POLYMER PARTICLES AND USES THEREOF
20170008938 ยท 2017-01-12
Inventors
- Bernd Helmut Adam REHM (Palmerston North, NZ)
- Bryce Malcolm Buddle (Palmerston North, NZ)
- David Neil Wedlock (Palmerston North, NZ)
Cpc classification
A61K49/0006
HUMAN NECESSITIES
International classification
Abstract
The present invention relates to polymer particles and uses thereof. In particular the present invention relates to functionalised polymer particles, processes of production and uses thereof in the diagnosis, treatment or prevention of tuberculosis.
Claims
1. A polymer particle comprising one or more fusion polypeptides, wherein one or more of the fusion polypeptides comprises a particle-forming protein and two or more of the group comprising a. an ESAT6 antigen or a binding domain capable of binding an ESAT6 antigen, b. a CFP10 antigen or a binding domain capable of binding a CFP10 antigen, c. an Rv3615c antigen or a binding domain capable of binding an Rv3615c antigen, and d. an Rv3020c antigen or a binding domain capable of binding an Rv3020c antigen.
2. The polymer particle of claim 1, wherein one or more of the fusion polypeptides comprises three or more of the group comprising a. an ESAT6 antigen or a binding domain capable of binding an ESAT6 antigen; b. a CFP10 antigen or a binding domain capable of binding a CFP10 antigen, c. an Rv3615c antigen or a binding domain capable of binding an Rv3615c antigen, d. an Rv3020c antigen or a binding domain capable of binding an Rv3020c antigen, and e. an Rv2346c antigen or a binding domain capable of binding an Rv2346c antigen.
3. The polymer particle of claim 1 or claim 2, wherein one or more of the fusion polypeptides comprises a particle-forming protein, an ESAT6 antigen, a CFP10 antigen, and an Rv3615c antigen.
4. The polymer particle of claim 3, wherein one or more of the fusion polypeptides comprises a particle-forming protein, an ESAT6 antigen, a CFP10 antigen, and an Rv3615c antigen, wherein said fusion polypeptide has at least about 95% sequence identity to the amino acid sequence depicted in SEQ. ID. NO. 10.
5. The polymer particle of any one of claims 1 to 4, wherein one or more of the fusion polypeptides comprises a particle-forming protein and i. an ESAT6 antigen or a binding domain capable of binding an ESAT6 antigen; and ii. a CFP10 antigen or a binding domain capable of binding a CFP10 antigen; and iii. an Rv3615c antigen or a binding domain capable of binding an Rv3615c antigen, and iv. an Rv3020c antigen or a binding domain capable of binding an Rv3020c antigen.
6. The polymer particle of claim 5, wherein one or more of the fusion polypeptides comprises a particle-forming protein, an ESAT6 antigen, a CFP10 antigen, an Rv3615c antigen, and an Rv3020c antigen.
7. The polymer particle of any one of claims 1 to 6, wherein the polymer particle comprises at least one fusion polypeptide comprising a particle-forming protein and two or more of the group comprising i. an ESAT6 antigen or a binding domain capable of binding an ESAT6 antigen; ii. a CFP10 antigen or a binding domain capable of binding a CFP10 antigen; iii. an Rv3615c antigen or a binding domain capable of binding an Rv3615c antigen; iv. an Rv3020c antigen or a binding domain capable of binding an Rv3020c antigen; and v. an Rv2346c antigen or a binding domain capable of binding an Rv2346c antigen; and at least one fusion polypeptide comprising a particle-forming protein and one or more of the group comprising vi. an ESAT6 antigen or a binding domain capable of binding an ESAT6 antigen; vii. a CFP10 antigen or a binding domain capable of binding a CFP10 antigen; viii. an Rv3615c antigen or a binding domain capable of binding an Rv3615c antigen; ix. an Rv3020c antigen or a binding domain capable of binding an Rv3020c antigen; and x. an Rv2346c antigen or a binding domain capable of binding an Rv2346c antigen.
8. The polymer particle of claim 7, wherein the fusion polypeptide comprising one or more antigens of the group (vi) to (x) is different to the fusion polypeptide comprising two or more antigens of group (i) to (v).
9. The polymer particle of any one of claims 1 to 8, wherein when present the ESAT6 antigen comprises 10 or more contiguous amino acids from the amino acid sequence of SEQ. ID. No. 1, and when present the CFP10 antigen comprises 10 or more contiguous amino acids from the amino acid sequence of SEQ. ID. No. 2, and when present the Rv3615c antigen comprises 10 or more contiguous amino acids from the amino acid sequence of SEQ. ID. No. 3, and when present the Rv3020c antigen comprises 10 or more contiguous amino acids from the amino acid sequence of SEQ. ID. No. 4, and when present the Rv2346c antigen comprises 10 or more contiguous amino acids from the amino acid sequence of SEQ. ID. No. 5.
10. The polymer particle of claim 10, wherein when present the ESAT6 antigen comprises the amino acid sequence of SEQ. ID. No. 1, and when present the CFP10 antigen comprises the amino acid sequence of SEQ. ID. No. 2, and when present the Rv3615c antigen comprises the amino acid sequence of SEQ. ID. No. 3, and when present the Rv3020c antigen comprises the amino acid sequence of SEQ. ID. No. 4, and when present the Rv2346c antigen comprises the amino acid sequence of SEQ. ID. No. 5.
11. A composition comprising one or more polymer particles according to any one of claims 1 to 10, and a carrier.
12. The composition according to claim 11 wherein the composition comprises two or more populations of polymer particles, wherein one population of polymer particles comprises one or more fusion polypeptides comprising a particle-forming protein and two or more of the group comprising i. an ESAT6 antigen or a binding domain capable of binding an ESAT6 antigen; ii. a CFP10 antigen or a binding domain capable of binding a CFP10 antigen; iii. an Rv3615c antigen or a binding domain capable of binding an Rv3615c antigen; iv. an Rv3020c antigen or a binding domain capable of binding an Rv3020c antigen; and v. an Rv2346c antigen or a binding domain capable of binding an Rv2346c antigen; and one population of polymer particles comprises one or more fusion polypeptides comprising a particle-forming protein and one or more of the group comprising vi. an ESAT6 antigen or a binding domain capable of binding an ESAT6 antigen; vii. a CFP10 antigen or a binding domain capable of binding a CFP10 antigen; viii. an Rv3615c antigen or a binding domain capable of binding an Rv3615c antigen; ix. an Rv3020c antigen or a binding domain capable of binding an Rv3020c antigen; and x. an Rv2346c antigen or a binding domain capable of binding an Rv2346c antigen; wherein one or more of the fusion polypeptides present on one population of polymer particles is different to one or more of the fusion polypeptides present on another population of polymer particles.
13. A diagnostic reagent comprising one or more polymer particles according to any one of claims 1 to 10 or a composition as claimed in claim 11 or 12.
14. The diagnostic reagent of claim 13 wherein the diagnostic reagent is for topical administration.
15. The diagnostic reagent of claim 13 or claim 14, wherein the diagnostic reagent is formulated to provide less than 10 microgram total antigen per dose.
16. The diagnostic reagent of claim 15, wherein the diagnostic reagent comprises less than 5 g total antigen per dose.
17. The diagnostic reagent of claim 13 or claim 14, wherein the diagnostic reagent is formulated to provide less than 5 g of one or more of the antigens present per dose.
18. The diagnostic reagent of claim 17, wherein the diagnostic reagent is formulated to provide less than 1 g of one or more of the antigens present per dose.
19. The diagnostic reagent of claim 13 or claim 14, wherein the diagnostic reagent is formulated to provide less than 5 g of each antigen present per dose.
20. The diagnostic reagent of claim 19, wherein the diagnostic reagent comprises less than 5 g of each antigen present per dose.
21. The diagnostic reagent of claim 19, wherein the diagnostic reagent comprises less than 1 g of each antigen present per dose.
22. The diagnostic reagent of any one of claims 13 to 21, wherein the diagnostic reagent comprises less than 0.5 g of one or more of the antigens present per dose.
23. The diagnostic reagent of any one of claims 13 to 22, wherein the diagnostic reagent comprises less than 0.5 g of each antigen present per dose.
24. The diagnostic reagent of any one of claims 13 to 23, wherein the diagnostic reagent comprises less than 50 ng of each antigen present per dose.
25. The diagnostic reagent of any one of claims 13 to 24, wherein the diagnostic reagent is formulated to provide less than 50 ng total antigen per dose.
26. The diagnostic reagent of any one of claims 13 to 24, wherein the diagnostic reagent is formulated to provide less than 10 ng total antigen per dose.
27. A method of diagnosing tuberculosis in a subject, the method comprising administering to the subject an effective amount of at least one polymer particle according to any one of claims 1 to 10, a composition of claim 11 or 12, or a reagent of any one of claims 13 to 26, and detecting an immune response in the subject, wherein the presence of an immune response is indicative of tuberculosis.
28. The method of claim 27, wherein the method is a method of detecting M. tuberculosis or M. bovis in a subject.
29. The method of claim 27 or claim 28, wherein the administration is topical.
30. The method of claim 29, wherein the administration is by skin prick.
31. The method of any one of claims 27 to 30, wherein the administration is of a diagnostic reagent and the diagnostic reagent comprises less than 5 g of each antigen present per dose.
32. The method of claim 31, wherein the diagnostic reagent comprises less than 5 g total antigen per dose.
33. The method of claim 31 or 32, wherein the diagnostic reagent comprises less than 1 g of each antigen present per dose.
34. The method of any one of claims 27 to 33, wherein the immune response indicative of tuberculosisis a delayed-type hypersensitivity response.
35. A method of detecting M. tuberculosis or M. bovis in a subject, the method comprising providing a sample from a subject, contacting the sample with at least one polymer particle according to any one of claims 1 to 10, a composition of claim 11 or 12, or a reagent of any one of claims 13 to 26, and detecting a response indicative of the presence of one or more M. tuberculosis antigens in the sample, wherein a response indicative of the presence of one or more M. tuberculosis or M. bovis antigens is indicative of M. tuberculosis or M. bovis in the subject.
36. The method of claim 35, wherein the response indicative of the presence of one or more M. tuberculosis or M. bovis antigens is a detection of the presence of an antibody to M. tuberculosis or M. bovis in said sample.
37. The method of claim 36, wherein the response indicative of the presence of one or more M. tuberculosis or M. bovis antigens is a detection of the presence of an immune cell responsive to M. tuberculosis or M. bovis in said sample.
38. The method of any one of claims 35 to 37, wherein the detection is by immunoassay.
39. The method of any one of claims 35 to 37, wherein the detection is by ELISA, radioimmunoassay, or Western Blot.
40. The method of any one of claims 35 to 37, wherein the detection is by cytokine assay.
41. The method of any one of claims 35 to 40, wherein the detection is of interferon-gamma.
42. The method of claim 35 or 37, wherein the presence of an immune cell responsive to Mycobacterium tuberculosis or M. bovis is detected by a cell proliferation assay, a cell sorting assay including FACS, or an in situ hybridisation assay.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0273] Further aspects of the present invention will become apparent from the following description which is given by way of example only and with reference to the accompanying drawings.
[0274]
[0275]
[0276]
[0277]
[0278]
[0279]
(A) Reactivity of TB antigens on the surface of polyester particles. WT (particles) is the negative control. Recombinant TB antigens (CFP10, Rv3615c, ESAT6, and the mixture of CFP10, Rv3615c and ESAT6) were used as positive controls. The testing samples are immobilized TB antigens (bead-CFP10, bead-Rv3615c, bead-ESAT6, and bead-CFP10-Rv3615c-ESAT6). The anti-CFP10 and anti-ESAT6 were mouse monoclonal antibodies and the anti-RV3615C polyclonal antibody was produced in a rabbit.* significantly higher than single antigen (P<0.05)
(B) Control experiment; the rabbit pre-immune serumwasused to replace the three specific antibodies as indicated in Figure B.
(C) Cross-reactivities of specific antibodies with the other two TB antigens. The total protein concentration of control particles, TB antigen particles, and free recombinant antigens in this figure was 1 g/ml, 1 g/ml, and 0.125 g/ml, respectively.* significantly higher than all other particles (P<0.05)
[0280]
[0281]
[0282]
[0283]
[0284]
[0285]
[0286]
[0287]
[0288]
[0289]
DETAILED DESCRIPTION
[0290] The present invention relates to polymer particles and uses thereof. In particular the present invention relates to functionalised polymer particles, for example, processes of production of functionalised polymer particles, and uses thereof in the diagnosis, treatment or prevention of tuberculosis.
[0291] Functionalised polymer particles of the present invention may comprise one or more surface-bound fusion polypeptides, and may also comprise one or more substances incorporated or adsorbed into the polymer particle core, one or more substances bound to surface bound fusion polypeptides, or a combination thereof.
1. Definitions
[0292] The term coding region or open reading frame (ORF) refers to the sense strand of a genomic DNA sequence or a cDNA sequence that is capable of producing a transcription product and/or a polypeptide under the control of appropriate regulatory sequences. The coding sequence is identified by the presence of a 5 translation start codon and a 3 translation stop codon. When inserted into a genetic construct, a coding sequence is capable of being expressed when it is operably linked to promoter and terminator sequences.
[0293] The term comprising as used in this specification means consisting at least in part of When interpreting each statement in this specification that includes the term comprising, features other than that or those prefaced by the term may also be present. Related terms such as comprise and comprises are to be interpreted in the same manner.
[0294] The term coupling reagent as used herein refers to an inorganic or organic compound that is suitable for binding at least one substance or a further coupling reagent that is suitable for binding a coupling reagent on one side and at least one substance on the other side. Examples of suitable coupling reagents, as well as exemplary methods for their use including methods suitable for the chemical modification of particles or fusion proteins of the present invention, are presented in PCT/DE2003/002799, published as WO 2004/020623 (Bernd Rehm), herein incorporated by reference in its entirety.
[0295] The term expression construct refers to a genetic construct that includes elements that permit transcribing the insert polynucleotide molecule, and, optionally, translating the transcript into a polypeptide. An expression construct typically comprises in a 5 to 3 direction: [0296] (1) a promoter, functional in the host cell into which the construct will be introduced, [0297] (2) the polynucleotide to be expressed, and [0298] (3) a terminator functional in the host cell into which the construct will be introduced.
[0299] Expression constructs of the invention are inserted into a replicable vector for cloning or for expression, or are incorporated into the host genome.
[0300] Examples of expression constructs amenable for adaptation for use in the present invention are provided in PCT/DE2003/002799 published as WO 2004/020623 (Bernd Rehm) and PCT/NZ2006/000251 published as WO 2007/037706 (Bernd Rehm) which are each herein incorporated by reference in their entirety.
[0301] The terms form a polymer particle and formation of polymer particles, as used herein, refer to the activity of a particle-forming protein as discussed herein.
[0302] A fragment of a polypeptide is a subsequence of the polypeptide that performs a function that is required for the enzymatic or binding activity and/or provides three dimensional structure of the polypeptide.
[0303] The term fusion polypeptide, as used herein, refers to a polypeptide comprising two or amino acid sequences, for example two or more polypeptide domains, fused through respective amino and carboxyl residues by a peptide linkage to form a single continuous polypeptide. It should be understood that the two or more amino acid sequences can either be directly fused or indirectly fused through their respective amino and carboxyl terimini through a linker or spacer or an additional polypeptide.
[0304] In one embodiment, one of the amino acid sequences comprising the fusion polypeptide comprises a particle-forming protein.
[0305] In particularly contemplated embodiments of the invention, two or more of the amino acid sequences comprising the fusion polypeptide comprise a M. tuberculosis antigen selected from the group comprising an ESAT6 antigen, a binding domain capable of binding an ESAT6 antigen, a CFP10 antigen, a binding domain capable of binding a CFP10 antigen, an Rv3615c antigen, a binding domain capable of binding an Rv3615c antigen, or a fusion partner.
[0306] In other particularly contemplated embodiments of the invention, three or more of the amino acid sequences comprising the fusion polypeptide comprise a M. tuberculosis antigen selected from the group comprising an ESAT6 antigen, a binding domain capable of binding an ESAT6 antigen, a CFP10 antigen, a binding domain capable of binding a CFP10 antigen, an Rv3615c antigen, a binding domain capable of binding an Rv3615c antigen, an Rv3020c antigen, a binding domain capable of binding an Rv3020c antigen, or a fusion partner.
