Z cells activated by zinc finger-like protein and uses thereof in cancer treatment
09546354 ยท 2017-01-17
Assignee
Inventors
- Nan-Shan Chang (Owega, NY, US)
- Chen-Yu Lu (Taipei, TW)
- Wan-Pei Su (Nantou, TW)
- Yu-An CHEN (Taipei, TW)
- Wang Wan Jen (New Taipei, TW)
Cpc classification
International classification
Abstract
Immune cells (Z cells) activated by zinc finger-like protein that regulates apoptosis (Zfra) and uses thereof in cancer treatment.
Claims
1. An in vitro cell culture system, comprising (i) an immune cell population, which comprises anti-cancer Z cells, and (ii) CI-4AS-1, Blebbistatin, or a combination thereof.
2. The in vitro cell culture system of claim 1, wherein the immune cell population comprises at least 20% anti-cancer Z cells.
3. The in vitro cell culture system of claim 1, wherein the immune cell population is prepared by a process comprising: culturing immune cells in vitro in a medium that comprises a peptide comprising the amino acid sequence of RRSSSCK (SEQ ID NO:1) to produce the immune cell population, which comprises anti-cancer Z cells.
4. The in vitro cell culture system of claim 3, wherein the medium further comprises CI-4AS-1 or Blebbistatin.
5. The in vitro cell culture system of claim 3, wherein the immune cells are spleen cells.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
DETAILED DESCRIPTION OF THE INVENTION
(10) The present disclosure is based on the unexpected discoveries that Zfra, either in a truncated form or full-length, activated a specific immune cell population (Z cells), which exhibited anti-cancer effects (e.g., inhibit cancer cell growth and block cancer cell metastasis). For example, when immune competent BALB/c mice or immune deficient nude and NOD-SCID mice were pre-injected with synthetic full length Zfra.sub.1-31 or truncated Zfra.sub.4-10 peptides via tail vein, these mice developed resistance against the growth of many types of cancer cells on their skin (65-100% suppression). Further, spleen cells treated with Zfra.sub.1-31 or truncated Zfra.sub.4-10 peptide produced a specific immune cell population (Z cells), which successfully inhibited cancer cell growth when injected into both immune competent and immune deficient mice.
(11) Conventional immunotherapy methods often rely on immune cells that are specific to cancer cell antigens and target only the cancer population that express the specific cancer antigen. By contrast, Z cells as described herein, which are activated by Zfra peptides, can essentially memorize and attack cancer cells in a cancer-antigen independent manner. Thus, the Z cells as described herein can be used in treat all types of cancer.
(12) Accordingly, described herein are immune cell populations containing Z cells, method for preparing such Z cells via, e.g., in vitro culturing in the presence of a Zfra peptide, and methods of using such cells in cancer treatment.
(13) Anti-Cancer Z Cells and Methods for Preparing Such
(14) Z cells, as used herein, refer to a population of cells such as immune cells that express hyaluronidase-2 (Hyal-2.sup.+), does not express one or more B-cell and/or T cell surface markers (e.g., CD3.sup. and CD19.sup.), and are reactive to a Zfra peptide such as those described herein (e.g., capable of binding to the Zfra peptide). For example, Z cells can be Hyal-2.sup.+, CD3.sup., CD19.sup., and capable of binding to a Zfra peptide (e.g., Zfra.sub.4-10 or Zfra.sub.1-31). Such immune cell populations can be activated in the presence of a Zfra peptide as described herein. In some examples, the immune cell population may containing at least 20% Z cells (e.g., 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, or above).
