially low or no expression of FcR.
Detecting, Identifying and/or Isolating gNatural Killers Cells
[0039] Natural killer can be identified by any convenient procedure, for example, by their expression patterns. For example, mature NK cells express known substances or markers that can be detected by procedures available in the art. A typical human marker profile includes, for example, NKG2A, NKG2D, NKp30, NKp44, NKp46, CD56, CD161, 2B4, NTB-A, CRACC, DNAM-1, CD69, CD25 and/or NKp44. Other markers for natural killer cells inclode KIRs. A typical mouse marker profile includes, for example, NK1.1, CD122, LY49 Family (Ly49A, Ly49C, Ly49D, Ly49E, Ly49F, Ly49G, Ly49H, and Ly49I), and/or NKG2A/C/E. NK cells do not express T-cell antigen receptors (TCR), CD3 or surface immunoglobulins (Ig) B cell receptor, but generally express the surface marker CD56 in humans.
[0040] The g.sup.NK cell subset of natural killer cells can be detected by observing whether FcR is expressed by a subpopulation of natural killer cells. The natural killer cells that do not express FcR are g.sup.NK cells. In some embodiments it may be useful to detect expression of any of the above-mentioned other natural killer cell markers as a positive identifier that the cell is a natural killer cell while also confirming that the cell does not express FcR. Expression of a natural killer cell surface marker that correlates with the expression of FcR (or lack thereof) can be detected by any available procedure that does not injure the cells. For example, the g.sup.NK cells can be detected, identified and/or isolated by flow cytometry by use of such a cell surface marker that correlates with FcR expression.
[0041] The CD3 and/or FcR proteins are intracellular proteins that are not easily detected unless the cells are treated to allow intracellular proteins to be detected, for example, by fixation and permeabilization. While such treatment can be used to confirm the identity of a substantially pure population of cells, in many cases it is preferable to use cell-surface markers that can be detected without injuring the cells when identifying and isolating g.sup.NK cells. For example, surface markers such as KIR (Killer cell immunoglobulin-like receptors) can be used to identify and isolate mature NK cells, and Natural cytotoxicity receptors (NCR) which are normally expressed on NK cells, but are not expressed on g.sup.NK cells can be used to identify and isolate g.sup.NK cells.
[0042] Antibodies and other binding entities can be used to detect expression levels of marker proteins (e.g., KIR and/or NCR), and isolate the g.sup.NK cells. For example, in some embodiments, antibodies specific for FcR-expressing cells (e.g., antibodies specific for a cell surface marker such as NCR that correlates with FcR expression) can be bound to a solid substrate, natural killer cells can be contacted with the antibody-substrate, and cells that do not bind to the antibodies are collected. Other methods available to those of skill in the art can also be employed.
[0043] Such antibodies and binding entities can be prepared by available methods. For example, KIR and/or NCR, amino acid sequences, including those illustrated herein, can be used to make KIR and/or NCR antibodies and binding entities.
[0044] An amino acid sequence for a human KIR polypeptide (Homo sapiens) is available in the NCBI database as accession number NP_037421.2 (GI:134268644), and is reproduced below as SEQ ID NO:3.
TABLE-US-00003 1 MSLMVVSMACVGLFLVQRAGPHMGGQDKPFLSAWPSAVVP 41 RGGHVTLRCHYRHRFNNFMLYKEDRIHIPIFHGRIFQESF 81 NMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPVVIMVTGN 121 HRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEGI 161 SKDPSRLVGQIHDGVSKANFSIGPMMLALAGTYRCYGSVT 181 HTPYQLSAPSDPLDIVVTGPYEKPSLSAQPGPKVQAGESV 241 TLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADF 281 PLGPATHGGTYRCFGSFRHSPYEWSDPSDPLLVSVTGNPS 301 SSWPSPTEPSSKSGNPRHLHILIGTSVVIILFILLLFFLL 361 HLWCSNKKNAAVMDQEPAGNRTANSEDSDEQDPEEVTYAQ 401 LDHCVFTQRKITRPSQRPKTPPTDTILYTELPNAKPRSKV 421 VSCP
When making antibodies, the extracellular portion of the KIR polypeptide can be employed. Thus, in some embodiments, a KIR antigen may not include the signal peptide (amino acids 1-21) and/or the transmembrane region (amino acids 341-360).
[0045] Other human KIR polypeptide sequences are available, for example, in the NCBI database with any of the following accession numbers: NP_703144.2 (GI:46488946), NP_001229796.1 (GI:338968852), NP_001229796.1 (GI:338968852), NP_006728.2 (GI:134268642), NP_065396.1 (GI:11968154), NP_001018091.1 (GI:66267727), NP_001077008.1 (GI:134133244), NP_036444.1 (GI:6912472), NP_055327.1 (GI:7657277), NP_056952.2 (GI:71143139), NP_036446.3 (GI:116517309), NP_001074239.1 (GI:124107610), NP_002246.5 (GI:124107606), NP_001074241.1 (GI:124107604), NP_036445.1 (GI:6912474) or a combination thereof. Any such KIR polypeptides can be used as antigens to make antibodies. The antigens employed can include an extracellular region of the KIR protein, and can exclude other portions of the KIR protein (e.g., the signal peptide, an intracellular domain, and/or a transmembrane domain).
[0046] An amino acid sequence for a human NCR polypeptide (Homo sapiens) is available in the NCBI database as accession number NP_004819.2 (GI:153945782), and is reproduced below as SEQ ID NO:4.
TABLE-US-00004 1 MAWRALHPLLLLLLLFPGSQAQSKAQVLQSVAGQTLTVRC 41 QYPPTGSLYEKKGWCKEASALVCIRLVTSSKPRTMAWTSR 61 FTIWDDPDAGFFTVTMTDLREEDSGHYWCRIYRPSDNSVS 121 KSVRFYLVVSPASASTQTSWTPRDLVSSQTQTQSCVPPTA 161 GARQAPESPSTIPVPSQPQNSTLRPGPAAPIALVPVFCGL 201 LVAKSLVLSALLVWWGDIWWKTMMELRSLDTQKATCHLQQ 241 VTDLPWTSVSSPVEREILYHTVARTKISDDDDEHTL
As indicated above for KIR, when making antibodies, the extracellular portion of the NCR polypeptide can be employed. Thus, in some embodiments, a NCR antigen may not include the signal peptide (amino acids 1-21) and/or the transmembrane region (amino acids 193-213).