[0307] The term fusion partner as used herein refers to a polypeptide such as a protein, a protein fragment, a binding domain, a target-binding domain, a binding protein, a binding protein fragment, an antibody, an antibody fragment, an antibody heavy chain, an antibody light chain, a single chain antibody, a single-domain antibody (a VHH for example), a Fab antibody fragment, an Fc antibody fragment, an Fv antibody fragment, a F(ab)2 antibody fragment, a Fab antibody fragment, a single-chain Fv (scFv) antibody fragment, an antibody binding domain (a ZZ domain for example), an antigen, an antigenic determinant, an epitope, a hapten, an immunogen, an immunogen fragment, biotin, a biotin derivative, an avidin, a streptavidin, a substrate, an enzyme, an abzyme, a co-factor, a receptor, a receptor fragment, a receptor subunit, a receptor subunit fragment, a ligand, an inhibitor, a hormone, a lectin, a polyhistidine, a coupling domain, a DNA binding domain, a FLAG epitope, a cysteine residue, a library peptide, a reporter peptide, an affinity purification peptide, or any combination of any two or more thereof.
[0308] It should be understood that two or more polypeptides listed above can form the fusion partner.
[0309] In one embodiment the amino acid sequences of the fusion polypeptide are indirectly fused through a linker or spacer, the amino acid sequences of said fusion polypeptide arranged in the order of polymer synthase-linker-antigen capable of eliciting an immune response, or antigen capable of eliciting an immune response-linker-polymer synthase, or polymer synthase-linker-binding domain of an antigen capable of eliciting an immune response, or binding domain of antigen capable of eliciting an immune response-linker-polymer synthase, for example. In other embodiments the amino acid sequences of the fusion polypeptide are indirectly fused through or comprise an additional polypeptide arranged in the order of polymer synthase-additional polypeptide-antigen capable of eliciting an immune response or polymer synthase-additional polypeptide-binding domain of an antigen capable of eliciting an immune response, or polymer synthase-linker-antigen capable of eliciting an immune response-additional polypeptide or polymer synthase-linker-binding domain of an antigen capable of eliciting an immune responseadditional polypeptide. Again, N-terminal extensions of the polymer synthase are expressly contemplated herein.
[0310] Immune responses include cell-mediated and humoral immune responses.
[0311] In one embodiment the amino acid sequences of the fusion polypeptide are indirectly fused through a linker or spacer, the amino acid sequences of said fusion polypeptide arranged in the order of polymer synthase-linker-M. tuberculosis or M. bovis antigen or M. tuberculosis or M. bovis antigen-linker-polymer synthase, or polymer synthase-linker-M. tuberculosis or M. bovis antigen binding domain or M. tuberculosis or M. bovis antigen binding domain-linker-polymer synthase, for example. In other embodiments the amino acid sequences of the fusion polypeptide are indirectly fused through or comprise an additional polypeptide arranged in the order of polymer synthase-additional polypeptide-M. tuberculosis or M. bovis antigen or polymer synthase-additional polypeptideM. tuberculosis or M. bovis antigen binding domain, or polymer synthase-linker-M. tuberculosis or M. bovis antigen-additional polypeptide or polymer synthase-linker-M. tuberculosis or M. bovis antigen binding domain-additional polypeptide. Again, N-terminal extensions of the polymer synthase are expressly contemplated herein.
[0312] A fusion polypeptide according to the invention may also comprise one or more polypeptide sequences inserted within the sequence of another polypeptide. For example, a polypeptide sequence such as a protease recognition sequence are inserted into a variable region of a protein comprising a particle binding domain.
[0313] Conveniently, a fusion polypeptide of the invention are encoded by a single nucleic acid sequence, wherein the nucleic acid sequence comprises at least two subsequences each encoding a polypeptide or a polypeptide domain. In certain embodiments, the at least two subsequences will be present in frame so as comprise a single open reading frame and thus will encode a fusion polypeptide as contemplated herein. In other embodiments, the at least two subsequences are present out of frame, and are separated by a ribosomal frame-shifting site or other sequence that promotes a shift in reading frame such that, on translation, a fusion polypeptide is formed. In certain embodiments, the at least two subsequences are contiguous. In other embodiments, such as those discussed above where the at least two polypeptides or polypeptide domains are indirectly fused through an additional polypeptide, the at least two subsequences are not contiguous.
[0314] Reference to a binding domain or a domain capable of binding is intended to mean one half of a complementary binding pair and may include binding pairs from the list above. For example, antibody-antigen, antibody-antibody binding domain, biotin-streptavidin, receptor-ligand, enzyme-inhibitor pairs. A target-binding domain will bind a target molecule in a sample, and are an antibody or antibody fragment, for example. A polypeptide-binding domain will bind a polypeptide, and are an antibody or antibody fragment, or a binding domain from a receptor or signalling protein, for example.
[0315] Examples of substances that are bound by a binding domain include a protein, a protein fragment, a peptide, a polypeptide, a polypeptide fragment, an antibody, an antibody fragment, an antibody binding domain, an antigen, an antigen fragment, an antigenic determinant, an epitope, a hapten, an immunogen, an immunogen fragment, a pharmaceutically active agent, a biologically active agent, an adjuvant or any combination of any two or more thereof. Such substances are target components in a sample that is analysed according to a method of the invention.
[0316] Accordingly, a domain capable of binding [an antigen] and grammatical equivalents will be understood to refer to one component in a complementary binding pair, wherein the other component is the specified antigen.
[0317] Accordingly, a M. tuberculosis antigen binding domain is a domain that is able to bind one or more M. tuberculosis antigens.
[0318] A M. tuberculosis antigen as used herein is an antigen derived from M. tuberculosis. Likewise, other antigens are identified by the organism from which they are derived.
[0319] The phrase antigen capable of eliciting an immune response refers to an antigen that, when contacted with one or more agentsagents of the immune system, such as one or more antibodies or one or more cells, is able to elicit or upregulate the responsiveness of the immune system, such as, for example, an upregulation in one or more T cell populations, such as for example increased CD8+ T-cell or CD4+ T cell activity or number, or an upregulation in one or more B cell populations, such as one or more B cell populations capable of producing antibodies specific to the antigen or capable of binding the antigen, or an increase in the amount or activity of one or more populations of antibodies.
[0320] The phrase antigen capable of eliciting a cell-mediated response refers to an antigen that, when contacted with one or more cells of the immune system, is able to elicit or upregulate the responsiveness of the immune system, such as, for example, an upregulation in one or more T cell populations, such as for example increased CD8+ T-cell or CD4+ T cell activity or number.
[0321] The term genetic construct refers to a polynucleotide molecule, usually double-stranded DNA, which may have inserted into it another polynucleotide molecule (the insert polynucleotide molecule) such as, but not limited to, a cDNA molecule. A genetic construct may contain the necessary elements that permit transcribing the insert polynucleotide molecule, and, optionally, translating the transcript into a polypeptide. The insert polynucleotide molecule are derived from the host cell, or are derived from a different cell or organism and/or are a recombinant polynucleotide. Once inside the host cell the genetic construct becomes integrated in the host chromosomal DNA. In one example the genetic construct is linked to a vector.
[0322] The term host cell refers to a bacterial cell, a fungi cell, yeast cell, a plant cell, an insect cell or an animal cell such as a mammalian host cell that is either 1) a natural PHA particle producing host cell, or 2) a host cell carrying an expression construct comprising nucleic acid sequences encoding at least a thiolase and a reductase and optionally a phasin. Which genes are required to augment what the host cell lacks for polymer particle formation will be dependent on the genetic makeup of the host cell and which substrates are provided in the culture medium.
[0323] The term linker or spacer as used herein relates to an amino acid or nucleotide sequence that indirectly fuses two or more polypeptides or two or more nucleic acid sequences encoding two or more polypeptides. In some embodiments the linker or spacer is about 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95 or about 100 amino acids or nucleotides in length. In other embodiments the linker or spacer is about 100, 125, 150, 175, 200, 225, 250, 275, 300, 325, 350, 375, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950 or about 1000 amino acids or nucleotides in length. In still other embodiments the linker or spacer is from about 1 to about 1000 amino acids or nucleotides in length, from about 10 to about 1000, from about 50 to about 1000, from about 100 to about 1000, from about 200 to about 1000, from about 300 to about 1000, from about 400 to about 1000, from about 500 to about 1000, from about 600 to about 1000, from about 700 to about 1000, from about 800 to about 1000, or from about 900 to about 1000 amino acids or nucleotides in length.
[0324] In one embodiment the linker or spacer may comprise a restriction enzyme recognition site. In another embodiment the linker or spacer may comprise a protease cleavage recognition sequence such as enterokinase, thrombin or Factor Xa recognition sequence, or a self-splicing element such as an intein. In another embodiment the linker or spacer facilitates independent folding of the fusion polypeptides.
[0325] The term mixed population, as used herein, refers to two or more populations of entities, each population of entities within the mixed population differing in some respect from another population of entities within the mixed population. For example, when used in reference to a mixed population of expression constructs, this refers to two or more populations of expression constructs where each population of expression construct differs in respect of the fusion polypeptide encoded by the members of that population, or in respect of some other aspect of the construct, such as for example the identity of the promoter present in the construct. Alternatively, when used in reference to a mixed population of fusion polypeptides, this refers to two or more populations of fusion polypeptides where each population of fusion polypeptides differs in respect of the polypepetides, such as polymer synthase, the antigen capable of eliciting a cell-mediated immune response, or the binding domain capable of binding an antigen capable of eliciting a cell-mediated immune response, the members that population contains. For example, in the context of use in the treatment of tuberculosis, a mixed population of fusion polypeptides refers to two or more populations of fusion polypeptides where each population of fusion polypeptides differs in respect of the polypepetides, such as polymer synthase, the M. tuberculosis antigens, or the M. tuberculosis antigen binding domains, the members that population contains. Still further, when used in reference to a mixed population of polymer particles, this refers to two or more populations of polymer particles where each population of polymer particles differs in respect of the fusion polypeptide or fusion polypeptides the members of that population carry.
[0326] The term nucleic acid as used herein refers to a single- or double-stranded polymer of deoxyribonucleotide, ribonucleotide bases or known analogues of natural nucleotides, or mixtures thereof. The term includes reference to a specified sequence as well as to a sequence complimentary thereto, unless otherwise indicated. The terms nucleic acid and polynucleotide are used herein interchangeably.
[0327] Operably-linked means that the sequenced to be expressed is placed under the control of regulatory elements that include promoters, tissue-specific regulatory elements, temporal regulatory elements, enhancers, repressors and terminators.
[0328] The term over-expression generally refers to the production of a gene product in a host cell that exceeds levels of production in normal or non-transformed host cells. The term overexpression when used in relation to levels of messenger RNA preferably indicates a level of expression at least about 3-fold higher than that typically observed in a host cell in a control or non-transformed cell. More preferably the level of expression is at least about 5-fold higher, about 10-fold higher, about 15-fold higher, about 20-fold higher, about 25-fold higher, about 30-fold higher, about 35-fold higher, about 40-fold higher, about 45-fold higher, about 50-fold higher, about 55-fold higher, about 60-fold higher, about 65-fold higher, about 70-fold higher, about 75-fold higher, about 80-fold higher, about 85-fold higher, about 90-fold higher, about 95-fold higher, or about 100-fold higher or above, than typically observed in a control host cell or non-transformed cell.
[0329] Levels of mRNA are measured using any of a number of techniques known to those skilled in the art including, but not limited to, Northern blot analysis and RT-PCR, including quantitative RT-PCR.
[0330] The term particle-forming protein, as used herein, refers to proteins involved in the formation of the particle. It may, for example, be selected from the group of proteins which comprises a polymer depolymerase, a polymer regulator, a polymer synthase and a particle size-determining protein. Preferably the particle-forming protein is selected from the group comprising a thiolase, a reductase, a polymer synthase and a phasin. A particle-forming protein such as a synthase may catalyse the formation of a polymer particle by polymerising a substrate or a derivative of a substrate to form a polymer particle. Alternatively, a particle-forming protein such as a thiolase, a reductase or a phasin may facilitate the formation of a polymer particle by facilitating polymerisation. For example, a thiolase or reductase may catalyse production of suitable substrates for a polymerase. A phasin may control the size of the polymer particle formed. Preferably the particle-forming protein comprises a particle binding domain and a particle forming domain.
[0331] As used herein, the term particle-forming reaction mixture refers to at least a polymer synthase substrate if the host cell or expression construct comprises a synthase catalytic domain or a polymer synthase and its substrate if the host cell or expression construct comprises another particle-forming protein or a particle binding domain that is not a polymer synthase catalytic domain.
[0332] A particle size-determining protein refers to a protein that controls the size of the polymer particles. It may for example be derived from the family of phasin-like proteins, preferably selected from the those from the genera Ralstonia, Alcaligenes and Pseudomonas, more preferably the phasin gene phaP from Ralstonia eutropha and the phasin gene phaF from Pseudomonas oleovorans. Phasins are amphiphilic proteins with a molecular weight of 14 to 28 kDa which bind tightly to the hydrophobic surface of the polymer particles. It may also comprise other host cell proteins that bind particles and influence particle size.
[0333] It will be appreciated that pathogens are typically host-specific. Accordingly, the methods and compositions of the invention are amenable to use in a particular host species against a particular pathogen, including against a species-specific pathogen. For example, embodiments for human subjects, for example for use in the detection of human-specific tuberculosis pathogens, will typically focus on Mycobacterium tuberculosis.
[0334] In other examples, embodiments for use with bovine, cervine and ovine subjects will typically target Mycobacterium spp., including for example e.g M. bovis, M. tuberculosis, M. leprae, M. kansasii, M. avium, M. avium paratuberculosis, and other Mycobacterium spp.
[0335] Accordingly, a subject is an animal, such as a mammal, including a mammalian companion animal or a human. Representative companion animals include feline, equine, and canine. Representative agricultural animals include bovine, ovine, cervine, and porcine. In one embodiment the human is an adult, a child, or an infant, including an immunocompromised adult, child, or infant, or an adult, a child or an infant vaccinated against, infected with, exposed to or at risk of infection or exposure to a pathogen.
[0336] The term treat and its derivatives (including treatment) should be interpreted in their broadest possible context. The term should not be taken to imply that a subject is treated until total recovery. Accordingly, treat broadly includes amelioration and/or prevention of the onset of the symptoms or severity of a particular condition.
[0337] A polymer regulator as used herein refers to a protein which regulates the transcription of the genes phaA, phaB and phaC involved in the formation of the polymer particles. It is withdrawn from transcription regulation by binding to the particle surface. One example of such a regulator is the phasin repressor (phaR) from R. eutropha YP_725943, which binds to the promoter of a phasin-like gene, the expression product of which regulates the size of polymer particles formed, and prevents the gene from being read. Because the phasin repressor is bound on the surface of the polymer particles formed, this site on the promoter is released and transcription of the underlying gene can begin. A polymer synthase as used herein refers to a protein which is capable of catalysing the formation of a polymer particle by polymerising a substrate or a derivative of a substrate to form a polymer particle. The nucleotide sequences of 88 PHA synthase genes from >45 different bacteria have been obtained, differing in primary structure, substrate specificity and subunit composition (Rehm, 2007).
[0338] A polymer synthase comprises at least the synthase catalytic domain at the C-terminus of the synthase protein that mediates polymerisation of the polymer and attachment of the synthase protein to the particle core. Polymer synthases for use in the present invention are described in detail in Rehm, 2003, which is herein incorporated by reference in its entirety. For example, the polymer synthase is a PHA synthase from the class 1 genera Acinetobacter, Vibrio, Aeromonas, Chromobacterium, Pseudomonas, Zoogloea, Alcaligenes, Delftia, Burkholderia, Ralstonia, Rhodococcus, Gordonia, Rhodobacter, Paracoccus, Rickettsia, Caulobacter, Methylobacterium, Azorhizobium, Agrobacterium, Rhizobium, Sinorhizobium, Rickettsia, Crenarchaeota, Synechocystis, Ectothiorhodospira, Thiocapsa, Thyocystis and Allochromatium, the class 2 genera Burkholderia and Pseudomonas, or the class 4 genera Bacillus, more preferably from the group comprising class 1 Acinetobacter sp. RA3849, Vibrio cholerae, Vibrio parahaemolyticus, Aeromonas punctata FA440, Aeromonas hydrophila, Chromobacterium violaceum, Pseudomonas sp. 61-3, Zoogloea ramigera, Alcaligenes latus, Alcaligenes sp. SH-69, Delftia acidovorans, Burkholderia sp. DSMZ9242, Ralstonia eutrophia H16, Burkholderia cepacia, Rhodococcus rubber PP2, Gordonia rubripertinctus, Rickettsia prowazekii, Synechocystis sp. PCC6803, Ectothiorhodospira shaposhnikovii N1, Thiocapsa pfennigii 9111, Allochromatium vinosum D, Thyocystis violacea 2311, Rhodobacter sphaeroides, Paracoccus denitrificans, Rhodobacter capsulatus, Caulobacter crescentus, Methylobacterium extorquens, Azorhizobium caulinodans, Agrobacterium tumefaciens, Sinorhizobium meliloti 41, Rhodospirillum rubrum HA, and Rhodospirillum rubrum ATCC25903, class 2 Burkholderia caryophylli, Pseudomonas chloraphis, Pseudomonas sp. 61-3, Pseudomonas putida U, Pseudomonas oleovorans, Pseudomonas aeruginosa, Pseudomonas resinovorans, Pseudomonas stutzeri, Pseudomonas mendocina, Pseudomonas pseudolcaligenes, Pseudomonas putida BM01, Pseudomonas nitroreducins, Pseudomonas chloraphis, and class 4 Bacillus megaterium and Bacillus sp. INT005.