(15) Hyal-2 is an anchor protein located on the outer cell membrane via the glycosylphosphatidyl-inositol (GPI) linkage. It was found that HYAL-2 is a receptor of transforming growth factor beta 1 (TGF-1). Hsu et al., J. Biol. Chem., 284:16049-16059; 2009. As an example, the amino acid sequence of human Hyal-2 is provided below (SEQ ID NO:3):
(16) TABLE-US-00001 mragpgptvtlalvlayswamelkptappiftgrpfvvaw dvptqdcgprlkvpldlnafdvqaspnegfvnqnitifyr drlglyprfdsagrsvhggvpqnvslwahrkmlqkrvehy irtqesaglavidwedwrpvwvrnwqdkdvyrrlsrqlva srhpdwppdrivkqaqyefefaaqqfmletlryvkavrpr hlwgfylfpdcynhdyvqnwesytgrcpdvevarndqlaw lwaestalfpsvyldetlassrhgrnfvsfrvqealrvar thhanhalpvyvftrptysrrltglsemdlistigesaal gaagvilwgdagyttstetcqylkdyltrllvpyvvnvsw atqycsraqchghgrcvrrnpsastflhlstnsfrlvpgh apgepqlrpvgelswadidhlgthfrcqcylgwsgeqcqw dhrqaaggaseawagshltsllalaalaftwtl
(17) B cell-specific and T cell-specific surface markers are well known in the art. Exemplary B-cell markers include, but are not limited to, CD19, CD20, CD24, CD27, CD28, CD34, CD38, BCMA/TNFRSF17, and ENPP-1. Exemplary T cell markers include, but are not limited to CD3, CD4, CD8, CD25, CD26, CD27, CD28, CD30, CD40L, CD71, CD154, and CD134. The Z cells described herein are negative in one or more of B cell-specific surface markers (e.g., CD19 and/or CD20) and one or more T cell-specific surface markers (e.g., CD3, CD4, and/or CD8).
(18) The Z cells described herein can be identified based on their surface presence of one or more B-cell and T-cell markers and their reactivity to a Zfra peptide as described herein via routine technology (e.g., FACS staining). For example, an agent (e.g., antibody) specific to Hyal-2 and one or more of the B-cell/T-cell markers (CD3 and CD19) can be used to determine whether a candidate cell express such B-cell/T-cell markers and Hyal-2. Further, a Zfra peptide conjugated with a detectable label (directly or indirectly) can be used to identify cells that are capable of binding to the Zfra peptide.
(19) The Z-cell-containing population can be prepared by in vitro activation by a Zfra peptide. Zinc-finger like protein that regulates apoptosis (Zfra) is a is a 31-amino-acid peptide containing two cysteines and one histidine and is similar to C2H2-type zinc finger proteins. (Hsu et al., 2005, Biochem Biophys Res Commun, 327, 415-23; Hong et al., 2007 BMC Mol Biol, 8, 50; Hsu et al., 2008, Cell Signal, 20, 1303-12; and Dudekula et al., 2010, Aging (Albany N.Y.), 2, 1023-9.) The amino acid sequence of the full-length Zfra is:
(20) NH-MSSRRSSSCKYCEQDFRAHTQKNAATPFLAN-COOH (SEQ ID NO:2)
(21) The serine residue in boldface is the serine phosphorylation sites Ser8 (S8), which was found to be essential to the activity of Zfra in regulating apoptosis. (Hong et al., 2007; Hsu et al., 2005). It was shown in the present study that a fragment of the full-length Zfra, RRSSSCK (Zfra.sub.4-10, SEQ ID NO:1) is sufficient to induce Z cell activation both in vivo and in vitro. See also WO2013/009948, which is incorporated by reference herein.
(22) The term a Zfra peptide refers to a peptide comprising the amino acid sequence of SEQ ID NO:1 (Zfra.sub.4-10). A Zfra peptide may consist of up to 50 amino acid residues (e.g., up to 45, 40, 35, 30, 25, or 20 amino acid residues). In some examples, a Zfra peptide as described herein may comprise SEQ ID NO:1 and share at least 75% sequence identity (e.g., 80%, 85%, 90%, 95%, or higher) as compared with the full-length Zfra (SEQ ID NO:2). In one example, the Zfra peptide consists of SEQ ID NO:2.
(23) The percent identity of two amino acid sequences is determined using the algorithm of Karlin and Altschul Proc. Natl. Acad. Sci. USA 87:2264-68, 1990, modified as in Karlin and Altschul Proc. Natl. Acad. Sci. USA 90:5873-77, 1993. Such an algorithm is incorporated into the NBLAST and XBLAST programs (version 2.0) of Altschul, et al. J. Mol. Biol. 215:403-10, 1990. BLAST protein searches can be performed with the XBLAST program, score=50, wordlength=3 to obtain amino acid sequences homologous to the protein molecules of the invention. Where gaps exist between two sequences, Gapped BLAST can be utilized as described in Altschul et al., Nucleic Acids Res. 25(17):3389-3402, 1997. When utilizing BLAST and Gapped BLAST programs, the default parameters of the respective programs (e.g., XBLAST and NBLAST) can be used.