[0047] Other NCR polypeptide sequences are available and can be used to make antibodies. For example, the NCBI database provides a number human NCR polypeptide sequences with the following accession numbers: O14931.1 (GI:47605770), O95944.2 (GI:251757303), O76036.1 (GI:47605775), NP_001138939.1 (GI:224586865), and/or NP_001138938.1 (GI:224586860). Any such NCR polypeptides can be used as antigens to make antibodies. The antigens employed can include an extracellular region of the NCR protein, and can exclude other portions of the NCR protein (e.g., the signal peptide, an intracellular domain, and/or a transmembrane domain).
[0048] Suitable antibodies may include polyclonal, monoclonal, fragments (such as Fab fragments), single chain antibodies and other forms of specific binding molecules.
[0049] Briefly, methods for detecting, identifying and/or isolating g.sup.NK cells can include contacting a cell population, or cell sample, with an antibody specific to NCR, and removing any cells that form a complex with the anti-NCR antibodies. In other embodiments, methods for detecting, identifying and/or isolating g.sup.NK cells can include contacting a cell population, or a cell sample, with an antibody to a natural killer cell specific marker, such as KIR, and an antibody specific for NCR; identifying, detecting and/or isolating cells that form a complex with the natural killer-specific antibody, to thereby identify, detect or isolate natural killer cells in the population or sample; and identifying, detecting and/or isolating the natural killer cells that do not form substantially any complex with the anti-NCR antibodies. Anti-FcR antibodies can be used on an aliquot of a population of natural kills cells treated (e.g. fixed) to permit antibody detection of intracellular proteins to confirm that a population of cells does not express FcR.
[0050] In some embodiments, a signal from the complex between the natural killer cells and the antibody to a natural killer cell specific marker is detected (e.g., KIR). However, when the natural killer cells are g.sup.NK cells substantially no signal from an NCR protein-antibody complex (or FcR protein-antibody complex) is detected because substantially no NCR protein-antibody complex (or FcR protein-antibody complex) forms.
[0051] In some embodiments, natural killer cells are first isolated and then sorted using available proceduresthose cells that express substantially no NCR are collected.
[0052] For example, a population of lymphocytes or peripheral blood mononuclear cells (PBMCs) can be obtained. Natural killer cells expressing one or more natural killer cell-specific markers are isolated from the cell population. For example, the natural killer cells may be identified as those expressing typical human natural killer cell markers such as KIR, NKG2A, NKG2D, NKp30, NKp44, NKp46, CD56, and CD161. For studies involving mice, natural killer cells can be identified and/or isolated using typical mouse markers such as NK1.1, CD122, LY49 Family (Ly49A, Ly49C, Ly49D, Ly49E, Ly49F, Ly49G, Ly49H, and Ly49I), or NKG2A/C/E.
[0053] Once the population of cells is a substantially pure population of natural killer cells, the g.sup.NK cells are identified as those that do not express NCR (or FcR) protein. For example, the population of natural killer cells can be sorted by flow cytometry using an antibody specific for NCR protein. The cells that are labeled by the anti-NCR antibodies are discarded and the cells that are not labeled by the anti-FcR antibodies are retained as g.sup.NK cells. Alternatively, the population of natural killer cells can be contacted with a solid substrate to which anti-NCR antibodies are bound. The cells that do not bind are the desired g.sup.NK cells, In another embodiment, the population of natural killer cells can be contacted with magnetic beads to which anti-NCR antibodies are bound, after incubation the magnetic beads are removed from the cell population, leaving the g.sup.NK cells as a substantially pure population of cells.
[0054] As illustrated herein, signals from labeled antibodies can be used for detection, identification and isolation of different cell types. A signal from an antibody specific for natural killer cells or a signal from an antibody specific for NCR (FcR) can be detected, for example, by using a label that is directly or indirectly attached to the antibody. Such an antibody with a directly attached label can be an antibody with a covalently attached reporter molecule.
[0055] As used herein, a reporter molecule is a molecule that provides an analytically detectable signal, allowing the detection of antigen-bound antibody. In some embodiments, detection is preferably at least relatively quantifiable, to allow determination of the amount of antigen (and/or cells expressing such an antigen) in the sample. Quantification of antigen (or cells expressing the antigen) may be calculated in absolute terms, or may be by comparison with a standard (or series of standards) containing a known normal level of antigen (and/or cells expressing such an antigen).
[0056] Many commonly used reporter molecules in this type of assay are either enzymes or fluorophores, For example, labels employed for flow cytometry detection and sorting of cells are often fluorescent labels or magnetic beads. In some embodiments, a second antibody can be used that binds to the anti-FcR antibody or antibody specific for natural killer cells. The reporter molecule can then be on the second antibody.
[0057] Fluorescent compounds, such as fluorescein or rhodamine, may be chemically coupled to antibodies without altering their binding capacity. When activated by illumination with light of a particular wavelength, the fluorophore-labeled antibody absorbs the light energy, inducing a state of excitability in the molecule, followed by emission of the light at a characteristic longer wavelength. The emission appears as a characteristic color visually detectable with a light microscope.
[0058] While fluorophores are often employed, other types of reporter molecules can also be employed including enzymes, magnetic beads, radioactive isotopes, enzymes and the like. Commonly used enzymes include horseradish peroxidase, glucose oxidase, beta-galactosidase and alkaline phosphatase, among others. The enzyme substrates to be used with the specific enzymes are generally chosen for the production, upon hydrolysis by the corresponding enzyme, of a detectable color change. For example, p-nitrophenyl phosphate is suitable for use with alkaline phosphatase conjugates; for peroxidase conjugates, 1,2-phenylenediamine or toluidine are commonly used. It is also possible to employ fluorogenic substrates, which yield a fluorescent product rather than the chromogenic substrates noted above. In all cases, the enzyme-labeled antibody is added to the first antibody-antigen complex and allowed to bind to the complex, and then the excess reagent is washed away. A solution containing the appropriate substrate is then added to the tertiary complex of antibody-antigen-labeled antibody. The substrate reacts with the enzyme linked to the second antibody, giving a qualitative visual signal, which may be further quantified, usually spectrophotometrically, to give an evaluation of the amount of antigen that is present in the serum sample.