[0339] Other polymer synthases amenable to use in the present invention include polymer synthases, each identified by it accession number, from the following organisms: C. necator (AY836680), P. aeruginosa (AE004091), A. vinosum (AB205104), B. megaterium (AF109909), H. marismortui (YP137339), P. aureofaciens (AB049413), P. putida (AF150670), R. eutropha (A34341), T. pfennigii (X93599), A. punctata (O32472), Pseudomonas sp. 61-3 (AB014757 and AB014758), R. sphaeroides (AAA72004, C. violaceum (AAC69615), A. borkumensis SK2 (CAL17662), A. borkumensis SK2 (CAL16866), R. sphaeroides KD131 (ACM01571 AND YP002526072), R. opacus B4 (BAH51880 and YP002780825), B. multivorans ATCC 17616 (YP001946215 and BAG43679), A. borkumensis SK2 (YP693934 and YP693138), R. rubrum (AAD53179), gamma proteobacterium HTCC5015 (ZP05061661 and EDY86606), Azoarcus sp. BH72 (YP932525), C. violaceum ATCC 12472 (NP902459), Limnobacter sp. MED105 (ZP01915838 and EDM82867), M. algicola DG893 (ZP01895922 and EDM46004), R. sphaeroides (CAA65833), C. violaceum ATCC 12472 (AAQ60457), A. latus (AAD10274, AAD01209 and AAC83658), S. maltophilia K279a (CAQ46418 and YP001972712), R. solanacearum IPO1609 (CAQ59975 and YP002258080), B. multivorans ATCC 17616 (YP001941448 and BAG47458), Pseudomonas sp. g113 (ACJ02400), Pseudomonas sp. g106 (ACJ02399), Pseudomonas sp. g101 (ACJ02398), R. sp. g132 (ACJ02397), R. leguminosarum bv. viciae 3841 (CAK10329 and YP770390), Azoarcus sp. BH72 (CAL93638), Pseudomonas sp. LDC-5 (AAV36510), L. nitroferrum 2002 (ZP03698179), Thauera sp. MZ1T (YP002890098 and ACR01721), M. radiotolerans JCM 2831 (YP001755078 and ACB24395), Methylobacterium sp. 4-46 (YP001767769 and ACA15335), L. nitroferrum 2002 (EEG08921), P. denitrificans (BAA77257), M. gryphiswaldense (ABG23018), Pseudomonas sp. USM4-55 (ABX64435 and ABX64434), A. hydrophila (AAT77261 and AAT77258), Bacillus sp. INT005 (BAC45232 and BAC45230), P. putida (AAM63409 and AAM63407), G. rubripertinctus (AAB94058), B. megaterium (AAD05260), D. acidovorans (BAA33155), P. seriniphilus (ACM68662), Pseudomonas sp. 14-3 (CAK18904), Pseudomonas sp. LDC-5 (AAX18690), Pseudomonas sp. PC17 (ABV25706), Pseudomonas sp. 3Y2 (AAV35431, AAV35429 and AAV35426), P. mendocina (AAM10546 and AAM10544), P. nitroreducens (AAK19608), P. pseudoalcaligenes (AAK19605), P. resinovorans (AAD26367 and AAD26365), Pseudomonas sp. USM7-7 (ACM90523 and ACM90522), P. fluorescens (AAP58480) and other uncultured bacterium (BAE02881, BAE02880, BAE02879, BAE02878, BAE02877, BAE02876, BAE02875, BAE02874, BAE02873, BAE02872, BAE02871, BAE02870, BAE02869, BAE02868, BAE02867, BAE0286, BAE02865, BAE02864, BAE02863, BAE02862, BAE02861, BAE02860, BAE02859, BAE02858, BAE02857, BAE07146, BAE07145, BAE07144, BAE07143, BAE07142, BAE07141, BAE07140, BAE07139, BAE07138, BAE07137, BAE07136, BAE07135, BAE07134, BAE07133, BAE07132, BAE07131, BAE07130, BAE07129, BAE07128, BAE07127, BAE07126, BAE07125, BAE07124, BAE07123, BAE07122, BAE07121, BAE07120, BAE07119, BAE07118, BAE07117, BAE07116, BAE07115, BAE07114, BAE07113, BAE07112, BAE07111, BAE07110, BAE07109, BAE07108, BAE07107, BAE07106, BAE07105, BAE07104, BAE07103, BAE07102, BAE07101, BAE07100, BAE07099, BAE07098, BAE07097, BAE07096, BAE07095, BAE07094, BAE07093, BAE07092, BAE07091, BAE07090, BAE07089, BAE07088, BAE07053, BAE07052, BAE07051, BAE07050, BAE07049, BAE07048, BAE07047, BAE07046, BAE07045, BAE07044, BAE07043, BAE07042, BAE07041, BAE07040, BAE07039, BAE07038, BAE07037, BAE07036, BAE07035, BAE07034, BAE07033, BAE07032, BAE07031, BAE07030, BAE07029, BAE07028, BAE07027, BAE07026, BAE07025, BAE07024, BAE07023, BAE07022, BAE07021, BAE07020, BAE07019, BAE07018, BAE07017, BAE07016, BAE07015, BAE07014, BAE07013, BAE07012, BAE07011, BAE07010, BAE07009, BAE07008, BAE07007, BAE07006, BAE07005, BAE07004, BAE07003, BAE07002, BAE07001, BAE07000, BAE06999, BAE06998, BAE06997, BAE06996, BAE06995, BAE06994, BAE06993, BAE06992, BAE06991, BAE06990, BAE06989, BAE06988, BAE06987, BAE06986, BAE06985, BAE06984, BAE06983, BAE06982, BAE06981, BAE06980, BAE06979, BAE06978, BAE06977, BAE06976, BAE06975, BAE06974, BAE06973, BAE06972, BAE06971, BAE06970, BAE06969, BAE06968, BAE06967, BAE06966, BAE06965, BAE06964, BAE06963, BAE06962, BAE06961, BAE06960, BAE06959, BAE06958, BAE06957, BAE06956, BAE06955, BAE06954, BAE06953, BAE06952, BAE06951, BAE06950, BAE06949, BAE06948, BAE06947, BAE06946, BAE06945, BAE06944, BAE06943, BAE06942, BAE06941, BAE06940, BAE06939, BAE06938, BAE06937, BAE06936, BAE06935, BAE06934, BAE06933, BAE06932, BAE06931, BAE06930, BAE06929, BAE06928, BAE06927, BAE06926, BAE06925, BAE06924, BAE06923, BAE06922, BAE06921, BAE06920, BAE06919, BAE06918, BAE06917, BAE06916, BAE06915, BAE06914, BAE06913, BAE06912, BAE06911, BAE06910, BAE06909, BAE06908, BAE06907, BAE06906, BAE06905, BAE06904, BAE06903, BAE06902, BAE06901, BAE06900, BAE06899, BAE06898, BAE06897, BAE06896, BAE06895, BAE06894, BAE06893, BAE06892, BAE06891, BAE06890, BAE06889, BAE06888, BAE06887, BAE06886, BAE06885, BAE06884, BAE06883, BAE06882, BAE06881, BAE06880, BAE06879, BAE06878, BAE06877, BAE06876, BAE06875, BAE06874, BAE06873, BAE06872, BAE06871, BAE06870, BAE06869, BAE06868, BAE06867, BAE06866, BAE06865, BAE06864, BAE06863, BAE06862, BAE06861, BAE06860, BAE06859, BAE06858, BAE06857, BAE06856, BAE06855, BAE06854, BAE06853 and BAE06852).
[0340] The N-terminal fragment of PHA synthase protein (about amino acids 1 to 200, or 1 to 150, or 1 to 100) is highly variable and in some examples is deleted or replaced by an antigen, an antigen binding domain, or another fusion partner without inactivating the enzyme or preventing covalent attachment of the synthase via the polymer particle binding domain (i.e. the C-terminal fragment) to the polymer core. The polymer particle a binding domain capable of binding the synthase comprises at least the catalytic domain of the synthase protein that mediates polymerisation of the polymer core and formation of the polymer particles.
[0341] In some embodiments the C-terminal fragment of PHA synthase protein is modified, partially deleted or partially replaced by an antigen capable of eliciting an immune response, a binding domain capable of binding an antigen capable of eliciting an immune response, or another fusion partner without inactivating the enzyme or preventing covalent attachment of the synthase to the polymer particle.
[0342] In certain cases, the antigen capable of eliciting an immune response, the binding domain capable of binding an antigen capable of binding an immune response, or another fusion partner are fused to the N-terminus or to the C-terminus of PHA synthase protein without inactivating the enzyme or preventing covalent attachment of the synthase to the polymer particle. Similarly, in other cases the antigen capable of eliciting an immune response, the binding domain capable of binding an antigen capable of eliciting an immune response, or another fusion partner are inserted within the PHA synthase protein, or indeed within the particle-forming protein. Examples of PhaC fusions are known in the art and presented herein.
[0343] In one example, the N-terminal fragment of PHA synthase protein (about amino acids 1 to 200, or 1 to 150, or 1 to 100) is highly variable and is deleted or replaced by a M. tuberculosis or M. bovis antigen, a M. tuberculosis or M. bovis antigen binding domain, or another fusion partner without inactivating the enzyme or preventing covalent attachment (covalent attachment occurs through the active site from which the nascent polyester protrudes) of the synthase via the polymer particle binding domain (i.e. the C-terminal fragment (this domain binds via hydrophobic interaction)) to the polymer particle. The polymer particle binding domain of the synthase comprises at least the catalytic domain of the synthase protein that mediates polymerisation of the polymer particle and formation of the polymer particles.
[0344] The C-terminal fragment of PHA synthase protein may also be modified, partially deleted or partially replaced, for example by the M. tuberculosis or M. bovis antigens described herein, or by a M. tuberculosis or M. bovis antigen binding domain as contemplated herein, or another fusion partner without inactivating the enzyme or preventing covalent attachment of the synthase to the polymer particle.
[0345] In certain cases, the M. tuberculosis or M. bovis antigen(s) or the M. tuberculosis or M. bovis antigen binding domain(s) or another fusion partner are fused to the N-terminus or to the C-terminus of PHA synthase protein without inactivating the enzyme or preventing covalent attachment of the synthase to the polymer particle. Similarly, in other cases the M. tuberculosis or M. bovis antigen(s), the M. tuberculosis or M. bovis antigen binding domain(s), or other fusion partner are inserted within the PHA synthase protein, or indeed within the particle-forming protein. Examples of PhaC fusions are known in the art and presented herein.
[0346] A polymer depolymerase as used herein refers to a protein which is capable of hydrolysing existing polymer, such as that found in a polymer particle, into water soluble monomers and oligomers. Examples of polymer depolymerases occur in a wide variety of PHA-degrading bacteria and fungi, and include the PhaZ1-PhaZ7 extracellular depolymerases from Paucimonas lemoignei, the PhaZ depolymerases from Acidovorax sp., A. faecalis (strains AE122 and T1), Delftia (Comamonas) acidovorans strain YM1069, Comamonas testosteroni, Comamonas sp., Leptothrix sp. strain HS, Pseudomonas sp. strain GM101 (acession no. AF293347), P. fluorescens strain GK13, P. stutzeri, R. pickettii (strains A1 and K1, acession no. JO4223, D25315), S. exfoliatus K10 and Streptomyces hygroscopicus (see Jendrossek D., and Handrick, R., Microbial Degredation of Polyhydroxyalkanoates, Annual Review of Microbiology, 2002, 56:403-32).
[0347] The term polypeptide, as used herein, encompasses amino acid chains of any length but preferably at least 5 amino acids, including full-length proteins, in which amino acid residues are linked by covalent peptide bonds. Polypeptides of the present invention are purified natural products, or are produced partially or wholly using recombinant or synthetic techniques. The term may refer to a polypeptide, an aggregate of a polypeptide such as a dimer or other multimer, a fusion polypeptide, a polypeptide variant, or derivative thereof.
[0348] The term promoter refers to non transcribed cis-regulatory elements upstream of the coding region that regulate gene transcription. Promoters comprise cis-initiator elements which specify the transcription initiation site and conserved boxes such as the TATA box, and motifs that are bound by transcription factors.
[0349] The term terminator refers to sequences that terminate transcription, which are found in the 3 untranslated ends of genes downstream of the translated sequence. Terminators are important determinants of mRNA stability and in some cases have been found to have spatial regulatory functions.
[0350] The term substance when referred to in relation to being bound to or absorbed into or incorporated within a polymer particle is intended to mean a substance that is bound by a fusion partner or a substance that is able to be absorbed into or incorporated within a polymer particle.
[0351] The term variant as used herein refers to polynucleotide or polypeptide sequences different from the specifically identified sequences, wherein one or more nucleotides or amino acid residues is deleted, substituted, or added. Variants are naturally-occurring allelic variants, or non-naturally occurring variants. Variants are from the same or from other species and may encompass homologues, paralogues and orthologues. In certain embodiments, variants of the polynucleotides and polypeptides possess biological activities that are the same or similar to those of the wild type polynucleotides or polypeptides. The term variant with reference to polynucleotides and polypeptides encompasses all forms of polynucleotides and polypeptides as defined herein.
[0352] Polynucleotide and Polypeptide Variants
[0353] The term polynucleotide(s), as used herein, means a single or double-stranded deoxyribonucleotide or ribonucleotide polymer of any length but preferably at least 15 nucleotides, and include as non-limiting examples, coding and non-coding sequences of a gene, sense and antisense sequences complements, exons, introns, genomic DNA, cDNA, pre-mRNA, mRNA, rRNA, siRNA, miRNA, tRNA, ribozymes, recombinant polypeptides, isolated and purified naturally occurring DNA or RNA sequences, synthetic RNA and DNA sequences, nucleic acid probes, primers and fragments. A number of nucleic acid analogues are well known in the art and are also contemplated.
[0354] A fragment of a polynucleotide sequence provided herein is a subsequence of contiguous nucleotides that is preferably at least 15 nucleotides in length. The fragments of the invention preferably comprises at least 20 nucleotides, more preferably at least 30 nucleotides, more preferably at least 40 nucleotides, more preferably at least 50 nucleotides and most preferably at least 60 contiguous nucleotides of a polynucleotide of the invention. A fragment of a polynucleotide sequence can be used in antisense, gene silencing, triple helix or ribozyme technology, or as a primer, a probe, included in a microarray, or used in polynucleotide-based selection methods.
[0355] The term fragment in relation to promoter polynucleotide sequences is intended to include sequences comprising cis-elements and regions of the promoter polynucleotide sequence capable of regulating expression of a polynucleotide sequence to which the fragment is operably linked.
[0356] Preferably fragments of promoter polynucleotide sequences of the invention comprise at least 20, more preferably at least 30, more preferably at least 40, more preferably at least 50, more preferably at least 100, more preferably at least 200, more preferably at least 300, more preferably at least 400, more preferably at least 500, more preferably at least 600, more preferably at least 700, more preferably at least 800, more preferably at least 900 and most preferably at least 1000 contiguous nucleotides of a promoter polynucleotide of the invention.
[0357] The term primer refers to a short polynucleotide, usually having a free 3OH group, that is hybridized to a template and used for priming polymerization of a polynucleotide complementary to the template. Such a primer is preferably at least 5, more preferably at least 6, more preferably at least 7, more preferably at least 9, more preferably at least 10, more preferably at least 11, more preferably at least 12, more preferably at least 13, more preferably at least 14, more preferably at least 15, more preferably at least 16, more preferably at least 17, more preferably at least 18, more preferably at least 19, more preferably at least 20 nucleotides in length.