(24) Any of the Zfra peptides as described herein can be used to activate the production of Z cells both in vivo and in vitro. In some examples, an in vitro culturing process can be performed to produce an immune cell population that contain Z cells as follows. A population of immune cells, such as spleen cells, blood cells (e.g., peripheral blood mononuclear cells), and bone marrow cells, can be collected from a suitable source, e.g., a healthy donor such as a human donor via routine practice. In some examples, the immune cell population may contain B cells. In some examples, the population of immune cells may obtained from a cancer patient, to whom an adoptive cell transfer immunotherapy is later performed. See descriptions below.
(25) The population of immune cells are cultured in vitro in a suitable medium that contains a suitable concentration of a Zfra peptide (e.g., 20 M to 200 M, such as 40 M to 150 M, 50 M to 120 M; 50 M to 100 M; 100 M to 150 M; or 150 M to 200 M) under suitable conditions for a suitable period of time to induce production of anti-cancer Z cells. In some examples, the culture medium may further comprise CI-4AS-1, Blebbistatin, or a combination thereof. For example, immune cells such as spleen cells, bone marrow cells, or blood cells can be isolated from a suitable donor. If needed, the cells can be resuspended in a suitable medium (e.g., an RPMI medium), which may be supplemented with fetal bovine serum at a suitable concentration (e.g., 10%). The cells may be cultured for a suitable period of time (e.g., overnight) in an incubator under suitable conditions (e.g., at 37 C. with 5% CO.sub.2/atmosphere). The cells can then be treated by a Zefra peptide (e.g., Zfra.sub.1-31 or Zfra.sub.4-10) at a suitable concentration as indicated herein for a suitable period of time (e.g., 16-24 hours). The cells can then be stained with a Zfra peptide conjugated to a detectable label (e.g., TMR-Zfra, which is Zfra1-31 labeled with red fluorescent tetramethylrodamine) to identify Z cells. Positive cells can be collected using a cell sorting machine.
(26) In some examples, Z cells may be enriched from the Z-cell-containing immune cell population as described herein, e.g., by cell sorting using an antibody that binds to a Z-cell surface marker (e.g., Hyal-2) or using a Zfra peptide. The Z-cell-enriched cell population thus obtained may contain at least 20% Z cells (e.g., 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 95%).
(27) Any of the immune cell populations that contain Z cells may be used directly in cancer treatment. Alternatively, the cells may be frozen (cryopreserved). Thus, the method may include the further step of cryopreserving the cells. The cells are preferably frozen in a cryopreservative, which is compatible with ultimately thawing the frozen cells and, after optionally washing the cells to remove the cryopreservative, the immune cells, including Z cells, may retain at least 25% cell viability (such as based on culture efficiency), and more preferably at least 50%, 60%, 70%, 80% or even at least 90% cell viability.
(28) Anti-Cancer Adoptive Cell Transfer Immunotherapy Using Z Cells
(29) The Z cells as described herein can be used in cancer treatment. To practice such a treatment, an effective amount of an immune cell population that contains Z cells can be transferred to a subject in need of the treatment in any physiologically acceptable excipient comprising an isotonic excipient prepared under sufficiently sterile conditions for human administration. For general principles in medicinal formulation, the reader is referred to Cell Therapy: Stem Cell Transplantation, Gene Therapy, and Cellular Immunotherapy, by G. Morstyn & W. Sheridan eds, Cambridge University Press, 1996. Choice of the cellular excipient and any accompanying elements of the composition will be adapted in accordance with the route and device used for administration. The cells may be introduced by injection, catheter, or the like. The cells may be frozen at liquid nitrogen temperatures and stored for long periods of time, being capable of use on thawing.
(30) The pharmaceutical preparations of cells described herein may comprise at least about 1,000; 2,000; 3,000; 4,000; 5,000; 6,000; 7,000; 8,000; or 9,000 Z cells. The pharmaceutical preparations of cells may comprise at least about 110.sup.4, 510.sup.4, 110.sup.5, 510.sup.5, 110.sup.6, 510.sup.6, 110.sup.7, 510.sup.7, 110.sup.8, or 510.sup.8 Z cells. In some examples, the pharmaceutical preparations of Z cells may comprise at least about 110.sup.2-110.sup.3, 110.sup.2-110.sup.4, 110.sup.4-110.sup.5, or 110.sup.3-110.sup.6 Z cells.