Compositions and Methods
[0059] Another aspect of the invention is a composition including g.sup.NK cells. Such a composition of g.sup.NK cells can include a pharmaceutically acceptable carrier or vehicle.
[0060] A pharmaceutically acceptable carrier or vehicle for such g.sup.NK cells is any non-toxic aqueous solution in which the g.sup.NK cells can be maintained, or remain viable, for a time sufficient to allow administration of live g.sup.NK cells. For example, the pharmaceutically acceptable carrier or vehicle can be a saline solution or buffered saline solution. The pharmaceutically acceptable carrier or vehicle can also include various bio materials that may increase the efficiency of g.sup.NK cells. Cell vehicles and carriers can, for example, include polysaccharides such as methylcellulose (M. C. Tate, D. A. Shear, S. W. Hoffman, D. G. Stein, M. C. LaPlaca, Biomaterials 22, 1113, 2001, which is incorporated herein by reference in its entirety), chitosan (Suh J K F, Matthew H W T. Biomaterials, 21, 2589, 2000; Lahiji A, Sohrabi A, Hungerford D S, et al., J Biomed Mater Res, 51, 586, 2000, each of which is incorporated herein by reference in its entirety), N-isopropylacrylamide copolymer P(NIPAM-co-AA) (Y. H. Bae, B. Vernon, C. K. Han, S. W. Kim, J. Control. Release 53, 249, 1998; H. Gappa, M. Baudys, J. J. Koh, S. W. Kim, Y. H. Bae, Tissue Eng. 7, 35, 2001, each of which is incorporated herein by reference in its entirety), as well as Poly(oxyethylene)/poly(D,L-lactic acid-co-glycolic acid) (B. Jeong, K. M. Lee, A. Gutowska, Y. H. An. Biomacromolecules 3, 865, 2002, which is incorporated herein by reference in its entirety), P(PF-co-EG) (Suggs L J, Mikos A G. Cell Trans, 8, 345, 1999, which is incorporated herein by reference in its entirety), PEO/PEG (Mann B K, Gobin A S, Tsai A T, Schmedlen R H, West J L., Biomaterials, 22, 3045, 2001; Bryant S J, Anseth K S. Biomaterials, 22, 619, 2001, each of which is incorporated herein by reference in its entirety), PVA (Chih-Ta Lee, Po-Han Kung and Yu-Der Lee, Carbohydrate Polymers, 61, 348, 2005, which is incorporated herein by reference in its entirety), collagen (Lee C R, Grodzinsky A J, Spector M., Biomaterials 22, 3145, 2001, which is incorporated herein by reference in its entirety), alginate (Bouhadir K H, Lee K Y, Alsberg E, Damm K L, Anderson K W, Mooney D J. Biotech Prog 17, 945, 2001; Smidsrd O, Skjak-Braek G., Trends Biotech, 8, 71, 1990, each of which is incorporated herein by reference in its entirety), etc. and they are used as a cell carrier for cellular treatment in the field of tissue engineering.
[0061] In some embodiments, the g.sup.NK cells can be present in the composition in an effective amount. An effective amount of activated g.sup.NK cells can vary depending on the patient, as well as the type, severity and extent of disease. Thus, a physician can determine what an effective amount is after considering the health of the subject, the extent and severity of disease, and other variables.
[0062] In certain embodiments of the invention, a therapeutically effective amount is the amount of a composition of the invention that reduces the severity, the duration and/or the symptoms associated with cancer, viral infection, microbial infection, or septic shock in an animal. In other embodiments, effective amount for cytotoxicity is defined as amount of g.sup.NK cell that is able to inhibit or reduce the growth of cancer, viral and microbial cells. In some embodiments, an effective amount of g.sup.NK cells is about 10.sup.6 to about 10.sup.12 cells, or about 10.sup.8 to about 10.sup.11 cells, or about 10.sup.9 to about 10.sup.10 cells. Such an amount can be administered to a cancer patient.
[0063] The composition can include increased percentages of g.sup.NK cells relative to natural populations of natural killer cells. For example, the composition can include 20%, 30%, 40%, 50%, 609%, 65%, 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or substantially 100% g.sup.NK cells.
[0064] In some embodiments, the g.sup.NK cells are administered to a subject soon after isolation. In other embodiments, the g.sup.NK cells are stored or expanded by growth in culture prior to administration.
[0065] The g.sup.NK cells can be can be administered to a subject by any convenient route including parenteral routes such as subcutaneous, intramuscular, intravenous, and/or epidural routes of administration.
[0066] In some embodiments, the g.sup.NK cells can be preserved at ultra low temperature before the administration to a patient. The g.sup.NK cells can also be preserved at ultra low temperature after isolation from a mammalian subject. For example, lymphocytes or another source of g.sup.NK cells can be isolated, stored at ultra low temperature and then processed to yield isolated g.sup.NK cells. Alternatively, the lymphocytes or another source of g.sup.NK cells can be isolated, processed to yield g.sup.NK cells and then stored at ultra-low temperature.
[0067] A typical method for the preservation at ultra low temperature in small scale is described, for example, in U.S. Pat. No. 6,0168,991. For small-scale, cells can be preserved at ultra low temperature by low density suspension (e.g., at a concentration of about 20010.sup.6/ml) in 5% human albumin serum (HAS) which is previously cooled. An equivalent amount of 20% DMSO can be added into the HAS solution. Aliquots of the mixture can be placed into vials and frozen overnight inside an ultra low temperature chamber at about 80 C.
[0068] The g.sup.NK cells can be employed in methods for treating cancer, viral infections, bacterial infections, and other disease states. The g.sup.NK cells can be administered to a subject to treat any disease or disorder responsive to cytokines and/or the release of natural killer cell cytoplasmic granules. For example, the disease or disorder can be responsive to cytokines such as gamma interferon (IFN-), tumor necrosis factor alpha (TNF-), and/or GM-CSF.
[0069] Diseases that the compositions and methods described herein can treat include microbial infection such as a viral infection, yeast infection, fungal infection, protozoan infection and/or bacterial infection.