[0358] The term probe refers to a short polynucleotide that is used to detect a polynucleotide sequence that is complementary to the probe, in a hybridization-based assay. The probe may consist of a fragment of a polynucleotide as defined herein. Preferably such a probe is at least 5, more preferably at least 10, more preferably at least 20, more preferably at least 30, more preferably at least 40, more preferably at least 50, more preferably at least 100, more preferably at least 200, more preferably at least 300, more preferably at least 400 and most preferably at least 500 nucleotides in length.
[0359] The term variant as used herein refers to polynucleotide or polypeptide sequences different from the specifically identified sequences, wherein one or more nucleotides or amino acid residues is deleted, substituted, or added. Variants are naturally-occurring allelic variants, or non-naturally occurring variants. Variants are from the same or from other species and may encompass homologues, paralogues and orthologues. In certain embodiments, variants of the polynucleotides and polypeptides possess biological activities that are the same or similar to those of the wild type polynucleotides or polypeptides. The term variant with reference to polynucleotides and polypeptides encompasses all forms of polynucleotides and polypeptides as defined herein.
[0360] Polynucleotide Variants
[0361] Variant polynucleotide sequences preferably exhibit at least 50%, more preferably at least 51%, at least 52%, at least 53%, at least 54%, at least 55%, at least 56%, at least 57%, at least 58%, at least 59%, at least 60%, at least 61%, at least 62%, at least 63%, at least 64%, at least 65%, at least 66%, at least 67%, at least 68%, at least 69%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least %, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity to a specified polynucleotide sequence. Identity is found over a comparison window of at least 20 nucleotide positions, preferably at least 50 nucleotide positions, at least 100 nucleotide positions, or over the entire length of the specified polynucleotide sequence.
[0362] Polynucleotide sequence identity can be determined in the following manner. The subject polynucleotide sequence is compared to a candidate polynucleotide sequence using BLASTN (from the BLAST suite of programs, version 2.2.10 [October 2004]) in bl2seq (Tatiana A. Tatusova, Thomas L. Madden (1999), Blast 2 sequencesa new tool for comparing protein and nucleotide sequences, FEMS Microbiol Lett. 174:247-250), which is publicly available from NCBI (ftp://ftp.ncbi.nih.gov/blast/). The default parameters of bl2seq are utilized except that filtering of low complexity parts should be turned off.
[0363] The identity of polynucleotide sequences can be examined using the following unix command line parameters:
[0364] bl2seq -i nucleotideseq1 -j nucleotideseq2 -F F -p blastn
[0365] The parameter -F F turns off filtering of low complexity sections. The parameter -p selects the appropriate algorithm for the pair of sequences. The bl2seq program reports sequence identity as both the number and percentage of identical nucleotides in a line Identities=.
[0366] Polynucleotide sequence identity may also be calculated over the entire length of the overlap between a candidate and subject polynucleotide sequences using global sequence alignment programs (e.g. Needleman, S. B. and Wunsch, C. D. (1970) J. Mol. Biol. 48, 443-453). A full implementation of the Needleman-Wunsch global alignment algorithm is found in the needle program in the EMBOSS package (Rice, P. Longden, I. and Bleasby, A. EMBOSS: The European Molecular Biology Open Software Suite, Trends in Genetics June 2000, vol 16, No 6. pp. 276-277) which can be obtained from http://www.hgmp.mrc.ac.uk/Software/EMBOSS/. The European Bioinformatics Institute server also provides the facility to perform EMBOSS-needle global alignments between two sequences on line at http:/www.ebi.ac.uk/emboss/align/.
[0367] Alternatively the GAP program can be used which computes an optimal global alignment of two sequences without penalizing terminal gaps. GAP is described in the following paper: Huang, X. (1994) On Global Sequence Alignment. Computer Applications in the Biosciences 10, 227-235.
[0368] Polynucleotide variants of the present invention also encompass those which exhibit a similarity to one or more of the specifically identified sequences that is likely to preserve the functional equivalence of those sequences and which could not reasonably be expected to have occurred by random chance. Such sequence similarity with respect to polypeptides determined using the publicly available bl2seq program from the BLAST suite of programs (version 2.2.10 [October 2004]) from NCBI (ftp://ftp.ncbi.nih.gov/blast/).
[0369] The similarity of polynucleotide sequences can be examined using the following unix command line parameters:
[0370] bl2seq -i nucleotideseq1 -j nucleotideseq2 F F -p TBlastx
[0371] The parameter -F F turns off filtering of low complexity sections. The parameter -p selects the appropriate algorithm for the pair of sequences. This program finds regions of similarity between the sequences and for each such region reports an E value which is the expected number of times one could expect to see such a match by chance in a database of a fixed reference size containing random sequences. The size of this database is set by default in the bl2seq program. For small E values, much less than one, the E value is approximately the probability of such a random match.
[0372] Variant polynucleotide sequences preferably exhibit an E value of less than 11010, more preferably less than 11020, less than 11030, less than 11040, less than 11050, less than 11060, less than 11070, less than 11080, less than 11090, less than 110100, less than 110110, less than 110120 or less than 110123 when compared with any one of the specifically identified sequences.
[0373] Alternatively, variant polynucleotides of the present invention hybridize to a specified polynucleotide sequence, or complements thereof under stringent conditions.
[0374] The term hybridize under stringent conditions, and grammatical equivalents thereof, refers to the ability of a polynucleotide molecule to hybridize to a target polynucleotide molecule (such as a target polynucleotide molecule immobilized on a DNA or RNA blot, such as a Southern blot or Northern blot) under defined conditions of temperature and salt concentration. The ability to hybridize under stringent hybridization conditions can be determined by initially hybridizing under less stringent conditions then increasing the stringency to the desired stringency.
[0375] With respect to polynucleotide molecules greater than about 100 bases in length, typical stringent hybridization conditions are no more than 25 to 30 C. (for example, 10 C.) below the melting temperature (Tm) of the native duplex (see generally, Sambrook et al., Eds, 1987, Molecular Cloning, A Laboratory Manual, 2nd Ed. Cold Spring Harbor Press; Ausubel et al., 1987, Current Protocols in Molecular Biology, Greene Publishing,). Tm for polynucleotide molecules greater than about 100 bases can be calculated by the formula Tm=81. 5+0.41% (G+C-log (Na+). (Sambrook et al., Eds, 1987, Molecular Cloning, A Laboratory Manual, 2nd Ed. Cold Spring Harbor Press; Bolton and McCarthy, 1962, PNAS 84:1390). Typical stringent conditions for polynucleotide of greater than 100 bases in length would be hybridization conditions such as prewashing in a solution of 6SSC, 0.2% SDS; hybridizing at 65 C., 6SSC, 0.2% SDS overnight; followed by two washes of 30 minutes each in 1SSC, 0.1% SDS at 65 C. and two washes of 30 minutes each in 0.2SSC, 0.1% SDS at 65 C.
[0376] With respect to polynucleotide molecules having a length less than 100 bases, exemplary stringent hybridization conditions are 5 to 10 C. below Tm. On average, the Tm of a polynucleotide molecule of length less than 100 bp is reduced by approximately (500/oligonucleotide length) C.
[0377] With respect to the DNA mimics known as peptide nucleic acids (PNAs) (Nielsen et al., Science. 1991 Dec. 6; 254(5037):1497-500) Tm values are higher than those for DNA-DNA or DNA-RNA hybrids, and can be calculated using the formula described in Giesen et al., Nucleic Acids Res. 1998 Nov. 1; 26(21):5004-6. Exemplary stringent hybridization conditions for a DNA-PNA hybrid having a length less than 100 bases are 5 to 10 C. below the Tm.
[0378] Variant polynucleotides of the present invention also encompasses polynucleotides that differ from the sequences of the invention but that, as a consequence of the degeneracy of the genetic code, encode a polypeptide having similar activity to a polypeptide encoded by a polynucleotide of the present invention. A sequence alteration that does not change the amino acid sequence of the polypeptide is a silent variation. Except for ATG (methionine) and TGG (tryptophan), in some examples other codons for the same amino acid are changed by art recognized techniques, e.g., to optimize codon expression in a particular host organism.
[0379] Polynucleotide sequence alterations resulting in conservative substitutions of one or several amino acids in the encoded polypeptide sequence without significantly altering its biological activity are also included in the invention. A skilled artisan will be aware of methods for making phenotypically silent amino acid substitutions (see, e.g., Bowie et al., 1990, Science 247, 1306).
[0380] Variant polynucleotides due to silent variations and conservative substitutions in the encoded polypeptide sequence can be determined using the publicly available bl2seq program from the BLAST suite of programs (version 2.2.10 [October 2004]) from NCBI (ftp://ftp.ncbi.nih.gov/blast/) via the TBlastx algorithm as previously described.
[0381] Polypeptide Variants
[0382] The term variant with reference to polypeptides encompasses naturally occurring, recombinantly and synthetically produced polypeptides. Variant polypeptide sequences preferably exhibit at least 50%, more preferably at least 51%, at least 52%, at least 53%, at least 54%, at least 55%, at least 56%, at least 57%, at least 58%, at least 59%, at least 60%, at least 61%, at least 62%, at least 63%, at least 64%, at least 65%, at least 66%, at least 67%, at least 68%, at least 69%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least %, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity to a sequences of the present invention. Identity is found over a comparison window of at least 20 amino acid positions, preferably at least 50 amino acid positions, at least 100 amino acid positions, or over the entire length of a polypeptide of the invention.
[0383] Polypeptide sequence identity can be determined in the following manner. The subject polypeptide sequence is compared to a candidate polypeptide sequence using BLASTP (from the BLAST suite of programs, version 2.2.10 [October 2004]) in bl2seq, which is publicly available from NCBI (ftp://ftp.ncbi.nih.gov/blast/). The default parameters of bl2seq are utilized except that filtering of low complexity regions should be turned off.
[0384] Polypeptide sequence identity may also be calculated over the entire length of the overlap between a candidate and subject polynucleotide sequences using global sequence alignment programs. EMBOSS-needle (available at http:/www.ebi.ac.uk/emboss/align/) and GAP (Huang, X. (1994) On Global Sequence Alignment. Computer Applications in the Biosciences 10, 227-235.) as discussed above are also suitable global sequence alignment programs for calculating polypeptide sequence identity.
[0385] Polypeptide variants of the present invention also encompass those which exhibit a similarity to one or more of the specifically identified sequences that is likely to preserve the functional equivalence of those sequences and which could not reasonably be expected to have occurred by random chance. Such sequence similarity with respect to polypeptides can be determined using the publicly available bl2seq program from the BLAST suite of programs (version 2.2.10 [October 2004]) from NCBI (ftp://ftp.ncbi.nih.gov/blast/). The similarity of polypeptide sequences can be examined using the following unix command line parameters:
[0386] bl2seq -i peptideseq1 -j peptideseq2 -F F -p blastp
[0387] Variant polypeptide sequences preferably exhibit an E value of less than 110.sup.10, more preferably less than 110.sup.20, less than 110.sup.30, less than 110.sup.40, less than 110.sup.50, less than 110.sup.60, less than 110.sup.70, less than 110.sup.80, less than 110.sup.90, less than 110.sup.100, less than 110.sup.110, less than 110.sup.120 or less than 110.sup.123 when compared with any one of the specifically identified sequences.
[0388] The parameter -F F turns off filtering of low complexity sections. The parameter -p selects the appropriate algorithm for the pair of sequences. This program finds regions of similarity between the sequences and for each such region reports an E value which is the expected number of times one could expect to see such a match by chance in a database of a fixed reference size containing random sequences. For small E values, much less than one, this is approximately the probability of such a random match.
[0389] Conservative substitutions of one or several amino acids of a described polypeptide sequence without significantly altering its biological activity are also included in the invention. A skilled artisan will be aware of methods for making phenotypically silent amino acid substitutions (see, e.g., Bowie et al., 1990, Science 247, 1306).
[0390] A polypeptide variant of the present invention also encompasses that which is produced from the nucleic acid encoding a polypeptide, but differs from the wild type polypeptide in that it is processed differently such that it has an altered amino acid sequence. For example, a variant is produced by an alternative splicing pattern of the primary RNA transcript to that which produces a wild type polypeptide.
[0391] The term vector refers to a polynucleotide molecule, usually double stranded DNA, which is used to transport the genetic construct into a host cell. In certain examples the vector is capable of replication in at least one additional host system, such as E. coli.
2. Tuberculosis
[0392] It will be appreciated that the polymer particles, methods and compositions of the present invention are in part directed to the identification, prevention or treatment of tuberculosis.
[0393] Tuberculosis is a severe global health concern, resulting in over 2 million human deaths worldwide per year. The disease in human subjects is caused by the bacterium M. tuberculosis. The bacterium commonly invades the lungs, through inhalation, causing infection in the lung, which can ultimately spread to other parts of the body, including the central nervous system, the lymphatic system, the circulatory system, the genitourinary system, the gastrointestinal systems, bones, joints and the skin (Dietrich, 2006; Mustafa, 2001). Various forms of tuberculosis in agricultural animals, such as bovine tuberculosis (typically caused by M. bovis) and Johne's disease (typically caused by M. paratuberculosis), also have a significant negative effect on production. Mycobacterium is a genus of Actinobacteria. The genus includes pathogens known to cause serious diseases in mammals, including tuberculosis and leprosy. Examples of pathogen species include M. tuberculosis, M. bovis, M. africanum, M. microti; M. leprae (leprosy), M. avium paratuberculosis (associated with Crohn's disease in humans and Johne's disease in sheep).
[0394] The spread of infection by M. tuberculosis or M. bovis is limited by the immune system. Many individuals show few symptoms other than a cough and fever. However, approximately 30% of individuals are not able to sufficiently control the infection and develop a primary disease. Despite this, the disease is capable of sitting dormant in individuals, infecting them again years or even decades later. For this reason, M. tuberculosis and M. bovis is unusual among infectious bacteria, as they can evade the immune response and survive in a refractory non- or slow-replicating phase for long periods of time.
[0395] Tuberculosis infection expresses itself in three phases. The first acute stage is identified by a proliferation of bacteria in the body's organs. An immune response quickly follows, controlling the infection and eventually resulting in a decline in bacterial load. Following the acute phase, the second latent phase is established. During this second stage, bacterial load is maintained at a stable and low level. M. tuberculosis or M. bovis change from an active multiplication state in the acute phase to a dormant state in the latent phase. A third reactivation phase may occur whereby the bacteria begin replicating again. The factors that influence this third stage are still largely unknown (Barnes and Cave, 2003).
[0396] It it thought that changes in antigen specificity of the immune response occur throughout the different stages of infection, as the bacterium is capable of modulating gene expression during transition from active replication to dormancy.
2.1 Current Treatment Strategies
[0397] Current treatment strategies for protection against tuberculosis include specific vaccines against known antigens, or antibiotic treatment in patients infected with intracellular bacterial pathogens.
[0398] The lack of suitable vaccines for protecting against reactivation of intracellular pathogens, either prophylactically prior to infection, or therapeutically after onset of infection, has prompted the need for new and improved treatment strategies against intracellular pathogens.
[0399] For example, the only currently available vaccine for tuberculosis is Bacille Calmette-Geurin (BCG), which contains live attenuated strains of Mycobacterium bovis. The efficacy of BCG in controlling tuberculosis infection is limited. Although the vaccine appears to protect children against the primary disease, its protective efficacy against the adult form of the disease (reactivation after latency) is reduced (World Health Organisationhttp://www.who.int). It has also been reported that efficacy of BCG is limited in many Third World countries where tuberculosis is prevalent. In addition, as the BCG vaccine is a live vaccine it is not suitable for administration to patients who are immuno-comprosmised. While the BCG vaccine reportedly reduces dissemination of M. tuberculosis to the spleen (and other organs), it does not prevent bacterial growth in the lungs.
[0400] The lack of a suitable vaccine for protecting against reactivation, either prophylactically prior to infection, or therapeutically after onset of infection, together with the other problems associated with live vaccines, has prompted the need for new and improved diagnosis and treatment strategies against tuberculosis.
3. Immune Response
3.1. Cell-Mediated Response
[0401] Cell-mediated immunity is primarily mediated by T-lymphocytes. Pathogenic antigens are expressed on the surface of antigen presenting cells (such as macrophages, B-lymphocytes, and dendritic cells), bound to either major histocompatibility MHC Class I or MHC Class II molecules. Presentation of pathogenic antigen coupled to MHC Class II activates a helper (CD4+) T-cell response. Upon binding of the T-cell to the antigen-MHC II complex, CD4+ T-cells proliferate, releasing cytokines, including interferon-gamma (IFN-) and interleukin 2 (IL-2), IL-4, IL-7, and IL-12.