(31) In the aforesaid pharmaceutical preparations and compositions, the number of Z cells or concentration cells may be determined by counting viable cells and excluding non-viable cells. For example, non-viable cells may be detected by failure to exclude a vital dye (such as Trypan Blue), or using a functional assay (such as the ability to adhere to a culture substrate, etc.). Additionally, the number of cells or concentration of cells may be determined by counting cells that express one or more cell markers and/or excluding cells that express one or more markers indicative of a cell type other than the desired cell type.
(32) The Z cells or immune cell population comprising such may be formulated with a pharmaceutically acceptable carrier. The carrier in the pharmaceutical composition must be acceptable in the sense that it is compatible with the cells in the composition, and preferably, capable of stabilizing the cells and not deleterious to the subject to be treated. For example, the Z cells or immune cell population may be administered alone or as a component of a pharmaceutical formulation. The subject cells may be formulated for administration in any convenient way for use in medicine. Pharmaceutical preparations suitable for administration may comprise the Z cells or immune cell population, in combination with one or more pharmaceutically acceptable sterile isotonic aqueous or non-aqueous solutions (e.g., balanced salt solution (BSS)), dispersions, suspensions or emulsions, or sterile powders, which may be reconstituted into sterile injectable solutions or dispersions just prior to use, which may contain antioxidants, buffers, bacteriostats, solutes or suspending or thickening agents.
(33) An effective amount of the Z cells or an immune cell population containing such as described herein may be administered into a subject in need of the treatment (e.g., a human patient having cancer, suspected of having cancer, or at risk for developing cancer) via suitable route. Such a subject may be identified via routine medical practice. In some examples, the subject is a cancer patient having or at risk for cancer metastasis.
(34) The term cancer as used herein refers to cells having the capacity for autonomous growth, i.e., an abnormal state or condition characterized by rapidly proliferating cell growth. It is meant to include all types of cancerous growths or oncogenic processes, metastatic tissues or malignantly transformed cells, tissues, or organs, irrespective of histopathologic type or stage of invasiveness. Exemplary types of cancer that can be treated by the method described herein include, but are not limited to, melanoma, breast cancer, prostate cancer, and lung cancer (e.g., small-cell lung cancer or non-small cell lung cancer).
(35) The term treating as used herein refers to the application or administration of a composition including the Z cells described herein to a subject, who has a cancer, a symptom of cancer, or a predisposition toward cancer, with the purpose to cure, heal, alleviate, relieve, alter, remedy, ameliorate, improve, or affect the disease, the symptoms of the disease, or the predisposition toward the disease.
(36) An effective amount as used herein refers to the amount of Z cells required to confer a desired therapeutic effect on the subject, either alone or in combination with one or more other active agents (e.g., anti-cancer agent). Effective amounts vary, as recognized by those skilled in the art, depending on route of administration, excipient usage, and co-usage with other active agents. The desired therapeutic effect may include inhibit or prevent cancer cell growth, reduced the risk for cancer development, and/or block or inhibit cancer cell metastasis in the subject who is treated with the method described herein. This may involve only slowing the progression of the disease temporarily, although more preferably, it involves halting the progression of the disease permanently. This can be monitored by routine methods or can be monitored according to diagnostic methods of the invention discussed herein. The desired response to treatment of the disease or condition also can be delaying the onset or even preventing the onset of the disease or condition.
(37) Such amounts will depend, of course, on the particular condition being treated, the severity of the condition, the individual patient parameters including age, physical condition, size, gender and weight, the duration of the treatment, the nature of concurrent therapy (if any), the specific route of administration and like factors within the knowledge and expertise of the health practitioner. These factors are well known to those of ordinary skill in the art and can be addressed with no more than routine experimentation. It is generally preferred that a maximum dose of the individual components or combinations thereof be used, that is, the highest safe dose according to sound medical judgment. It will be understood by those of ordinary skill in the art, however, that a patient may insist upon a lower dose or tolerable dose for medical reasons, psychological reasons or for virtually any other reasons.