[0070] By a viral infection is meant an infection caused by the presence of a virus in the body. Viral infections include chronic or persistent viral infections, which are viral infections that are able to infect a host and reproduce within the cells of a host over a prolonged period of time-usually weeks, months or years, before proving fatal. Viruses giving rise to chronic infections that which may be treated in accordance with the present invention include, for example, the human papilloma viruses (HPV), Herpes simplex, and other herpes viruses, the viruses of hepatitis B and C as well as other hepatitis viruses, human immunodeficiency virus, and the measles virus, all of which can produce important clinical diseases. Prolonged infection may ultimately lead to the induction of disease which may be, e. g., in the case of hepatitis C virus liver cancer, fatal to the patient. Other chronic viral infections which may be treated in accordance with the present invention include Epstein Barr virus (EBV), as well as other viruses such as those which may be associated with tumors.
[0071] Examples of viral infections which can be treated or prevented with the compositions and methods described herein include, but are limited to, viral infections caused by retroviruses (e. g., human T-cell lymphotrophic virus (HTLV) types I and II and human immunodeficiency virus (HIV)), herpes viruses (e. g., herpes simplex virus (HSV) types I and II, Epstein-Barr virus and cytomegalovirus), arenaviruses (e. g., lassa fever virus), paramyxoviruses (e. g., morbillivirus virus, human respiratory syncytial virus, and pneumovirus), adenoviruses, bunyaviruses (e. g., hantavirus), cornaviruses, filoviruses (e. g., Ebola virus), flaviviruses (e. g., hepatitis C virus (HCV), yellow fever virus, and Japanese encephalitis virus), hepadnaviruses (e. g., hepatitis B viruses (HBV), orthomyoviruses (e. g., Sendai virus and influenza viruses A, B and C), papovaviruses (e. g., papillomaviruses), picornaviruses (e. g., rhinoviruses, enteroviruses and hepatitis A viruses), poxviruses, reoviruses (e. g., rotaviruses), togaviruses (e. g., rubella virus), and rhabdoviruses (e. g., rabies virus). The treatment and/or prevention of a viral infection includes, but is not limited to, alleviating one or more symptoms associated with said infection, the inhibition, reduction or suppression of viral replication, and/or the enhancement of the immune response.
[0072] In some embodiments of the invention, a therapeutically effective amount is an amount of a composition described herein that results in a reduction in viral titer or microbial titer by at least 2.5%, at least 5%, at least 10%, at least 15%, at least 25%, at least 35%, at least 45%, at least 50%, at least 75%, at least 85%, by at least 90%, at least 95 9%, or at least 99% in an animal administered a composition of the invention relative to the viral titer or microbial titer in an animal or group of animals (e. g., two, three, five, ten or more animals) not administered a composition of the invention.
[0073] Examples of types of cancer and proliferative disorders that can be treated with the compositions described herein include, but are not limited to, leukemia (e. g., myeloblastic, promyelocytic, myelomonocytic, monocytic, erythroleukemia, chronic myelocytic (granulocytic) leukemia, and chronic lymphocytic leukemia),
[0074] lymphoma (e. g., Hodgkin's disease and non-Hodgkin's disease), fibrosarcoma, myxosarcoma, liposarcoma, chondrosarcoma, osteogenic sarcoma, angiosarcoma, endotheliosarcoma, Ewing's tumor, colon carcinoma, pancreatic cancer, breast cancer, ovarian cancer, prostate cancer, squamous cell carcinoma, basal cell carcinoma, adenocarcinoma, renal cell carcinoma, hepatoma, Wilm's tumor, cervical cancer, uterine cancer, testicular tumor, lung carcinoma, small cell long carcinoma, bladder carcinoma, epithelial carcinoma, glioma, astrocytoma, oligodendroglioma, melanoma, neuroblastoma, retinoblastoma, dysplasia and hyperplasia. The treatment and/or prevention of cancer includes, but is not limited to, alleviating one or more symptoms associated with cancer, the inhibition or reduction of the progression of cancer, the promotion of the regression of cancer, and/or the promotion of the immune response.
[0075] In certain other embodiments, a therapeutically effective amount is the amount of a composition of the invention that results in a reduction of the growth or spread of cancer by at least 2.5%, at least 5%, at least 10%, at least 159%, at least 25%, at least 35%, at least 45%, at least 50%, at least 75%, at least 85%, by at least 90%, at least 95 9%, or at least 99% in a patient or an animal administered a composition described herein relative to the growth or spread of cancer in a patient (or an animal) or a group of patients (or animals) not administered a composition of the invention.
[0076] In some embodiments, the compositions are used in a method of treating a yeast or bacterial infection. For example, the compositions and methods described herein can treat infections relating to Streptococcus pyogenes, Streptococcus pneumoniae, Neisseria gonorrhoea, Neisseria meningitidis, Corynebacterium diphtheriae, Clostridium botulinum, Clostridium perfringens, Clostridium tetani, Haemophilus influenzae, Klebsiella pneumoniae, Klebsiella ozaenae, Klebsiella rhinoscleromotis, Staphylococcus aureus, Vibrio cholera, Escherichia coli, Pseudomonas aeruginosa, Campylobacter (Vibrio) fetus, Campylobacterjejuni, Aeromonas hydrophila, Bacillus cereus, Edwardsiella tarda, Yersinia enterocolitica, Yersinia pestis, Yersinia pseudotuberculosis, Shigella dysenteriae, Shigella flexneri, Shigella sonnei, Salmonella typhimurium, Treponemapallidam, Treponemapertenue, Treponema carateneum, Borrelia vincentii, Borrelia burgdorferi, Leptospira icterohemorrhagiae, Mycobacterium tuberculosis, Toxoplasma gondii, Pneumocystis carinii, Francisella tularensis, Brucella aborts, Brucella sais, Brucella melitensis, Mycoplasma spp., Rickettsiaprowazeki, Rickettsia tsutsugumashi, Chlamydia spp., Helicobacter pylori or combinations thereof.
[0077] The g.sup.NK cells can be administered simultaneously with anti-microbial, anti-viral and other therapeutic agents.
[0078] For example, the g.sup.NK cells can be administered simultaneously with antibodies specific for a selected cancer type. Alternatively, the g.sup.NK cells can be administered at selected times that are distinct from the times when antibodies specific for a selected cancer type are administered. Antibodies specific for a selected cancer type include any antibody approved for treatment of cancer. Examples include trastuzumab (Herceptin) for breast cancer, rituximab (Rituxan) for lymphoma, and cetuximab (Erbitux) for head and neck squamous cell carcinoma.