[0402] Presentation of pathogenic antigens bound to MHC Class I molecules activates a cytotoxic (CD8+) T-cell response. Upon binding of the T-cell to the antigen-MHC I complex, CD8+ cells secrete perforin, resulting in pathogen cell lysis, swelling and death. Alternatively, CD8+ cells induce programmed cell death or apoptosis. Activation of CD8+ T-cells is amplified by the release of specific cytokines by CD4+ T-cells.
[0403] A cell-mediated immune response is believed to be central to the immunity against various pathogens, including intracellular pathogens such as M. tuberculosis.
[0404] Methods to assess and monitor the onset or progression of a cell-mediated response in a subject are well known in the art. Convenient exemplary methods include those in which the presence of or the level of one or more cytokines associated with a cell-mediated response, such as those identified herein, including for example interferon-gamma, is assessed. Similarly, cell-based methods to assess or monitor the onset and progression of a cell-mediated response are amenable to use in the present invention, and may include cell proliferation or activation assays, including assays targeted at identifying activation or expansion of one or more populations of immune cells, such as T-lymphocytes.
[0405] In certain embodiments, methods of the invention that elicit both a cell-mediated immune response and a humoral response are preferred.
[0406] In other embodiments, methods of the invention that elicit predominantly a cell-mediated response are preferred. Such methods may include those that elicit a cell-mediated immune response without a significant humoral response, or without any detectable humoral response. In one example, the immune response is a cell-mediated immune response, such as that indicated by an IFN- response, in the absence of a significant IgA response, or in the absence of a significant IgE response, or in the absence of a significant IgG response, including the absence of a significant IgG1 response, or the absence of a significant IgG2 response, or in the absence of a significant IgM response.
3.2. Humoral Response
[0407] The humoral immune response is mediated by secreted antibodies produced by B cells. The secreted antibodies bind to antigens presented on the surface of invading pathogens, flagging them for distruction.
[0408] It has been suggested that a combined cell-mediated and humoral response (such as that as a consequence of an initiated cell-mediated response) would be beneficial to achieve a more highly sensitive immune response to or enhance the level of protection against intracellular pathogens.
[0409] Again, methods to assess and monitor the onset or progression of a humoral response are well known in the art. These include antibody binding assays, ELISA, skin-prick tests and the like.
4. Tuberculosis Antigens
[0410] It will be appreciated that a great many M. tuberculosis and M. bovis antigens have been characterised. Exemplary M. tuberculosis and M. bovis antigens early secretary antigen target (ESAT) 6, Ag85A, Ag85B (MPT59), Ag85B, Ag85C, MPT32, MPT51, MPT59, MPT63, MPT64, MPT83, MPB5, MPB59, MPB64, MTC28, MTB2, MTB8.4, MTB9.9, MTB32A, MTB39, MTB41, TB10.4, TB10C, TB11B, TB12.5, TB13A, TB14, TB15, TB15A, TB16, TB16A, TB17, TB18, TB21, TB20.6, TB24, TB27B, TB32, TB32A, TB33, TB38, TB40.8, TB51, TB54, TB64, CFP6, CFP7, CFP7A, CFP7B, CFP8A, CFP8B, CFP9, CFP10, CFP11, CFP16, CFP17, CFP19, CFP19A, CFP19B, CFP20, CFP21, CFP22, CFP22A, CFP23, CFP23A, CFP23B, CFP25, CFP25A, CFP27, CFP28, CFP28B, CFP29, CFP30A, CFP30B, CFP50, CWP32, hspX (alpha-crystalline), APA, Tuberculin purified protein derivative (PPD), ST-CF, PPE68, LppX, PstS-1, PstS-2, PstS-3, HBHA, GroEL, GroEL2, GrpES, LHP, 19 kDa lipoprotein, 71 kDa, RD1-ORF2, RD1-ORF3, RD1-ORF4, RD1-ORF5, RD1-ORF8, RD1-ORF9A, RD1-ORF9B, Rv1984c, Rv0577, Rv1827, BfrB, Tpx. Rv1352, Rv1810, PpiA, Cut2, FbpB, FbpA, FbpC, DnaK, FecB, Ssb, Rp1L, FixA, FixB, AhpC2, Rv2626c, Rv1211, Mdh, Rv1626, Adk, C1pP, SucD (Belisle et al, 2005; U.S. Pat. No. 7,037,510; US 2004/0057963; US 2008/0199493; US 2008/0267990), or at least one antigenic portion or T-cell epitope of any of the above mentioned antigens.
[0411] However, the applicants have determined that a combination of the antigens selected from the group consisting of ESAT6, CFP10, Rv3615c, and Rv3020c are particularly effective in the present invention.
[0412] The amino acid sequence of the ESAT6 antigen is as follows:
TABLE-US-00001 [SEQ.ID.NO.1] MTEQQWNFAGIEAAASAIQGNVTSIHSLLDEGKQSLTKLAAAWGGSGSEA YQGVQQKWDATATELNNALQNLARTISEAGQAMASTEGNVTGMFA.
[0413] The amino acid sequence of the CFP10 antigen is as follows:
TABLE-US-00002 [SEQ.ID.NO.2] MAEMKTDAATLAQEAGNFERISGDLKTQIDQVESTAGSLQGQWRGAAGTA AQAAVVRFQEAANKQKQELDEISTNIRQAGVQYSRADEEQQQALSSQMGF.
[0414] The amino acid sequence of the Rv3615c antigen is as follows:
TABLE-US-00003 [SEQ.ID.NO.3] MTENLTVQPERLGVLASHHDNAAVDASSGVEAAAGLGESVAITHGPYCSQ FNDTLNVYLTAHNALGSSLHTAGVDLAKSLRIAAKIYSEADEAWRKAIDG LFT.
[0415] The amino acid sequence of the Rv3020c antigen is as follows:
TABLE-US-00004 [SEQ.ID.NO.4] GGGGGMSLLDAHIPQLIASHTAFAAKAGLMRHTIGQAEQQAMSAQAFHQG ESAAAFQGAHARFVAAAAKVNTLLDIAQANLGEAAGTYVAADAAAASSYT GF.
[0416] The amino acid sequence of the Rv2346c antigen is as follows:
TABLE-US-00005 [SEQ.ID.NO.5] MTINYQFGDVDAHGAMIRAQAGLLEAEHQAIVRDVLAAGDFWGGAGSVAC QEFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQTDSAVGSSWA.
[0417] In various examples, the two or more antigens, for example three, four, or all five of the antigens selected from the group consisting of ESAT6, CFP10, Rv3615c, Rv3020c, and Rv2346c, or two or more binding domains capable of binding the specified antigens, or any combination thereof, are produced as a fusion protein, in certain embodiments additionally comprising a particle-forming polypeptide. In certain embodiments, other M. tuberculosis or M. bovis antigens, including other M. tuberculosis or M. bovis antigens selected from above mentioned antigens, may additionally be utilised.
[0418] For example, in one embodiment, the two or more antigens comprise an ESAT6-Rv3020c fusion, for example for in-frame fusion at the C-terminus of the polymer synthase, such as phaC, comprising the amino acid sequence:
TABLE-US-00006 [SEQ.ID.NO.6] EMTEQQWNFAGIEAAASAIQGNVTSIHSLLDEGKQSLTKLAAAWGGSGSE AYQGVQQKWDATATELNNALQNLARTISEAGQAMASTEGNVTGMFAGGGG GMSLLDAHIPQLIASHTAFAAKAGLMRHTIGQAEQQAMSAQAFHQGESAA AFQGAHARFVAAAAKVNTLLDIAQANLGEAAGTYVAADAAAASSYTGF.
[0419] In another example, the two or more antigens comprise CFP10, Rv3615c, and ESAT6, for example as a fusion polypeptide additionally comprising a polymer synthase, such as PhaC. For example, the fusion polypeptide comprises CFP10 and Rv3615c fused to the N-terminus of PhaC, with ESAT6 fused to the C-terminus, such as a polypeptide comprising the amino acid sequence depicted herein as SEQ. ID. NO. 10.
[0420] In other embodiments, the fusion polypeptides of the invention comprise the antigen fusions as described herein in the Examples, including, for example, the fusion polypeptides comprising an amino acid sequence of any one of SEQ. ID. NO.s 7 to 10, including those encoded by the nucleotide sequences of any one of SEQ. ID. NO.s 11 to 15.
[0421] It will be appreciated that fusion polypeptides comprising two or more antigens for use in the present invention can be encoded by nucleic acid sequences suitable for expression, including those optimised for expression in different host cells. For example, the ESAT6-Rv3020c fusion polypeptide depicted herein as SEQ. ID. NO. 6 can be encoded by a nucleotide sequence optimised for expression in E. coli, using codon optimisation, such as the nucleotide sequence:
TABLE-US-00007 [SEQ.ID.NO.11] ctcgagatgacggaacaacaatggaactttgctggcatcgaagccgccgc atctgctattcaaggcaatgtgacctctatccactcgctgctggatgaag gcaaacagagtctgaccaaactggcagcagcatggggcggtagcggctct gaagcctatcaaggtgtgcagcaaaaatgggacgctaccgcgacggaact gaacaatgccctgcagaacctggcacgtacgatttctgaagcaggtcaag ctatggcaagcacggaaggcaatgtcacgggcatgttcgcaggcggcggc ggcggcatgagcctgctggatgcgcatattccgcagctgattgcgagcca taccgcgtttgcggcgaaagcgggcctgatgcgtcataccattggccagg cggaacagcaggcgatgagcgcgcaggcgtttcatcagggcgaaagcgcg gcggcgtttcagggcgcgcatgcgcgttttgtggcggcggcggcgaaagt gaacaccctgctggatattgcgcaggcgaacctgggcgaagcggcgggca cctatgtggcggcggatgcggcggcggcgagcagctataccggcttttaa ggatcc.
[0422] In another embodiment of nucleic acid coding sequences optimised for expression in a particular host, the CFP10-Rv3615c-PhaC-ESAT6 fusion polypeptide comprising the amino acid sequence depicted herein as SEQ. ID. NO. 10 is encoded by a nucleotide sequence optimised for expression in E. coli, using codon optimisation, such as the nucleotide sequence:
TABLE-US-00008 [SEQ.ID.NO.15] atggcagaaatgaaaacggatgcggcgaccctggcacaagaagcgggcaactttgaacgtattagcggcgacctgaaaacccaaatcga tcaggttgaaagcaccgcgggttctctgcaaggccagtggcgtggtgcggccggtacggcagctcaagcggccgtggttcgctttcagga agcagctaacaaacaaaaacaggaactggatgaaatttcaaccaatatccgtcaagccggcgtgcagtattcgcgcgcagacgaagaaca gcaacaggctctgagctctcaaatgggtttcgggcccggcggtggcggtggcccgatgaccgaaaacctgacggttcagccggaacgtc tgggtgtcctggcaagtcatcacgataatgcagcagtcgacgccagttccggtgtggaagcagctgcaggtctgggtgaaagtgtggcgat tacccatggtccgtattgctcccagtttaacgataccctgaatgtttacctgacggcccataacgcactgggttcatcgctgcacacggctggt gtcgacctggcaaaatctctgcgcatcgccgcaaaaatctattcagaagcagacgaagcgtggcgtaaagcaatcgacggcctgttcacca ctagtgcgaccggcaaaggcgcggcagcttccacgcaggaaggcaagtcccaaccattcaaggtcacgccggggccattcgatccagc cacatggctggaatggtcccgccagtggcagggcactgaaggcaacggccacgcggccgcgtccggcattccgggcctggatgcgctg gcaggcgtcaagatcgcgccggcgcagctgggtgatatccagcagcgctacatgaaggacttctcagcgctgtggcaggccatggccga gggcaaggccgaggccaccggtccgctgcacgaccggcgcttcgccggcgacgcatggcgcaccaacctcccatatcgcttcgctgcc gcgttctacctgctcaatgcgcgcgccttgaccgagctggccgatgccgtcgaggccgatgccaagacccgccagcgcatccgcttcgcg atctcgcaatgggtcgatgcgatgtcgcccgccaacttccttgccaccaatcccgaggcgcagcgcctgctgatcgagtcgggcggcgaa tcgctgcgtgccggcgtgcgcaacatgatggaagacctgacacgcggcaagatctcgcagaccgacgagagcgcgtttgaggtcggcc gcaatgtcgcggtgaccgaaggcgccgtggtcttcgagaacgagtacttccagctgttgcagtacaagccgctgaccgacaaggtgcacg cgcgcccgctgctgatggtgccgccgtgcatcaacaagtactacatcctggacctgcagccggagagctcgctggtgcgccatgtggtgg agcagggacatacggtgtttctggtgtcgtggcgcaatccggacgccagcatggccggcagcacctgggacgactacatcgagcacgcg gccatccgcgccatcgaagtcgcgcgcgacatcagcggccaggacaagatcaacgtgctcggcttctgcgtgggcggcaccattgtctc gaccgcgctggcggtgctggccgcgcgcggcgagcacccggccgccagcgtcacgctgctgaccacgctgctggactttgccgacac gggcatcctcgacgtctttgtcgacgagggccatgtgcagttgcgcgaggccacgctgggcggcggcgccggcgcgccgtgcgcgctg ctgcgcggccttgagctggccaataccttctcgttcttgcgcccgaacgacctggtgtggaactacgtggtcgacaactacctgaagggcaa cacgccggtgccgttcgacctgctgttctggaacggcgacgccaccaacctgccggggccgtggtactgctggtacctgcgccacaccta cctgcagaacgagctcaaggtaccgggcaagctgaccgtgtgcggcgtgccggtggacctggccagcatcgacgtgccgacctatatct acggctcgcgcgaagaccatatcgtgccgtggaccgcggcctatgcctcgaccgcgctgctggcgaacaagctgcgcttcgtgctgggt gcgtcgggccatatcgccggtgtgatcaacccgccggccaagaacaagcgcagccactggactaacgatgcgctgccggagtcgccgc agcaatggctggccggcgccatcgagcatcacggcagctggtggccggactggaccgcatggctggccgggcaggccggcgcgaaa cgcgccgcgcccgccaactatggcaatgcgcgctatcgcgcaatcgaacccgcgcctgggcgatacgtcaaagccaaggcacatatggt gctggcggtggcgattgataaacgcggaggcggtggaggcctcgagatgacggaacaacaatggaactttgctggcatcgaagccgcc gcatctgctattcaaggcaatgtgacctctatccactcgctgctggatgaaggcaaacagagtctgaccaaactggcagcagcatggggcg gtagcggctctgaagcctatcaaggtgtgcagcaaaaatgggacgctaccgcgacggaactgaacaatgccctgcagaacctggcacgt acgatttctgaagcaggtcaagctatggcaagcacggaaggcaatgtcacgggcatgttcgcataa.
[0423] In other embodiments, the fusion polypeptides of the invention include those encoded by the nucleotide sequences of any one of SEQ. ID. NO.s 11 to 15.
5. Expression Constructs
[0424] Processes for producing and using expression constructs for expression of fusion polypeptides in microorganisms, plant cells or animal cells (cellular expression systems) or in cell free expression systems, and host cells comprising expression constructs useful for forming polymer particles for use in the invention are well known in the art (e.g. Sambrook et al., 1987; Ausubel et al., 1987).
[0425] Expression constructs for use in methods of the invention are in one embodiment inserted into a replicable vector for cloning or for expression, or in another embodiment are incorporated into the host genome. Various vectors are publicly available. The vector is, for example, in the form of a plasmid, cosmid, viral particle, or phage. The appropriate nucleic acid sequence can be inserted into the vector by a variety of procedures. In general, DNA is inserted into an appropriate restriction endonuclease site(s) using techniques known in the art. Vector components generally include, but are not limited to, one or more of a signal sequence, an origin of replication, one or more selectable marker genes, an enhancer element, a promoter, and a transcription termination sequence. Construction of suitable vectors containing one or more of these components employs standard ligation techniques known in the art.
[0426] Both expression and cloning vectors contain a nucleic acid sequence that enables the vector to replicate in one or more selected host cells. Such sequences are well known for a variety of bacteria, yeast, and viruses.
[0427] In one embodiment the expression construct is present on a high copy number vector.
[0428] In one embodiment the high copy number vector is selected from those that are present at 20 to 3000 copies per host cell.
[0429] In one embodiment the high copy number vector contain a high copy number origin of replication (ori), such as ColE1 or a ColE1-derived origin of replication. For example, the ColE-1 derived origin of replication may comprise the pUC19 origin of replication.