(38) In some embodiments, the anti-cancer Z cells described herein can be combined with one or more other anti-cancer therapy, including surgery, chemotherapy, and/or radiotherapy. In some examples, the Z cells can be co-administered with one or more other anti-cancer agents. The term co-administration is meant to refer to a combination therapy by any administration route, in which two or more agents are administered to a subject in need of the treatment. Co-administration of agents may also be referred to as combination therapy or combination treatment. The agents may be in the same dosage formulations or separate formulations. For combination treatment with more than one active agent, where the active agents are in separate dosage formulations, the active agents can be administered concurrently, or they each can be administered at separately staggered times. The agents may be administered simultaneously or sequentially (e.g., one agent may directly follow administration of the other or the agents may be give episodically, e.g., one can be given at one time followed by the other at a later time, e.g., within a week), as long as they are given in a manner sufficient to allow both agents to achieve effective concentrations in the body. The agents may also be administered by different routes, e.g., one agent may be administered intravenously while a second agent is administered intramuscularly or orally. Thus, the anticancer agent may be administered prior to, concomitant with, or after the administration of the Z cells. Co-administrable agents also may be formulated as an admixture, as, for example, in a single formulation or single tablet. These formulations may be parenteral or oral, such as the formulations described, e.g., in U.S. Pat. Nos. 6,277,384; 6,261,599; 5,958,452 and PCT publication No. WO 98/25613, each hereby incorporated by reference.
(39) Examples of anti-cancer agent include, but are not limited to, chemotherapeutic agents, growth inhibitory agents, cytotoxic agents, agents used in radiation therapy, anti-angiogenesis agents, apoptotic agents, anti-tubulin agents, and other-agents to treat cancer such as, anti-CD20 antibodies, an epidermal growth factor receptor (EGFR) antagonist (e.g., a tyrosine kinase inhibitor), HER1/EGFR inhibitor (e.g., erlotinib (Tarceva), platelet derived growth factor inhibitors (e.g., Gleevec (Imatinib Mesylate)), a COX-2 inhibitor (e.g., celecoxib), interferons, cytokines, antagonists (e.g., neutralizing antibodies) that bind to one or more of the targets molecule and other bioactive and organic chemical agents.
(40) Examples of anti-breast cancer drugs include, but not limited to, Abitrexate (Methotrexate), Abraxane (Paclitaxel Albumin-stabilized Nanoparticle Formulation), Ado-Trastuzumab Emtansine, Adriamycin PFS (Doxorubicin Hydrochloride), Adriamycin RDF (Doxorubicin Hydrochloride), Adrucil (Fluorouracil), Afinitor (Everolimus), Anastrozole, Aredia (Pamidronate Disodium), Arimidex (Anastrozole), Aromasin (Exemestane), Capecitabine, Clafen (Cyclophosphamide), Cyclophosphamide, Cytoxan (Cyclophosphamide), Docetaxel, Doxorubicin Hydrochloride, Efudex (Fluorouracil), Ellence (Epirubicin Hydrochloride), Epirubicin Hydrochloride, Everolimus, Exemestane, Fareston (Toremifene), Faslodex (Fulvestrant), Femara (Letrozole), Fluoroplex (Fluorouracil), Fluorouracil, Folex (Methotrexate), Folex PFS (Methotrexate), Fulvestrant, Gemcitabine Hydrochloride, Gemzar (Gemcitabine Hydrochloride), Goserelin Acetate, Herceptin (Trastuzumab), Ixabepilone, Ixempra (Ixabepilone), Kadcyla (Ado-Trastuzumab Emtansine), Lapatinib Ditosylate, Letrozole, Megace (Megestrol Acetate), Megestrol Acetate, Methotrexate, Methotrexate LPF (Methotrexate), Mexate (Methotrexate), Mexate-AQ (Methotrexate), Neosar (Cyclophosphamide), Nolvadex (Tamoxifen Citrate), Novaldex (Tamoxifen Citrate), Paclitaxel, Paclitaxel Albumin-stabilized Nanoparticle Formulation, Pamidronate Disodium, Perjeta (Pertuzumab), Pertuzumab, Tamoxifen Citrate, Taxol (Paclitaxel), Taxotere (Docetaxel), Trastuzumab, Toremifene, Tykerb (Lapatinib Ditosylate), Xeloda (Capecitabine), and Zoladex (Goserelin Acetate).