[0079] The following non-limiting examples illustrate certain materials and methods used in developing the invention.
Example 1: Materials and Methods
[0080] This Example describes some of the materials and methods used to develop aspects of the invention.
Human Subjects and Blood Samples
[0081] PBMCs were isolated by Ficoll-Hypaque density gradient centrifugation of samples obtained from discarded, de-identified leukocyte reduction filters (American Red Cross), or blood donations from healthy volunteers with informed consent, approved by the Michigan State University Biomedical and Health Institutional Review Board.
Phenotypic Analysis of NK Cells
[0082] Peripheral blood mononuclear cells (PBMCs) were stained for flow cytometric analysis using fluorochrome-conjugated antibodies as previously described by Kim et al. (Proc Natl Acad Sci USA 105(8):3053-3058 (2008)). Antibodies to detect the following proteins were from Beckman Coulter [CD56 (N901), NKG2A (Z199), NKp44 (Z231)], BD Biosciences [CD3 (UCHT1), CD16 (3G8), KIR2DL2/3 (CH-L), KIR3DL1 (DX9), NKp46 (9E2), NKp30 (p30-15), CD11a (043-25B), CD11b (ICRF44), CD11e (B-1y6), NKG2D (1D11), CD161 (DX12), DNAM-1 (DX11), CD57 (NK-1), CD25 (M-A251), IFN- (B27), TNF- (Mab11), CD107a (H4A3), Granzyme A (CB9), Granzyme B (GB11)], Biolegend [CD14 (HCD14), CD19 (HIB19), CD2 (RPA-2.10), 2B4 (C1.7), NTB-A (NT-7), CRACC (162.1), CD69 (FN50)], eBiosciences [KIR2DL1 (HP-MA4), Perforin (dG9)], and R&D [NKG2C (134591)]. For detection of signaling adaptors, cells were fixed and permeabilized, then stained with FcRI subunit antibody (Millipore) that was conjugated with either Alexa-488 or Pacific blue, or mAbs against CD3 (6B10.2, Biolegend).
Cytokine Production and Degranulation Assays
[0083] PBMCs were stimulated for 4-6 hours with plate-bound anti-CD16 (3G8), or tumor cells (K562 or 721.221) at a ratio of 10:1 (E:T). Antibody-dependent functional activity was determined by pre-labeling P815 target cells with rabbit anti-mouse lymphocyte polyclonal antibodies, or SCC4 squamous carcinoma cells with anti-EGFR mAb (Cetuximab). All cytokine assays were performed in the presence of Brefeldin A. For degranulation assays, PBMCs were stimulated in the presence of anti-CD107a and monensin for 4 hours, followed by surface and intracellular staining for flow cytometry.
Immunoblot Analysis
[0084] Detection of FcR and CD3 in cell lysates was by immunoblot analysis using anti-FcRI subunit or anti-CD3 primary antibodies followed by anti-rabbit or anti-mouse secondary antibody, respectively, with visualization on Li-cor's odyssey.
NK Cell Sorting and Limiting Dilutions
[0085] PBMCs were sorted following surface receptor staining to exclude non-NK cells and enrich for enriched g.sup.NK and conventional NK cells. The resulting samples were plated by limiting dilution in NK cloning medium (RPMI1640 supplemented with 5% pooled human AB serum, 10% fetal bovine serum, 1 g/ml PHA, 100 U/ml IL-2, and 10 ng/ml Il-15) along with PHA-stimulated (1 g/ml for 1 h) allogeneic PBMCs and RPMI 8866 cells that had been treated with mitomycin C for 2 hours at 37 C. Feeder cells were added at 25,000 per well every 10-14 days for up to 2 months.
mRNA Quantification
[0086] Total RNA extracts were used to prepare cDNA for amplification by gene-specific primers in SYBR green PCR Mastermix (for enriched NK cells), or in the presence of gene-specific Taqman probes (for cultured NK cells) (Applied Biosystems). Amplification and detection was performed using an Applied Biosystems StepOnePlus Instrument and software. Relative quantities were calculated after normalization to GAPDH. The following primers were for SYBR green assays:
TABLE-US-00005 FcRsense, (SEQIDNO:5) 5-CGGCCGATCTCCAGCCCAAGA-3 FcRanti-sense, (SEQIDNO:6) 5-GCATGCAGGCATATGTGATGCC-3; GAPDHsense, (SEQIDNO:7) 5-GGAAGGTGAAGGTCGG-3; and GAPDHanti-sense, (SEQIDNO:8) 5-GAAGATGGTGATGGGATTTC-3.
Taqman gene expression assays for FcR (Hs00175408_m1), CD3 (Hs00609515_m1), and GAPDH (Hs03929097_g1) were from Applied Biosciences.
Statistics
[0087] Statistical analyses were performed using the paired Student's t-test. Differences were considered statistically significant when P<0.05.
Example 2: NK Cells Deficient for FcR Have Enhanced CD16-Dependent Responsiveness
[0088] This Example illustrates that there is a subset of natural killer cells in some humans, which are referred to herein as g.sup.NK cells. Such g.sup.NK cells have useful properties, including the ability to secrete higher levels of cytokines and chemokines than other natural killer cells.