[0430] Numerous high copy number origins of replication suitable for use in the vectors of the present invention are known to those skilled in the art. These include the ColE1-derived origin of replication from pBR322 and its derivatives as well as other high copy number origins of replication, such as M13 FR on or p15A ori. The 2 plasmid origin is suitable for yeast, and various viral origins (SV40, polyoma, adenovirus, VSV or BPV) are useful for cloning vectors in mammalian cells.
[0431] Preferably, the high copy number origin of replication comprises the ColE1-derived pUC19 origin of replication.
[0432] The restriction site is positioned in the origin of replication such that cloning of an insert into the restriction site will inactivate the origin, rendering it incapable of directing replication of the vector. Alternatively, the at least one restriction site is positioned within the origin such that cloning of an insert into the restriction site will render it capable of supporting only low or single copy number replication of the vector.
[0433] Expression and cloning vectors will typically contain a selection gene, also termed a selectable marker to detect the presence of the vector in the transformed host cell. Typical selection genes encode proteins that (a) confer resistance to antibiotics or other toxins, e.g., ampicillin, neomycin, methotrexate, or tetracycline, (b) complement auxotrophic deficiencies, or (c) supply critical nutrients not available from complex media, e.g., the gene encoding D-alanine racemase for Bacilli.
[0434] Selectable markers commonly used in plant transformation include the neomycin phophotransferase II gene (NPT II) which confers kanamycin resistance, the aadA gene, which confers spectinomycin and streptomycin resistance, the phosphinothricin acetyl transferase (bar gene) for Ignite (AgrEvo) and Basta (Hoechst) resistance, and the hygromycin phosphotransferase gene (hpt) for hygromycin resistance.
[0435] Examples of suitable selectable markers for mammalian cells are those that enable the identification of cells competent to take up expression constructs, such as DHFR or thymidine kinase. An appropriate host cell when wild-type DHFR is employed is the CHO cell line deficient in DHFR activity, prepared and propagated as described by Urlaub et al., 1980. A suitable selection gene for use in yeast is the trp1 gene present in the yeast plasmid YRp7 (Stinchcomb et al., 1979; Kingsman et al., 1979; Tschemper et al., 1980). The trp1 gene provides a selection marker for a mutant strain of yeast lacking the ability to grow in tryptophan, for example, ATCC No. 44076 or PEP4-1 [Jones, Genetics, 85:12 (1977)].
[0436] An expression construct useful for forming polymer particles preferably includes a promoter which controls expression of at least one nucleic acid encoding a polymer synthase, particle-forming protein or fusion polypeptide.
[0437] Promoters recognized by a variety of potential host cells are well known. Promoters suitable for use with prokaryotic hosts include the -lactamase and lactose promoter systems [Chang et al., 1978; Goeddel et al., 1979), alkaline phosphatase, a tryptophan (trp) promoter system [Goeddel, Nucleic Acids Res., 8:4057 (1980); EP 36,776], and hybrid promoters such as the tac promoter [deBoer et al., 1983). Promoters for use in bacterial systems also will contain a Shine-Dalgarno (S.D.) sequence operably linked to the nucleic acid encoding a polymer synthase, particle-forming protein or fusion polypeptide.
[0438] Examples of suitable promoting sequences for use with yeast hosts include the promoters for 3-phosphoglycerate kinase [Hitzeman et al., 1980) or other glycolytic enzymes [Hess et al., 1968; Holland, 1978), such as enolase, glyceraldehyde-3-phosphate dehydrogenase, hexokinase, pyruvate decarboxylase, phosphofructokinase, glucose-6-phosphate isomerase, 3-phosphoglycerate mutase, pyruvate kinase, triosephosphate isomerase, phosphoglucose isomerase, and glucokinase.
[0439] Other yeast promoters, which are inducible promoters having the additional advantage of transcription controlled by growth conditions, are the promoter regions for alcohol dehydrogenase 2, isocytochrome C, acid phosphatase, degradative enzymes associated with nitrogen metabolism, metallothionein, glyceraldehyde-3-phosphate dehydrogenase, and enzymes responsible for maltose and galactose utilization.
[0440] Examples of suitable promoters for use in plant host cells, including tissue or organ of a monocot or dicot plant include cell-, tissue- and organ-specific promoters, cell cycle specific promoters, temporal promoters, inducible promoters, constitutive promoters that are active in most plant tissues, and recombinant promoters. Choice of promoter will depend upon the temporal and spatial expression of the cloned polynucleotide, so desired. The promoters are those from the host cell, or promoters which are derived from genes of other plants, viruses, and plant pathogenic bacteria and fungi. Those skilled in the art will, without undue experimentation, be able to select promoters that are suitable for use in modifying and modulating expression constructs using genetic constructs comprising the polynucleotide sequences of the invention. Examples of constitutive plant promoters include the CaMV 35S promoter, the nopaline synthase promoter and the octopine synthase promoter, and the Ubi 1 promoter from maize. Plant promoters which are active in specific tissues, respond to internal developmental signals or external abiotic or biotic stresses are described in the scientific literature. Exemplary promoters are described, e.g., in WO 02/00894, which is herein incorporated by reference.
[0441] Examples of suitable promoters for use in mammalian host cells comprise those obtained from the genomes of viruses such as polyoma virus, fowlpox virus, adenovirus (such as Adenovirus 2), bovine papilloma virus, avian sarcoma virus, cytomegalovirus, a retrovirus, hepatitis-B virus and Simian Virus 40 (SV40), from heterologous mammalian promoters, e.g., the actin promoter or an immunoglobulin promoter, and from heat-shock promoters, provided such promoters are compatible with the host cell systems.
[0442] Transcription of an expression construct by higher eukaryotes is in some examples increased by inserting an enhancer sequence into the vector. Enhancers are cis-acting elements of DNA, usually about from 10 to 300 bp that act on a promoter to increase its transcription. Many enhancer sequences are now known from mammalian genes (globin, elastase, albumin, -fetoprotein, and insulin). Typically, however, one will use an enhancer from a eukaryotic cell virus. Examples include the SV40 enhancer on the late side of the replication origin (bp 100-270), the cytomegalovirus early promoter enhancer, the polyoma enhancer on the late side of the replication origin, and adenovirus enhancers. Typically, the enhancer is spliced into the vector at a position 5 or 3 to the polymer synthase, particle-forming protein or fusion polypeptide coding sequence, but is preferably located at a site 5 from the promoter.
[0443] Expression vectors used in eukaryotic host cells (yeast, fungi, insect, plant, animal, human, or nucleated cells from other multicellular organisms) will also contain sequences necessary for the termination of transcription and for stabilizing the mRNA. Such sequences are commonly available from the 5 and, occasionally 3, untranslated regions of eukaryotic or viral DNAs or cDNAs. These regions contain nucleotide segments transcribed as polyadenylated fragments in the untranslated portion of the mRNA encoding the polymer synthase, particle-forming protein or fusion polypeptide.
[0444] In one embodiment the expression construct comprises an upstream inducible promoter, such as a BAD promoter, which is induced by arabinose.
[0445] In one embodiment the expression construct comprises a constitutive or regulatable promoter system.
[0446] In one embodiment the regulatable promoter system is an inducible or repressible promoter system.
[0447] While it is desirable to use strong promoters in the production of recombinant proteins, regulation of these promoters is essential since constitutive overproduction of heterologous proteins leads to decreases in growth rate, plasmid stability and culture viability.
[0448] A number of promoters are regulated by the interaction of a repressor protein with the operator (a region downstream from the promoter). The most well known operators are those from the lac operon and from bacteriophage A. An overview of regulated promoters in E. coli is provided in Table 1 of Friehs & Reardon, 1991.
[0449] A major difference between standard bacterial cultivations and those involving recombinant E. coli is the separation of the growth and production or induction phases. Recombinant protein production often takes advantage of regulated promoters to achieve high cell densities in the growth phase (when the promoter is off and the metabolic burden on the host cell is slight) and then high rates of heterologous protein production in the induction phase (following induction to turn the promoter on).
[0450] In one embodiment the regulatable promoter system is selected from LacI, Trp, phage and phage RNA polymerase.
[0451] In one embodiment the promoter system is selected from the lac or Ptac promoter and the lad repressor, or the trp promoter and the TrpR repressor.
[0452] In one embodiment the LacI repressor is inactivated by addition of isopropyl--D-thiogalactopyranoside (IPTG) which binds to the active repressor causes dissociation from the operator, allowing expression.
[0453] In one embodiment the trp promoter system uses a synthetic media with a defined tryptophan concentration, such that when the concentration falls below a threshold level the system becomes self-inducible. In one embodiment 3--indole-acrylic acid is added to inactivate the TrpR repressor.
[0454] In one embodiment the promoter system may make use of the bacteriophage repressor cI. This repressor makes use of the prophage and prevent expression of all the lytic genes by interacting with two operators termed OL and OR. These operators overlap with two strong promoters PL and PR respectively. In the presence of the cI repressor, binding of RNA polymerase is prevented. The cI repressor can be inactivated by UV-irradiation or treatment of the cells with mitomycin C. A more convenient way to allow expression of the recombinant polypeptide is the application of a temperature-sensitive version of the cI repressor cI857. Host cells carrying a -based expression system can be grown to mid-exponential phase at low temperature and then transferred to high temperature to induce expression of the recombinant polypeptide.
[0455] A widely used expression system makes use of the phage T7 RNA polymerase which recognises only promoters found on the T7 DNA, and not promoters present on the host cell chromosome. Therefore, the expression construct may contain one of the T7 promoters (normally the promoter present in front of gene 10) to which the recombinant gene will be fused. The gene coding for the T7 RNA polymerase is either present on the expression construct, on a second compatible expression construct or integrated into the host cell chromosome. In all three cases, the gene is fused to an inducible promoter allowing its transcription and translation during the expression phase.
[0456] The E. coli strains BL21 (DE3) and BL21 (DE3) pLysS (Invitrogen, CA) are examples of host cells carrying the T7 RNA polymerase gene (there are a few more very suitable and commercially available E. coli strains harbouring the T7RNA polymerase gene such as e.g. KRX and XJ (autolysing)). Other cell strains carrying the T7 RNA polymerase gene are known in the art, such as Pseudomonas aeruginosa ADD1976 harboring the T7 RNA polymerase gene integrated into the genome (Brunschwig & Darzins, 1992) and Cupriavidus necator (formerly Ralstonia eutropha) harboring the T7 RNA polymerase gene integrated into the genome under phaP promoter control (Barnard et al., 2004).
[0457] The T7 RNA polymerase offers three advantages over the host cell enzymes: First, it consists of only one subunit, second it exerts a higher processivity, and third it is insensitive towards rifampicin. The latter characteristic can be used especially to enhance the amount of fusion polypeptide by adding this antibiotic about 10 min after induction of the gene coding for the T7 RNA polymerase. During that time, enough polymerase has been synthesised to allow high-level expression of the fusion polypeptide, and inhibition of the host cell enzymes prevents further expression of all the other genes present on both the plasmid and the chromosome. Other antibiotics which inhibit the bacterial RNA polymerase but not the T7 RNA polymerase are known in the art, such as streptolydigin and streptovaricin.
[0458] Since all promoter systems are leaky, low-level expression of the gene coding for T7 RNA polymerase may be deleterious to the cell in those cases where the recombinant polypeptide encodes a toxic protein. These polymerase molecules present during the growth phase can be inhibited by expressing the T7-encoded gene for lysozyme. This enzyme is a bifunctional protein that cuts a bond in the cell wall of the host cell and selectively inhibits the T7 RNA polymerase by binding to it, a feed-back mechanism that ensures a controlled burst of transcription during T7 infection. The E. coli strain BL21 (DE3) pLysS is an example of a host cell that carries the plasmid pLysS that constitutively expresses T7 lysozyme.
[0459] In one embodiment the promoter system makes use of promoters such as API or APR which are induced or switched on to initiate the induction cycle by a temperature shift, such as by elevating the temperature from about 30-37 C. to 42 C. to initiate the induction cycle.
[0460] A strong promoter may enhance fusion polypeptide density at the surface of the particle during in-vivo production.
[0461] Exemplary fusion polypeptides comprise:
[0462] a polymer synthase, and any two or more of the following
[0463] (i) an ESAT6 antigen,
[0464] (ii) a binding domain capable of binding an ESAT6 antigen,
[0465] (iii) a CFP10 antigen,
[0466] (iv) a binding domain capable of binding a CFP10 antigen,
[0467] (v) an Rv3615c antigen,
[0468] (vi) a binding domain capable of binding an Rv3615c antigen
[0469] (vii) an Rv3020c antigen,
[0470] (viii) a binding domain capable of binding an Rv3020c antigen.
[0471] Other exemplary fusion polypeptides comprise:
[0472] a polymer synthase, and any two or more of the following
[0473] (ix) an ESAT6 antigen,
[0474] (x) a binding domain capable of binding an ESAT6 antigen,
[0475] (xi) a CFP10 antigen,
[0476] (xii) a binding domain capable of binding a CFP10 antigen,
[0477] (xiii) an Rv3615c antigen,
[0478] (xiv) a binding domain capable of binding an Rv3615c antigen
[0479] (xv) an Rv3020c antigen,
[0480] (xvi) a binding domain capable of binding an Rv3020c antigen, and
[0481] (xvii) an Rv2346c antigen
[0482] (xviii) a binding domain capable of binding an Rv2346c antigen. [0483] Once expressed, the fusion polypeptide is able to form or facilitate formation of a polymer particle.
[0484] In one embodiment the nucleic acid sequence encoding at least polymer synthase is indirectly fused with the other nucleic acid sequences through a polynucleotide linker or spacer sequence of a desired length.
[0485] In one embodiment the amino acid sequence of the fusion polypeptide comprising the antigen(s) or binding domain(s) is contiguous with the C-terminus of the amino acid sequence comprising a polymer synthase.
[0486] In one embodiment the amino acid sequence of the fusion protein comprising the antigen(s) or binding domain(s) is indirectly fused with the N-terminus of the amino acid sequence comprising a polymer synthase fragment through a peptide linker or spacer of a desired length that facilitates independent folding of the fusion polypeptides.
[0487] In one embodiment the amino acid sequence of the fusion polypeptide the antigen(s) or binding domain(s) is contiguous with the N-terminus of the amino acid sequence comprising a particle-forming protein, preferably a polymer synthase, or a C-terminal synthase fragment.
[0488] In one embodiment the amino acid sequence of the fusion protein the antigen(s) or binding domain(s) is indirectly fused with the C-terminus of the amino acid sequence comprising a particle-forming protein, preferably a polymer synthase, or a N-terminal polymer synthase fragment through a peptide linker or spacer of a desired length to facilitate independent folding of the fusion polypeptides.
[0489] In one embodiment the amino acid sequence of the fusion polypeptide the antigen(s) or binding domain(s) is contiguous with the N-terminus of the amino acid sequence encoding a depolymerase, or a C-terminal depolymerase fragment.
[0490] One advantage of the fusion polypeptides according to the present invention is that the modification of the proteins binding to the surface of the polymer particles does not affect the functionality of the proteins involved in the formation of the polymer particles. For example, the functionality of the polymer synthase is retained if a recombinant polypeptide is fused with the N-terminal end thereof, resulting in the production of recombinant polypeptide on the surface of the particle. Should the functionality of a protein nevertheless be impaired by the fusion, this shortcoming is offset by the presence of an additional particle-forming protein which performs the same function and is present in an active state.
[0491] In this manner, it is possible to ensure a stable bond of the recombinant polypeptide bound to the polymer particles via the particle-forming proteins.
[0492] It should be appreciated that the arrangement of the proteins in the fusion polypeptide is dependent on the order of gene sequences in the nucleic acid contained in the plasmid.
[0493] For example, it may be desired to produce a fusion polypeptide wherein the M. tuberculosis antigen is indirectly fused to the polymer synthase. The term indirectly fused refers to a fusion polypeptide comprising a particle-forming protein, preferably a polymer synthase, and at least one M. tuberculosis or M. bovis antigen or a binding domain capable of binding at least one M. tuberculosis or M. bovis antigen that are separated by an additional protein which may be any protein that is desired to be expressed in the fusion polypeptide.
[0494] When used in the context of particles for use in the diagnosis or treatment of tuberculosis, it may be desired to produce a fusion polypeptide wherein the M. tuberculosis or M. bovis antigen(s) or at least one M. tuberculosis or M. bovis antigen binding domain is indirectly fused to the polymer synthase.