(41) Anti-melanoma drugs include Aldesleukin, Dabrafenib, Dacarbazine, DTIC-Dome (Dacarbazine), Intron A (Recombinant Interferon Alfa-2b), Ipilimumab, Mekinist (Trametinib), Peginterferon Alfa-2b, PEG-Intron (Peginterferon Alfa-2b), Proleukin (Aldesleukin), Recombinant Interferon Alfa-2b, Sylatron (Peginterferon Alfa-2b), Tafinlar (Dabrafenib), Trametinib, Vemurafenib, Yervoy (Ipilimumab), and Zelboraf (Vemurafenib).
(42) Drugs for treating non-small cell lung cancer include Abitrexate (Methotrexate), Abraxane (Paclitaxel Albumin-stabilized Nanoparticle Formulation), Afatinib Dimaleate, Alimta (Pemetrexed Disodium), Avastin (Bevacizumab), Carboplatin, Cisplatin, Crizotinib, Docetaxel, Erlotinib Hydrochloride, Folex (Methotrexate), Folex PFS (Methotrexate), Gefitinib, Gilotrif (Afatinib Dimaleate), Gemcitabine Hydrochloride, Gemzar (Gemcitabine Hydrochloride), Iressa (Gefitinib), Methotrexate, Methotrexate LPF (Methotrexate), Mexate (Methotrexate), Mexate-AQ (Methotrexate), Paclitaxel, Paclitaxel Albumin-stabilized Nanoparticle Formulation, Paraplat (Carboplatin), Paraplatin (Carboplatin), Pemetrexed Disodium, Platinol (Cisplatin), Platinol-AQ (Cisplatin), Tarceva (Erlotinib Hydrochloride), Taxol (Paclitaxel), Taxotere (Docetaxel), and Xalkori (Crizotinib).
(43) Drugs for treating small-cell lung cancer include Abitrexate (Methotrexate), Etopophos (Etoposide Phosphate), Etoposide, Etoposide Phosphate, Folex (Methotrexate), Folex PFS (Methotrexate), Hycamtin (Topotecan Hydrochloride), Methotrexate, Methotrexate LPF (Methotrexate), Mexate (Methotrexate), Mexate-AQ (Methotrexate), Toposar (Etoposide), Topotecan Hydrochloride, and VePesid (Etoposide).
(44) Anti-prostate cancer drugs include Abiraterone Acetate, Bicalutamide, Cabazitaxel, Casodex (Bicalutamide), Degarelix, Denosumab, Docetaxel, Enzalutamide, Jevtana (Cabazitaxel), Leuprolide Acetate, Lupron (Leuprolide Acetate), Lupron Depot (Leuprolide Acetate), Lupron Depot-3 Month (Leuprolide Acetate), Lupron Depot-4 Month (Leuprolide Acetate), Lupron Depot-Ped (Leuprolide Acetate), Prednisone, Prolia (Denosumab), Provenge (Sipuleucel-T), Radium 223 Dichloride, Sipuleucel-T, Taxotere (Docetaxel), Viadur (Leuprolide Acetate), Xgeva (Denosumab), Xofigo (Radium 223 Dichloride), Xtandi (Enzalutamide), and Zytiga (Abiraterone Acetate).
(45) Any of the above-listed drugs can be co-used with the Z-cells described herein for treating the target cancer. The co-use of a Zfra peptide as described herein and CI-4AS-1, Blebbistatin, or a combination thereof is also within the scope of this disclosure.
(46) Without further elaboration, it is believed that one skilled in the art can, based on the above description, utilize the present invention to its fullest extent. The following specific embodiments are, therefore, to be construed as merely illustrative, and not limitative of the remainder of the disclosure in any way whatsoever. All publications cited herein are incorporated by reference for the purposes or subject matter referenced herein.
EXAMPLES
Example 1
Truncated Zfra Peptide Suppresses Cancer Metastasis and Stemness
(47) BALB/c mice were pre-injected with sterile MilliQ water or Zfra.sub.4-10 (1 mM in 100 l sterile water) once per week in three consecutive weeks. Following one week post-treatment, the mice were inoculated with melanoma B16F10 cells via tail veins (210.sup.5 cells in 100 l PBS). Mice receiving the control died 50 days following inoculation of B16F10 cells, while Zfra.sub.4-10-treated mice remained alive and were sacrificed for examination.