Identification of FcR-Deficient NK Cells
[0089] PBMCs from a large panel of donor samples obtained from leukocyte reduction filters were analyzed for IFN- production by NK cells following incubation with tumor cells or antibody-coated target cells. This analysis revealed that NK cells from many donors did not show a correlative response pattern; for instance, NK cells from donors #25 and #28 responded poorly to K562 tumor cells, but responded markedly well to antibody-coated P815 target cells (
[0090] To explore potential mechanisms underlying the differential responsiveness, the expression of FcR and CD3 was examined. Both FcR and CD3 are associated with CD16 as well as the natural cytotoxicity receptors (NCRs) NKp46 and NKp30. Such NCRs are involved in recognition of K562 (Sivori et al. Eur J Immunol 29(5):1656-1666 (1999); Brandt et al., J Exp Med 206(7):1495-1503 (2009)). Flow cytometric analysis following intracellular staining showed that in the majority of the donors, essentially all NK cells expressed both FcR and CD3 (
[0091] To examine the potential homogeneity of FcR-deficient NK cells and the subset similarities between different donors, the expression of killer cell immunoglobulin-like receptors (KIRs) and NKG2A was surveyed. Such KIRs and NKG2A are inhibitory receptors for MHC I and are expressed by partially overlapping subsets of NK cells (Parham. Nat Rev Immunol 5(3):201-214 (2005)). The FcR-deficient NK cells in some donors had highly skewed expression of KIR2DL1, KIR2DL2/3 and/or KIR3DL1, three well-characterized KIRs expressed primarily within the CD56.sup.dim NK cell population (id.). For instance, in donor #258, almost all (>95%) of the FcR-deficient NK cells expressed KIR2DL1 as well as KIR3DL1 but not KIR2DL2/3, whereas only small percentages of CD56.sup.dim NK cells expressing FcR (hereafter referred to as conventional NK cells) displayed these receptors (
[0092] To determine whether FcR-deficient NK cells express a low level of FcR, samples of FcR-deficient NK cells were obtained and enriched to about 70% purity by cell sorting based on expression of KIRs that correlated well with FcR-deficiency (e.g., KIR2DL2/3 in donor #209). To further increase the purity, the sorted cells (KIR2DL2/3.sup.+ NK cells) were cultured under limiting dilution conditions. Analysis of the resulting cultures showed that many different FcR-deficient NK cell clones were homogeneous (>97%) for FcR-deficiency (
Distinct Phenotype of g.SUP..NK Cells
[0093] To determine whether deficiency of FcR may impact the expression of activation receptors with which it associates, the expression of NKp46 in g.sup.NK cells and conventional NK cells was compared.
[0094] CD16 expression also reduced in g.sup.NK cells, but not so dramatically as FcR expression. In particular, the expression level of CD16 on g.sup.NK cells was approximately 60% of that on conventional NK cells (MFI: 1362263 vs. 844 227, n=13), and there was variation between donors (
[0095] KIR2DL4 is an activation KIR associated with FcR (Kikuchi-Maki et al., J Immunol 174(7):3859-3863 (2005)). While conventional NK cells showed detectable levels of KIR2DL4, after culture in IL-2, g.sup.NK cells did not show such upregulation (
[0096] In addition to the FcR-associated receptors, & NK and conventional NK cells differ in expression levels of NKG2C, an activation receptor expressed by a subset of NK cells (Bryceson & Long, Curr Opin Immunol 20(3):344-352 (2008); Vivier et al. Science 331(6013):44-49 (2011)). Compared to conventional NK cells, g.sup.NK cells expressed this receptor more frequently in most of the donors, although g.sup.NK cells in a few donors expressed NKG2C at low-to-undetectable levels similar to conventional NK cells (
Functional Responsiveness of g.SUP..NK Cells
[0097] To evaluate the responsiveness of g.sup.NK cells to CD16 stimulation, NK cell cytokine production was examined following incubation with immobilized anti-CD16 mAb. Unexpectedly, g.sup.NK cells produced much greater amounts of IFN- compared to conventional NK cells (P<0.0001) (
[0098] To evaluate the functional activity of g.sup.NK cells against tumor cells, NK cell cytokine production was examined following stimulation with K562 cells. Compared to conventional NK cells, g.sup.NK cells expressed significantly less IFN- (P<0.001) (
Long-Term Stability of the .SUP..NK Population
[0099] To investigate whether the g.sup.NK subset is a transient or stable population, a longitudinal study was performed to evaluate the number and phenotype of g.sup.NK cells over an extended period of time. Four to five months after the initial blood donation, additional samples were analyzed from several donors (n=10) that originally had readily detectable numbers (i.e., more than 3% of CD56.sup.dim NK cells) g.sup.NK cells. For every donor examined, the number of g.sup.NK cells was nearly identical during this time frame (
Example 3: Antibody-Dependent Memory-Like NK Cells Distinguished by FcR Deficiency
Introduction
[0100] Natural killer cells are innate immune cells that contribute to host defense against viral infection and malignancy through rapid production of cytokines and the release of cytotoxic granules (Hwang et al. 2012, Int. Immunol, 24:792-802). In particular, NK cells play a crucial role in the control of herpes virus infection, such as infection by human CMV (HCMV) (Biron et al. 1989. N. Engl. J. Med. 320:1731-1735: Etzioni et al. 2005. J. Pediatr. 146:423-425; Kuijpers et al. 2008. Blood. 112; 914-915). Despite being categorized as innate immune cells with a relatively short lifespan (estimated at 10-20 d) (Ranson et al. 2003. Blood. 101:4887-4893; Jamieson et al. 2004. J. Immunol. 172:864-870), recent studies of mouse models demonstrate adaptive immune features of NK cells, such as recall responses to certain haptens and viral Ags lasting up to several months (O'Leary et al. 2006. Nat. Immunol. 7:507-516; Sun et al. 2009. Nature. 457:557-561; Paust et al. 2010. Nat. Immunol. 11:1127-1135). However, considering the fact that NK cells lack mechanisms for gene rearrangement to generate Ag-specific receptors, the molecular basis for specific target recognition is poorly understood, and it is unclear whether NK cells can mount memory responses to diverse pathogens (Hwang et al. 2012. Int. Immunol. 24:792-802; Cooper et al. 2010. Immunol. Rev. 235:297-305), Recently, it was found that about one third of healthy individuals have circulating FcRg-deficient NK (g.sup.NK) cells that express CD3 C. normally, but are deficient for FcR (Hwang et al. 2012. Int. Immunol. 24:792-802), the two signaling adaptors associated with the FcR CD16 (Lanier. 2008. Nat. Immunol. 9:495-502). Provided herein is data which supports that g.sup.NK cells represent a distinct type of memory cell that primarily uses pathogen-specific Abs instead of Ag-specific receptors for target recognition.
Materials and Methods
Human Subjects and Blood Samples
[0101] PBMCs from healthy donors were obtained with informed consent or from discarded, deidentified leukoreduction filters (American Red Cross), as approved by the Michigan State University Biomedical and Health Institutional Review Board.