[0495] In one embodiment the additional protein is selected from a particle-forming protein or a fusion polypeptide, or a linker or spacer to facilitate independent folding of the fusion polypeptides, as discussed above. In this embodiment it would be necessary to order the sequence of genes in the plasmid to reflect the desired arrangement of the fusion polypeptide.
[0496] In other embodiments the M. tuberculosis or M. bovis antigen(s) or binding domain(s) capable of binding at least one M. tuberculosis or M. bovis antigen are directly fused to the polymer synthase. The term directly fused is used herein to indicate where two or more peptides are linked via peptide bonds.
[0497] It is also possible to form a particle wherein the particle comprises at least two distinct fusion polypeptides that are bound to the polymer particle. For example, a first fusion polypeptide comprising a M. tuberculosis or M. bovis antigen or a binding domain capable of binding at least one M. tuberculosis or M. bovis antigen fused to a polymer synthase could be bound to the polymer particle. When used in the context of particles for use in the treatment of tuberculosis, the exemplary particle comprises a first fusion polypeptide comprising a M. tuberculosis or M. bovis antigen, for example, or at least one M. tuberculosis or M. bovis antigen binding domain fused to a polymer synthase bound to the polymer particle.
[0498] In one embodiment the expression construct is expressed in vivo. Preferably the expression construct is a plasmid which is expressed in a microorganism, preferably Escherichia coli.
[0499] In one embodiment the expression construct is expressed in vitro. Preferably the expression construct is expressed in vitro using a cell free expression system.
[0500] In one embodiment one or more genes can be inserted into a single expression construct, or one or more genes can be integrated into the host cell genome. In all cases expression can be controlled through promoters as described above.
[0501] In one embodiment the expression construct further encodes at least one additional fusion polypeptide comprising a M. tuberculosis or M. bovis antigen or at least one M. tuberculosis or M. bovis antigen binding domain and a particle-forming protein as discussed above.
[0502] Plasmids useful herein are shown in the examples and are described in detail in PCT/DE2003/002799 published as WO 2004/020623 (Bernd Rehm) and PCT/NZ2006/000251 published as WO 2007/037706 (Bernd Rehm) which are each herein incorporated by reference in their entirety.
[0503] It will be appreciated that the binding domain capable of binding at least one M. tuberculosis or M. bovis antigen are able to bind M. tuberculosis or M. bovis antigen present in the subject to which the binding domain is administered or in which the immune response is to be elicited.
[0504] Thus, in the context of use for the diagnosis or treatment of tuberculosis, it will be appreciated that the M. tuberculosis or M. bovis antigen binding domains are able to bind at least one M. tuberculosis or M. bovis antigen, for example a M. tuberculosis or M. bovis antigen present in the subject to which the M. tuberculosis or M. bovis antigen binding domain is administered or in which the immune response is to be elicited.
6. Hosts for Particle Production
[0505] The particles of the present invention are conveniently produced in a host cell, using one or more expression constructs as herein described. Polymer particles of the invention can be produced by enabling the host cell to express the expression construct. This can be achieved by first introducing the expression construct into the host cell or a progenitor of the host cell, for example by transforming or transfecting a host cell or a progenitor of the host cell with the expression construct, or by otherwise ensuring the expression construct is present in the host cell.
[0506] Following transformation, the transformed host cell is maintained under conditions suitable for expression of the fusion polypeptides from the expression constructs and for formation of polymer particles. Such conditions comprise those suitable for expression of the chosen expression construct, such as a plasmid in a suitable organism, as are known in the art. For example, and particularly when high yield or overexpression is desired, provision of a suitable substrate in the culture media allows the particle-forming protein component of a fusion polypeptide to form a polymer particle.
[0507] Accordingly, the present invention provides a method for producing polymer particles, the method comprising:
[0508] providing a host cell comprising at least one expression construct of the invention,
[0509] maintaining the host cell under conditions suitable for expression of the expression
[0510] construct and for formation of polymer particles; and
[0511] separating the polymer particles from the host cells.
[0512] Preferably the host cell is, for example, a bacterial cell, a fungi cell, yeast cell, a plant cell, an insect cell or an animal cell, preferably an isolated or non-human host cell. Host cells useful in methods well known in the art (e.g. Sambrook et al., 1987; Ausubel et al., 1987) for the production of recombinant polymer particles are frequently suitable for use in the methods of the present invention, bearing in mind the considerations discussed herein.
[0513] Suitable prokaryote host cells comprise, for example, eubacteria, such as Gram-negative or Gram-positive organisms, for example, Enterobacteriaceae such as E. coli. Various E. coli strains are publicly available, such as E. coli K12 strain MM294 (ATCC 31,446); E. coli X1776 (ATCC 31,537); E. coli strain W3110 (ATCC 27,325) and K5 772 (ATCC 53,635). Other suitable prokaryotic host cells include other Enterobacteriaceae such as Escherichia spp., Enterobacter, Erwinia, Klebsiella, Proteus, Salmonella, e.g., Salmonella typhimurium, Serratia, e.g., Serratia marcescans, and Shigella, as well as Bacilli such as B. subtilis and B. licheniformis, Pseudomonas such as P. aeruginosa, and Actinomycetes such as Streptomyces, Rhodococcus, Corynebacterium and Mycobaterium.
[0514] In some embodiments, for example, E. coli strain W3110 may be used because it is a common host strain for recombinant DNA product fermentations. Preferably, the host cell secretes minimal amounts of proteolytic enzymes. For example, strain W3110 may be modified to effect a genetic mutation in the genes encoding proteins endogenous to the host, with examples of such hosts including E. coli W3110 strain 1A2, which has the complete genotype tonA; E. coli W3110 strain 9E4, which has the complete genotype tonA ptr3; E. coli W3110 strain 27C7 (ATCC 55,244), which has the complete genotype tonA ptr3 phoA E15 (argF-lac)169 degP ompT kanr; E. coli W3110 strain 37D6, which has the complete genotype tonA ptr3 phoA E15 (argF-lac)169 degP ompT rbs7 ilvG kanr; E. coli W3110 strain 40B4, which is strain 37D6 with a non-kanamycin resistant degP deletion mutation.
[0515] In some preferred embodiments, for example, Lactococcus lactis strains that do not produce lipopolysaccharide endotoxins may be used. Examples of Lactococcus lactis strains include MG1363 and Lactococcus lactis subspecies cremoris NZ9000.
[0516] In addition to prokaryotes, eukaryotic microbes such as filamentous fungi or yeast are suitable cloning or expression hosts for use in the methods of the invention, for example. Examples include Saccharomyces cerevisiae, a commonly used lower eukaryotic host microorganism. Other examples include Schizosaccharomyces pombe (Beach and Nurse, 1981; EP 139,383), Kluyveromyces hosts (U.S. Pat. No. 4,943,529; Fleer et al., 1991) such as, e.g., K. lactis (MW98-8C, CBS683, CBS4574; Louvencourt et al., 1983), K. fragilis (ATCC 12,424), K. bulgaricus (ATCC 16,045), K. wickeramii (ATCC 24,178), K. waltii (ATCC 56,500), K. drosophilarum (ATCC 36,906; Van den Berg et al, 1990), K. thermotolerans, and K. marxianus; yarrowia (EP 402,226); Pichia pastoris (EP 183,070; Sreekrishna et al., 1988); Candida; Trichoderma reesia (EP 244,234); Neurospora crassa (Case et al., 1979); Schwanniomyces such as Schwanniomyces occidentalis (EP 394,538 published 31 Oct. 1990); and filamentous fungi such as, e.g., Neurospora, Penicillium, Tolypocladium (WO 91/00357 published 10 Jan. 1991), and Aspergillus hosts such as A. nidulans (Ballance et al., 1983; Tilburn et al., 1983; Yelton et al., 1984) and A. niger (Kelly and Hynes, 1985). Methylotropic yeasts are suitable herein and comprise yeast capable of growth on methanol selected from the genera consisting of Hansenula, Candida, Kloeckera, Pichia, Saccharomyces, Torulopsis, and Rhodotorula. A list of specific species that are exemplary of this class of yeasts may be found in Anthony, 1982.
[0517] Examples of invertebrate host cells include insect cells such as Drosophila S2 and Spodoptera Sf9, as well as plant cells, such as cell cultures of cotton, corn, potato, soybean, petunia, tomato, and tobacco. Numerous baculoviral strains and variants and corresponding permissive insect host cells from hosts such as Spodoptera frugiperda (caterpillar), Aedes aegypti (mosquito), Aedes albopictus (mosquito), Drosophila melanogaster (fruitfly), and Bombyx mori have been identified. A variety of viral strains for transfection are publicly available, e.g., the L-1 variant of Autographa californica NPV and the Bm-5 strain of Bombyx mori NPV, and such viruses may be used as the virus herein according to the present invention, particularly for transfection of Spodoptera frugiperda cells.
[0518] Examples of useful mammalian host cell lines are monkey kidney CV1 line transformed by SV40 (COS-7, ATCC CRL 1651); human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture, Graham et al., J. Gen Virol. 36:59 (1977)); baby hamster kidney cells (BHK, ATCC CCL 10); Chinese hamster ovary cells/-DHFR (CHO, Urlaub et al., 1980); mouse sertoli cells (TM4, Mather, 1980); monkey kidney cells (CV1 ATCC CCL 70); African green monkey kidney cells (VERO-76, ATCC CRL-1587); human cervical carcinoma cells (HELA, ATCC CCL 2); canine kidney cells (MDCK, ATCC CCL 34); buffalo rat liver cells (BRL 3A, ATCC CRL 1442); human lung cells (W138, ATCC CCL 75); human liver cells (Hep G2, HB 8065); mouse mammary tumor (MMT 060562, ATCC CCL51); TRI cells (Mather et al., 1982); MRC 5 cells; FS4 cells; and a human hepatoma line (Hep G2).
[0519] Eukaryotic cell lines, and particularly mammalian cell lines, will be preferred when, for example, the antigen capable of eliciting a cell-mediated immune response or the binding domain capable of binding the antigen capable of eliciting a cell-mediated immune response or the M. tuberculosis or M. bovis antigen or the M. tuberculosis or M. bovis antigen binding domain requires one or more post-translational modifications, such as, for example, glycation. For example, one or more antigens capable of eliciting a cell-mediated immune response may require post-translational modification to be immunogenic or optimally immunogenic, and may thus be usefully expressed in an expression host capable of such post-translational modifications.
[0520] In one embodiment the host cell is a cell with an oxidising cytosol, for example the E. coli Origami strain (Novagen).
[0521] In another embodiment the host cell is a cell with a reducing cytosol, preferably E. coli.
[0522] The host cell, for example, may be selected from the genera comprising Ralstonia, Acaligenes, Pseudomonas and Halobiforma. Preferably the microorganism used is selected from the group comprising, for example, Ralstonia eutropha, Alcaligenes latus, Escherichia coli, Pseudomonas fragi, Pseudomonas putida, Pseudomonas oleovorans, Pseudomonas aeruginosa, Pseudomonas fluorescens, and Halobiforma haloterrestris. This group comprises both microorganisms which are naturally capable of producing biocompatible, biodegradable particles and microorganisms, such as for example E. coli, which, due to their genetic makeup, are not capable of so doing. The genes required to enable the latter-stated microorganisms to produce the particles are introduced as described above.
[0523] Extremely halophilic archaea produce polymer particles with lower levels of unspecific binding of protein, allowing easier isolation and purification of the particles from the cells.
[0524] In principle, any culturable host cell may be used for the production of polymer particles by means of the above-described process, even if the host cell cannot produce the substrates required to form the polymer particles due to a different metabolism. In such cases, the necessary substrates are added to the culture medium and are then converted into polymer particle by the proteins which have been expressed by the genes which have been introduced into the cell.
[0525] Genes utilized to enable the latter-stated host cells to produce the polymer particles include, for example, a thiolase, a reductase or a polymer synthase, such as phaA thiolase, phaB ketoacyl reductase or phaC synthase from Ralstonia eutropha. Which genes are used to augment what the host cell lacks for polymer particle formation will be dependent on the genetic makeup of the host cell and which substrates are provided in the culture medium.
[0526] The genes and proteins involved in the formation of polyhydroxyalkanoate (PHA) particles, and general considerations for particle formation are reported in Madison, et al, 1999; published PCT International Application WO 2004/020623 (Bernd Rehm); and Rehm, 2003; Brockelbank J A. et al., 2006; Peters and Rehm, 2006; Backstrom et al, (2006) and Rehm, (2006), all of which are herein incorporated by reference.
[0527] A polymer synthase alone can be used in any host cell with (R)-Hydroxyacyl-CoA or other CoA thioester or derivatives thereof as a substrate.
[0528] The polymer particle can also be formed in vitro. Preferably, for example, a cell free expression system is used. In such systems a polymer synthase is provided. Purified polymer synthase, such as that obtainable from recombinant production, or in cell free systems capable of protein translation, that obtainable in the cell free system itself by way of introduction of an expression construct encoding a polymer synthase, will be preferred. In order to produce an environment to allow particle formation in vitro the necessary substrates for polymer particle formation should be included in the media.
[0529] The polymer synthase can be used for the in vitro production of functionalised polymer particles using (R)-Hydroxyacyl-CoA or other CoA thioester as a substrate, for example.
[0530] The fusion polypeptides can be purified from lysed cells using a cell sorter, centrifugation, filtration or affinity chromatography prior to use in in vitro polymer particle production.
[0531] In vitro polymer particle formation enables optimum control of surface composition, including the level of fusion polypeptide coverage, phospholipid composition and so forth.
[0532] It will be appreciated that the characteristics of the polymer particle may be influenced or controlled by controlling the conditions in which the polymer particle is produced. This may include, for example, the genetic make up of the host cell, eg cell division mutants that produce large granules, as discussed in Peters and Rehm, 2005. The conditions in which a host cell is maintained, for example temperature, the presence of substrate, the presence of one or more particle-forming proteins such as a particle size-determining protein, the presence of a polymer regulator, and the like.
[0533] In one embodiment, a desirable characteristic of the polymer particle is that it is persistent. The term persistent refers to the ability of the polymer particle to resist degradation in a selected environment. An additional desirable characteristic of the polymer particle is that it is formed from the polymer synthase or particle-forming protein and binds to the C- or N-terminal of the polymer synthase or particle-forming protein during particle assembly.
[0534] In some embodiments of the invention it is desirable to achieve overexpression of the expression constructs in the host cell. Mechanisms for overexpression a particular expression construct are well known in the art, and will depend on the construct itself, the host in which it is to be expressed, and other factors including the degree of overexpression desired or required. For example, overexpression can be achieved by i) use of a strong promoter system, for example the T7 RNA polymerase promoter systemin prokaryotic hosts; ii) use of a high copy number plasmid, for example a plasmid containing the colE1 origin of replication or iii) stabilisation of the messenger RNA, for example through use of fusion sequences, or iv) optimization of translation through, for example, optimization of codon usage, of ribosomal binding sites, or termination sites, and the like. The benefits of overexpression may allow the production of smaller particles where desired and the production of a higher number of polymer particles.
[0535] The composition of the polymers forming the polymer particles may affect the mechanical or physiochemical properties of the polymer particles. For example, polymer particles differing in their polymer composition may differ in half-life or may release biologically active substances, in particular pharmaceutical active ingredients, at different rates. For example, polymer particles composed of C6-C14 3-hydroxy fatty acids exhibit a higher rate of polymer degradation due to the low crystallinity of the polymer. An increase in the molar ratio of polymer constituents with relatively large side chains on the polymer backbone usually reduces crystallinity and results in more pronounced elastomeric properties. By controlling polymer composition in accordance with the process described in the invention, it is accordingly possible to influence the biodegradability of the polymer particles and thus affect the duration the polymer particles (and when present the one or more antigens capable of eliciting a cell-mediated immune response or the binding domains of the antigens capable of eliciting a cell-mediated immune response on the particle or the one or more M. tuberculosis or M. bovis antigens or M. tuberculosis or M. bovis antigen binding domains on the particle, are maintained in, for example, a subject to whom they are administered, or to affect the release rate for biologically active substances present on or in the polymer particles, in particular pharmaceutically active agents or skin-care ingredients.
[0536] At least one fatty acid with functional side groups is preferably introduced into the culture medium as a substrate for the formation of the polymer particles, with at least one hydroxy fatty acid and/or at least one mercapto fatty acid and/or at least one -amino fatty acid particularly preferably being introduced. Fatty acids with functional side groups should be taken to mean saturated or unsaturated fatty acids. These also include fatty acids containing functional side groups which are selected from the group comprising methyl groups, alkyl groups, hydroxyl groups, phenyl groups, sulfhydryl groups, primary, secondary and tertiary amino groups, aldehyde groups, keto groups, ether groups, carboxyl groups, O-ester groups, thioester groups, carboxylic acid amide groups, hemiacetal groups, acetal groups, phosphate monoester groups and phosphate diester groups. Use of the substrates is determined by the desired composition and the desired properties of the polymer particle.