(48) As shown in
Example 2
Isolation of Novel Zfra-Binding Hyal-2+ Z Lymphocytes and their Down-Regulation in Tumor-Bearing Mice
(49) In this example, spleen cells were isolated from immune deficient NOD-SCID mice, which are deficient in T and B lymphocytes and NK cells. The isolated spleen cells were stained with antibody against Hyal-2 (green) and TMR-Zfra (Zfra.sub.1-31 labeled with red fluorescent tetramethylrodamine) for 30 minutes on ice, and then fixed with 4% formaldehyde (
(50) When immune deficient nude mice were pre-injected with the full-length Zfra.sub.1-31 peptide once per week for 4 weeks, these mice resisted the growth of breast MDA-MB-231 xenografts (
(51) Next, the levels of spleen Z cells in mice pre-treated with full-length Zfra.sub.1-31 or control and inoculated with B16F10 melanoma cells were examined. B16F10-growing BALB/c mice had low levels of Z cells, which were 3.3% or lower (
Example 3
Identification of Compounds which Increase the Anti-Cancer Efficacy of Z Cell Based Treatment
(52) In this example, more than 300 hundred compounds were screened for their activities in boosting Z cell function either alone or in combination with a Zfra peptide. From this collection of compounds, CI-4AS-1 (androgen receptor agonist) and ()-Blebbistatin (inhibitor for non-muscle myosin II ATPase) were identified.
(53) Next, Immune competent BALB/c mice or immune deficient NOD-SCID mice were pre-injected with CI-4AS-1 or ()-Blebbistatin (suspended in dimethyl sulfoxide; DMSO), in the presence or absence of Zfra.sub.4-10 peptide once per week for 3 consecutive weeks. These mice were then inoculated with 2.510.sup.6 or 1.510.sup.6 malignant melanoma B16F10 cells at both right and left flanks. Sixty days later, spleen cell transfer from donor BALB/c to recipient NOD-SCID mice was performed via tail vein injection. Thirty days later, the recipient mice were inoculated with 1.510.sup.6 B16F10 cells at both right and left flanks. See
(54) BALB/c mice (B78-B83) were pretreated with Zfra4-10 in the presence or absence of indicated chemicals once per week for three consecutive weeks. A week later post injection, the mice were inoculated with melanoma B16F10 cells. No cancer cell growth was shown in all mice except the PBS control mice (B78).
(55) Similar experiments were carried out in immunodeficient NOD-SCID mice.
(56) Taken together, the results showed that all of the indicated treatments involving administration of the compounds with or without Zfra peptide blocked the growth of B16F10 cells in BALB/c mice, but only slightly retarded the growth of B16F10 cells in NOD-SCID mice (
(57) Spleen cells from the mice were isolated and stained with synthesized peptide TMR-Zfra.sub.1-31 (Tetramethylrhodamine-Zfra, excitation 550 nm, emission 573 nm) for 30 minutes on ice. Surface marker analysis revealed the presence of Z cells, which conferred the anticancer activity (
Example 4
In Vitro Activation of Spleen Cells with Zfra Confers Suppression of Cancer Cell Growth
(58) As a technical breakthrough, Z cells were successfully activated in vitro to produce a population of immune cells containing Z cells. When transferred into nave mice, these in vitro prepared Z cells successfully blocked cancer growth.
(59) Briefly, spleen cells were isolated from BALB/c mice and then cultured overnight. These cells were stimulated with Zfra.sub.4-10 peptide (10 M) for 16-24 hr, and then stained with TMR-Zfra, followed by isolating the cells using a cell sorter. Z+ and Z cell populations were counted and injected via tail veins of BALB/c. Post injection for 1 week or up to 12 months, these mice were challenged with breast cancer cells and were found that cancer cell growth was significantly suppressed in mice treated with Z+ cell populations as compared with mice treated with Z cell populations.
Other Embodiments
(60) All of the features disclosed in this specification may be combined in any combination. Each feature disclosed in this specification may be replaced by an alternative feature serving the same, equivalent, or similar purpose. Thus, unless expressly stated otherwise, each feature disclosed is only an example of a generic series of equivalent or similar features.
(61) From the above description, one skilled in the art can easily ascertain the essential characteristics of the present invention, and without departing from the spirit and scope thereof, can make various changes and modifications of the invention to adapt it to various usages and conditions. Thus, other embodiments are also within the claims.