Phenotypic and Functional Analysis of NK Cells
[0102] PBMCs were stained using Abs for flow cytometry, and CD56.sup.dim CD3.sup.CD14.sup.CD19.sup. cells were gated as previously described (Hwang et al. 2012. Int. Immunol. 24:792-802). Briefly, cells were stained with Abs for cell surface markers and then fixed in 2% formaldehyde. To distinguish g.sup.NK cells, samples were treated with permeabilization buffer containing 0.1% saponin, followed by staining of intracellular proteins, including FcR (anti-FcRI, subunit; Millipore) and CD3 (clone 6B10.2; eBioscience). MRC-5 lung fibroblasts or human foreskin fibroblasts were cultured in 96-well plates, infected (multiplicity of infection=1) with HCMV (Towne strain; or AD169) or HSV-1 for 2 hours, and then washed with PBS to remove unadsorbed virus. PBMCs were cultured for 1-5 days with HCMV infected cells or for 40 hours with HSV-1-infected cells in the presence of recombinant human IL-2 (10 U/ml). Six hours prior to analysis, 1 l plasma or purified IgG (Nab Protein A Plus Purification Kit; Thermo Scientific) was added along with brefeldin A (for cytokine analysis) or anti-CD107a with monensin (for degranulation). To exclude dead cells, a LIVE/DEAD CellStain Kit (Invitrogen) was used.
ELISA
[0103] Serological status of donor plasma was determined using ELISA kits (MP Biomedicals), according to the manufacturer's instructions.
Statistics
[0104] The Wilcoxon matched pairs signed rank test was used for all assays with the exception of ELISAs, for which the X.sup.2 test was used, Differences were considered significant when p<0.05 (GraphPad Prism).
Results and Discussion
Association Between g.sup.NK Cells and HCMV Infection
[0105] To explore the origin of g.sup.NK cells, the phenotypic characteristics of conventional NK cells, which express FcR, were compared with g.sup.NK cells from healthy donors. Analysis of killer cell Ig-like receptors, which are expressed by subsets of NK cells (Parham et al. 2005. Nat Rev Immunol 5:201-214), showed that, in many donors, g.sup.NK cells predominantly expressed particular killer cell Ig-like receptors, suggesting that the g.sup.NK cell subset is an outcome of expansion.
[0106] Considering the expansion and presence of g.sup.NK cells in about one third of healthy donors (Hwang et al. 2012. Int. Immunol. 24:792-802), it was hypothesized that the presence of g.sup.NK cells are associated with prior infection by a common pathogen that does not cause illness in the presence of normal immune function. Previously, it was found that, compared with conventional NK cells, g.sup.NK cells display markedly lower levels of NKp30 and NKp46 (Hwang et al. 2012. Int. Immunol. 24:792-802), the natural cytotoxicity receptors associated with FcR (Moretta et al. 2006 Semin. Immunol. 18:151-158). Interestingly, a subset of NK cells with a similar NCR.sup.lo phenotype was found in HCMV-seropositive, but not in HCMV-seronegative, individuals (Guma et al. 2004. Blood. 104:3664-3671). To examine the possible association of g.sup.NK cells with HCMV, HCMV-specific Abs were tested in the plasma of 42 healthy donors, 17 of whom had g.sup.NK cells. HCMV seropositivity correlated strongly with the presence of g.sup.NK cells (p<0.0001); all donors with g.sup.NK cells, except for one, were seropositive for HCMV IgG (
[0107] Unlike conventional NK cells, g.sup.NK cells showed predominant expression of NKG2C in many, but not all, donors (
Requirement of Abs for Superior Responsiveness of g.sup.NK Cells to HCMV-Infected Cells
[0108] Given the association with HCMV infection, it was next determined whether g.sup.NK cells respond better than conventional NK cells to HCMV-infected cells. NK cell responsiveness was evaluated by examining intracellular IFN- after incubation of PBMCs with lung fibroblasts (MRC-5) that were either mock infected or infected with the Towne strain of HCMV (Cha et al. 1996. J. Virol. 70:78-83). Although the overall production of IFN- by NK cells was slightly increased over background, g.sup.NK cells produced less IFN- than conventional NK cells (
[0109] To assess the cytolytic potential of NK cells, the expression of CD107a, a degranulation marker, was examined following incubation with HCMV-infected target cells. In the absence of Ab, the degranulation response of g.sup.NK cells was significantly (p<0.01) lower than conventional NK cells (
Enhanced Effector Responses of 8 NK Cells to HSV-1-Infected Cells in the Presence of Virus-Specific Abs
[0110] Given the augmented responsiveness in the presence of HCMV-specific Abs, it is thought that g.sup.NK cells could also respond robustly to other pathogens when pathogen-specific Abs are available. To test this possibility, PBMCs from HSV-1-seropositive donors were co-cultured with HSV-1-infected cells in the presence or absence of autologous plasma. Similar to the HCMV-infection setting, IFN- production by g.sup.NK cells was significantly higher (p<0.05) than from conventional NK cells in the presence of seropositive plasma (
[0111] To examine whether g.sup.NK cells from HSV-1-naive donors could respond to HSV-1-infected cells. Abs were purified from non-autologous plasma and tested for the ability to enhance cytokine production. The addition of Abs purified from HSV-1-seropositive donors led to greatly enhanced IFN- production by g.sup.NK cells over conventional NK cells from HSV-1-naive donors co-cultured with HSV-1-infected cells (
Long-Term Persistence of g.sup.NK Cells
[0112] It was next sought to determine whether g.sup.NK cells are a transient or stable population. Longitudinal studies showed that the relative frequencies of g.sup.NK cells within the NK cell pool, as well as their absolute numbers, were nearly constant for 4.9 mo after original assessments (
[0113] Collectively, this study reveals memory features of g.sup.NK cells distinct from other memory cells. Unlike classical memory cells that use gene-rearranged Ag-specific receptors, g.sup.NK cells use the germ line-encoded FcR that recognizes Abs bound to target cells. Moreover, g.sup.NK cells are unlikely related to Ag-specific memory NK cells described in mouse models (O'Leary et al. 2006. Nat. Immunol. 7:507-516; Son et al. 2009. Nature. 457:557-561; Paust et al. 2010. Nat. Immunol. 11:1127-1135), because FcR deficiency abrogates CD16 expression on murine NK cells (Takai et al. 1994. Cell. 76:519-529), and these memory-type NK cells disappear with a constant rate of decay (Schlub et al. 2011. J. Immunol, 187:1385-1392). The responses of g.sup.NK cells are not restricted to a specific pathogen, because
[0114] Ag specificity is conferred through Ag-specific Abs. Given the persistence and enhanced capabilities, g.sup.NK cells are poised to impact the host immune response to diverse pathogens over the long-term, particularly during later stages of primary infection, reinfection, or chronic infection if pathogen-specific Abs are available. Thus, g.sup.NK cells represent a new class of memory cells that does not depend on Ag-specific receptors, for which FcR deficiency itself provides a molecular signature. Finally, g.sup.NK cells may have important implications for Ab-based therapies for infectious diseases and cancer in which the enhanced responsiveness of g.sup.NK cells to Abbound targets could significantly impact therapeutic efficacy.
BIBLIOGRAPHY
[0115] 1. Lanier LL (2008) Nat Immunol 9(5):495-502. [0116] 2. Bryceson YT & Long EO (2008) Curr Opin Immunol 20(3):344-352. [0117] 3. Orange JS (2008) Nat Rev Immunol 8(9):713-725. [0118] 4. Caligiuri MA (2008) Blood 112(3):461-469. [0119] 5. Vivier E, et al. (2011) Science 331(6013):44-49. [0120] 6. Sivori S, et al. (1999) Eur J Immunol 29(5):1656-1666. [0121] 7. Bottino C, Moretta L, & Moretta A (2006) Curr Top Microbiol Immunol 298:175-182. [0122] 8. Brandt CS, et al. (2009) J Exp Med 206(7):1495-1503. [0123] 9. Campbell KS & Purdy AK (2011) Immunology 132(3):315-325. [0124] 10. Vivier E. et al. (1991) J Immunol 147(12):4263-4270. [0125] 11. Pende D, et al. (1999) J Exp Med 190(10):1505-1516. [0126] 12. Lanier LL, Yu G, & Phillips JH (1989) Nature 342(6251):803-805. [0127] 13. De Maria A, et al. (2003) Eur J Immunol 33(9):2410-2418. [0128] 14. Mavilio D. et al. (2003) Proc Natl Acad Sci U S A 100(25):15011-15016. [0129] 15. Fauriat C, et al. (2007) Blood 109(1):323-330. [0130] 16. Narni-Mancinelli E, et al. (2011) Proc Natl Acad Sci U S A 108(45):18324-18329. [0131] 17. Kim S, et al. (2005) Nature 436(7051):709-713. [0132] 18. Yokoyama WM & Kim S (2006) Immunity 24(3):249-257. [0133] 19. Anfossi N, et al. (2006) Immunity 25(2):331-342. [0134] 20. Yawata M, et al. (2006) J Exp Med 203(3):633-645. [0135] 21. Yu J. et al. (2007) J Immunol 179(9):5977-5989. [0136] 22. Kim S, et al. (2008) Proc Natl Acad Sci USA 105(8):3053-3058. [0137] 23. Parsons MS, Zipperlen K, Gallant M, & Grant M (2010) J Leukoc Biol 88(5):905-912. [0138] 24. Parham P (2005) Nat Rev Immunol 5(3):201-214. [0139] 25. Kikuchi-Maki A, Catina TL, & Campbell KS (2005) J Immunol 174(7):3859-3863. [0140] 26. Lopez-Verges S, et al. (2010) Blood 116(19):3865-3874. [0141] 27. Bjorkstrom NK, et al. (2010) Blood 116(19):3853-3864. [0142] 28. Fauriat C. Long EO, Ljunggren HG. & Bryceson YT (2010) Blood 115(11):2167-2176. [0143] 29. Bida AT, et al. (2011) Mol Immunol 48(9-10):1149-1159. [0144] 30. Carter PJ (2006) Nat Rev Immunol 6(5):343-357. [0145] 31. Kohrt HE, et al. (2011) Blood 117(8):2423-2432.
[0146] All patents and publications, as well as amino acid or nucleotide sequences represented by accession numbers, referenced or mentioned herein are indicative of the levels of skill of those skilled in the art to which the invention pertains, and each such referenced patent or publication as well as amino acid or nucleotide sequences represented by accession numbers, is hereby specifically incorporated by reference to the same extent as if it had been incorporated by reference in its entirety individually or set forth herein in its entirety. Applicants reserve the right to physically incorporate into this specification any and all materials and information from any such cited patents or publications or accession numbers.
[0147] The specific methods and compositions described herein are representative of preferred embodiments and are exemplary and not intended as limitations on the scope of the invention. Other objects, aspects, and embodiments will occur to those skilled in the art upon consideration of this specification, and are encompassed within the spirit of the invention as defined by the scope of the claims. It will be readily apparent to one skilled in the art that varying substitutions and modifications may be made to the invention disclosed herein without departing from the scope and spirit of the invention. The invention illustratively described herein suitably may be practiced in the absence of any element or elements, or limitation or limitations, which is not specifically disclosed herein as essential. The methods and processes illustratively described herein suitably may be practiced in differing orders of steps, and the methods and processes are not necessarily restricted to the orders of steps indicated herein or in the claims. As used herein and in the appended claims, the singular forms a, an, and the include plural reference unless the context clearly dictates otherwise. Thus, for example, a reference to a nucleic acid or a polypeptide includes a plurality of such nucleic acids or polypeptides (for example, a solution of nucleic acids or polypeptides or a series of nucleic acid or polypeptide preparations), and so forth. Under no circumstances may the patent be interpreted to be limited to the specific examples or embodiments or methods specifically disclosed herein. Under no circumstances may the patent be interpreted to be limited by any statement made by any Examiner or any other official or employee of the Patent and Trademark Office unless such statement is specifically and without qualification or reservation expressly adopted in a responsive writing by Applicants.
[0148] The terms and expressions that have been employed are used as terms of description and not of limitation, and there is no intent in the use of such terms and expressions to exclude any equivalent of the features shown and described or portions thereof, but it is recognized that various modifications are possible within the scope of the invention as claimed, Thus, it will be understood that although the present invention has been specifically disclosed by preferred embodiments and optional features, modification and variation of the concepts herein disclosed may be resorted to by those skilled in the art, and that such modifications and variations are considered to be within the scope of this invention as defined by the appended claims.