[0537] The substrate or the substrate mixture may comprise at least one optionally substituted amino acid, lactate, ester or saturated or unsaturated fatty acid, preferably acetyl-CoA.
[0538] In one embodiment an adjuvant, an immunomodulatory agent or molecule, such as an immunostimulatory agent or molecule, or other compound useful in the preparation of vaccines is provided in the substrate mixture and is incorporated into the polymer particle during polymer particle formation, or is allowed to diffuse into the polymer particle.
[0539] The polymer particle may comprise a polymer selected from poly-beta-amino acids, polylactates, polythioesters and polyesters, for example. Most preferably the polymer comprises polyhydroxyalkanoate (PHA), preferably poly(3-hydroxybutyrate) (PHB).
[0540] The polymer synthase or polymer particle preferably comprises a phospholipid monolayer that encapsulates the polymer particle. Preferably said particle-forming protein spans said lipid monolayer.
[0541] The polymer synthase or particle-forming protein is preferably bound to the polymer particle or to the phospholipid monolayer or is bound to both.
[0542] The particle-forming protein is preferably covalently or non-covalently bound to the polymer particle it forms.
[0543] Preferably at least about 1%, 2%, 3%, 4%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or 100% of the surface area of the polymer particle is covered by fusion polypeptides.
[0544] In certain circumstances it may be desirable to control the size of the particles produced in the methods of the invention, for example to produce particles particularly suited to a given application. For example, it may be desirable to produce polymer particles comprising one or more antigens capable of eliciting a cell-mediated immune response of a relatively large size, for example to elicit a robust cell-mediated immune response. For example, in the context of particles for use in the treatment of tuberculosis, it may be desirable to produce polymer particles comprising one or more M. tuberculosis or M. Bovis antigens of a relatively large size, for example to elicit a robust cell-mediated immune response. Methods to control the size of polymer particles are described in PCT/DE2003/002799 published as WO 2004/020623, and PCT/NZ2006/000251 published as WO 2007/037706.
[0545] In some embodiments, particle size is controlled by controlling the expression of the particle-forming protein, or by controlling the expression of a particle size-determining protein if present, for example.
[0546] In other embodiments of the present invention, for example, particle size control may be achieved by controlling the availability of a substrate, for example the availability of a substrate in the culture medium. In certain examples, the substrate may be added to the culture medium in a quantity such that it is sufficient to ensure control of the size of the polymer particle.
[0547] It will be appreciated that a combination of such methods may be used, allowing the possibility for exerting still more effective control over particle size.
[0548] In various embodiments, for example, particle size may be controlled to produce particles having a diameter of from about 10 nm to 3 m, preferably from about 10 nm to about 900 nm, from about 10 nm to about 800 nm, from about 10 nm to about 700 nm, from about 10 nm to about 600 nm, from about 10 nm to about 500 nm, from about 10 nm to about 400 nm, from about 10 nm to about 300 nm, from about 10 nm to about 200 nm, and particularly preferably of from about 10 nm to about 100 nm.
[0549] In other embodiments, for example, particle size may be controlled to produce particles having a diameter of from about 10 nm to about 90 nm, from about 10 nm to about 80 nm, from about 10 nm to about 70 nm, from about 10 nm to about 60 nm, from about 10 nm to about 50 nm, from about 10 nm to about 40 nm, from about 10 nm to about 30 nm, or from about 10 nm to about 20 nm.
[0550] Other ranges of average polymer size, for example, including ranges within the above recited ranges, are specifically contemplated, for example polymer particles having a diameter of from about 50 to about 500 nm, from about 150 to about 250 nm, or from about 100 to about 500 nm, etc.
[0551] In various embodiments, for example, 90% of the particles produced have a diameter of about 200 nm or below, 80% have a diameter about 150 nm or below, 60% have a diameter about 100 nm or below, 45% have a diameter about 80 nm or below, 40% have a diameter about 60 nm or below, 25% have a diameter about 50 nm or below, and 5% have a diameter about 35 nm or below
[0552] In various embodiments, for example, the method produces polymer particles with an average diameter less than about 200 nm, less than about 150 nm, or less than about 110 nm.
7. Compositions and formulations
[0553] The polymer particles of the invention can be formulated as compositions suitable for use in the methods of the invention for a number of different applications, for example, formulated for administration via a particular route or formulated for storage, can be stably maintained as particles outside the host cell that produced them, and that these particles can be designed to suit a number of applications.
[0554] In one embodiment, for example, the compositions useful herein are formulated to allow for administration to a subject by any chosen route, including but not limited to oral or parenteral (including topical, subcutaneous, intramuscular and intravenous) administration.
[0555] Thus, for example, a pharmaceutical composition useful according to the invention may be formulated with an appropriate pharmaceutically acceptable carrier (including excipients, diluents, auxiliaries, and combinations thereof) selected with regard to the intended route of administration and standard pharmaceutical practice. For example, pharmaceutical compositions intended for vaccination can contain one or more adjuvants or immunostimulants, as are well known in the art. For example, a composition useful according to the invention can be administered orally as a powder, liquid, tablet or capsule, or topically as an ointment, cream or lotion. Suitable formulations may contain additional agents as required, including emulsifying, antioxidant, flavouring or colouring agents, and may be adapted for immediate-, delayed-, modified-, sustained-, pulsed- or controlled-release.
[0556] Thus, the invention also is directed to doses, dosage forms, formulations, compositions and/or devices comprising one or more polymer particles of the invention including those disclosed herein, useful for the diagnosis or therapy of diseases, disorders, and/or conditions in humans and other mammals and other disorders as disclosed herein. The use of these dosage forms, formulations compositions and/or devices comprising one or more polymer particles of the invention enables effective identification and/or treatment of these conditions. The invention provides, for example, dosage forms, formulations, devices and/or compositions containing one or more polymer particles of the invention. The dosage forms, formulations, devices and/or compositions of the invention may be formulated to optimize bioavailability, immunogenicity, or to maintain plasma, blood, or tissue concentrations within the immunogenic, diagnostic, or therapeutic range, including for extended periods. Controlled delivery preparations may also be used to optimize the antigen concentration at the site of action, for example.
[0557] The dosage forms, formulations, devices and/or compositions of the invention are in certain embodiments formulated for periodic administration, for example to provide continued exposure to the one or more polymer particles of the invention. Strategies to elicit a beneficial immunological response, for example those that employ one or more booster vaccinations, are well known in the art, and such strategies may be adopted in the practise of the present invention.
[0558] Diagnostic compositions of the present invention are in certain embodiments formulated for topical administration, for example formulated for use in skin prick tests.
[0559] Pharmaceutical compositions and dosage forms can be administered via the parenteral route, and this route will be preferred for certain embodiments of methods of eliciting an immune response, such as those described herein. Examples of parenteral dosage forms include aqueous solutions, isotonic saline or 5% glucose of the active agent, or other well-known pharmaceutically acceptable excipients. Cyclodextrins, for example, or other solubilising agents well-known to those familiar with the art, can be utilized as pharmaceutical excipients for delivery of the therapeutic agent.
[0560] Examples of dosage forms suitable for oral administration include, but are not limited to tablets, capsules, lozenges, or like forms, or any liquid forms such as syrups, aqueous solutions, emulsions and the like, capable of providing a therapeutically effective amount of a polymer particle of the invention. Capsules can contain any standard pharmaceutically acceptable materials such as gelatin or cellulose. Tablets can be formulated in accordance with conventional procedures by compressing mixtures of the active ingredients with a solid carrier and a lubricant. Examples of solid carriers include starch and sugar bentonite. Active ingredients can also be administered in a form of a hard shell tablet or a capsule containing a binder, e.g., lactose or mannitol, a conventional filler, and a tabletting agent.
[0561] Examples of dosage forms suitable for transdermal administration include, but are not limited, to transdermal patches, transdermal bandages, and the like. Examples of dosage forms suitable for topical administration of the compositions and formulations of the invention are any lotion, stick, spray, ointment, paste, cream, gel, etc., whether applied directly to the skin or via an intermediary such as a pad, patch or the like.
[0562] Examples of dosage forms suitable for suppository administration of the compositions and formulations of the invention include any solid dosage form inserted into a bodily orifice particularly those inserted rectally, vaginally and urethrally.
[0563] Examples of dosage of forms suitable for injection of the compositions and formulations of the invention include delivery via bolus such as single or multiple administrations by intravenous injection, subcutaneous, subdermal, and intramuscular administration or oral administration.
[0564] Examples of dosage forms suitable for depot administration of the compositions and formulations of the invention include pellets or small cylinders of polymer particles of the invention or solid forms wherein the polymer particles of the invention are entrapped in a matrix of biodegradable polymers, microemulsions, liposomes or are microencapsulated.
[0565] Examples of infusion devices for compositions and formulations of the invention include infusion pumps containing one or more polymer particles of the invention at a desired amount for a desired number of doses or steady state administration, and include implantable drug pumps.
[0566] Examples of implantable infusion devices for compositions, and formulations of the invention include any solid form in which the polymer particles of the invention are encapsulated within or dispersed throughout a biodegradable polymer or synthetic, polymer such as silicone, silicone rubber, silastic or similar polymer.
[0567] Examples of dosage forms suitable for transmucosal delivery of the compositions and formulations of the invention include depositories solutions for enemas, pessaries, tampons, creams, gels, pastes, foams, nebulised solutions, powders and similar formulations containing in addition to the active ingredients such carriers as are known in the art to be appropriate. Specifically contemplated are dosage forms suitable for inhalation or insufflation of the compositions and formulations of the invention, including compositions comprising solutions and/or suspensions in pharmaceutically acceptable, aqueous, or organic solvents, or mixture thereof and/or powders. Transmucosal administration of the compositions and formulations of the invention may utilize any mucosal membrane but commonly utilizes the nasal, buccal, vaginal and rectal tissues. Formulations suitable for nasal administration of the compositions and formulations of the invention may be administered in a liquid form, for example, nasal spray, nasal drops, or by aerosol administration by nebulizer, including aqueous or oily solutions of the polymer particles. Formulations for nasal administration, wherein the carrier is a solid, include a coarse powder having a particle size, for example, of less than about 100 microns, preferably less, most preferably less than about 50 microns, which is administered in the manner in which snuff is taken, i.e., by rapid inhalation through the nasal passage from a container of the powder held close up to the nose. Formulations of the invention may be prepared as aqueous solutions for example in saline, solutions employing benzyl alcohol or other suitable preservatives, absorption promoters to enhance bio-availability, fluorocarbons, and/or other solubilising or dispersing agents known in the art.
[0568] Examples of dosage forms suitable for buccal administration of the compositions and formulations of the invention include lozenges, tablets and the like, compositions comprising solutions and/or suspensions in pharmaceutically acceptable, aqueous, or organic solvents, or mixtures thereof and/or powders.
[0569] Examples of dosage forms suitable for sublingual administration of the compositions and formulations of the invention include lozenges, tablets and the like, compositions comprising solutions and/or suspensions in pharmaceutically acceptable, aqueous, or organic solvents, or mixtures thereof and/or powders.
[0570] Examples of dosage forms suitable for opthalmic administration of the compositions and formulations of the invention include inserts and/or compositions comprising solutions and/or suspensions in pharmaceutically acceptable, aqueous, or organic solvents.
[0571] Examples of formulations of compositions, including vaccines and controlled drug formulations, useful for delivery of the compositions and formulations of the invention are found in, for example, Sweetman, S. C. (Ed.). Martindale. The Complete Drug Reference, 33rd Edition, Pharmaceutical Press, Chicago, 2002, 2483 pp.; Aulton, M. E. (Ed.) Pharmaceutics. The Science of Dosage Form Design. Churchill Livingstone, Edinburgh, 2000, 734 pp.; and, Ansel, H. C., Allen, L. V. and Popovich, N. G. Pharmaceutical Dosage Forms and Drug Delivery Systems, 7th Ed., Lippincott 1999, 676 pp. Excipients employed in the manufacture of drug delivery systems are described in various publications known to those skilled in the art including, for example, Kibbe, E. H. Handbook of Pharmaceutical Excipients, 3rd Ed., American Pharmaceutical Association, Washington, 2000, 665 pp. The USP also provides examples of modified-release oral dosage forms, including those formulated as tablets or capsules. See, for example, The United States Pharmacopeia 23/National Formulary 18, The United States Pharmacopeial Convention, Inc., Rockville Md., 1995 (hereinafter the USP), which also describes specific tests to determine the drug release capabilities of extended-release and delayed-release tablets and capsules. The USP test for drug release for extended-release and delayed-release articles is based on drug dissolution from the dosage unit against elapsed test time. Descriptions of various test apparatus and procedures may be found in the USP. Further guidance concerning the analysis of extended release dosage forms has been provided by the F.D.A. (See Guidance for Industry. Extended release oral dosage forms: development, evaluation, and application of in vitro/in vivo correlations. Rockville, Md.: Center for Drug Evaluation and Research, Food and Drug Administration, 1997).
[0572] Further examples of dosage forms of the invention include, but are not limited to modified-release (MR) dosage forms including delayed-release (DR) forms; prolonged-action (PA) forms; controlled-release (CR) forms; extended-release (ER) forms; timed-release (TR) forms; and long-acting (LA) forms. For the most part, these terms are used to describe orally administered dosage forms, however these terms may be applicable to any of the dosage forms, formulations, compositions and/or devices described herein. These formulations effect delayed total drug release for some time after drug administration, and/or drug release in small aliquots intermittently after administration, and/or drug release slowly at a controlled rate governed by the delivery system, and/or drug release at a constant rate that does not vary, and/or drug release for a significantly longer period than usual formulations.
[0573] In certain embodiments, a diagnostically or therapeutically effective amount of one or more polymer particles of the invention or of one or more antigens comprising one or more polymer particles of the invention is from about 1 ug/kg to about 1 g/kg. Exemplary diagnostically or therapeutically effective dose ranges include, for example, from about 1 g/kg to about 500 mg/kg, from about 1 g/kg to about 400 mg/kg, from about 1 g/kg to about 300 mg/kg, from about 1 g/kg to about 200 mg/kg, from about 1 g/kg to about 100 mg/kg, from about 1 g/kg to about 90 mg/kg, from about 1 g/kg to about 80 mg/kg, from about 1 g/kg to about 70 mg/kg, from about 1 g/kg to about 60 mg/kg, from about 1 g/kg to about 50 mg/kg, from about 5 g/kg to about 50 mg/kg, from about 10 g/kg to about 50 mg/kg, from about 50 g/kg to about 50 mg/kg, from about 100 g/kg to about 50 mg/kg, from about 200 g/kg to about 50 mg/kg, from about 300 g/kg to about 50 mg/kg, from about 400 g/kg to about 50 mg/kg, from about 500 g/kg to about 50 mg/kg, from about 600 g/kg to about 50 mg/kg, from about 700 g/kg to about 50 mg/kg, from about 800 g/kg to about 50 mg/kg, from about 900 g/kg to about 50 mg/kg, about 1 mg/kg to about 50 mg/kg, about 5 mg/kg to about 50 mg/kg, about 10 mg/kg to about 50 mg/kg, about 15 mg/kg to about 50 mg/kg, about 20 mg/kg to about 50 mg/kg, about 25 mg/kg to about 50 mg/kg, about 30 mg/kg to about 50 mg/kg, about 35 mg/kg to about 50 mg/kg, about 40 mg/kg to about 50 mg/kg, or about 45 mg/kg to about 50 mg/kg.
[0574] Other diagnostically or therapeutically effective dose ranges include, for example, from about 1 mg/kg to about 1 g/kg, from about 1.5 mg/kg to about 950 mg/kg, about 2 mg/kg to about 900 mg/kg, about 3 mg/kg to about 850 mg/kg, about 4 mg/kg to about 800 mg/kg, about 5 mg/kg to about 750 mg/kg, about 5 mg/kg to about 700 mg/kg, 5 mg/kg to about 600 mg/kg, about 5 mg/kg to about 500 mg/kg, about 10 mg/kg to about 400 mg/kg, about 10 mg/kg to about 300 mg/kg, about 10 mg/kg to about 200 mg/kg, about 10 mg/kg to about 250 mg/kg, about 10 mg/kg to about 200 mg/kg, about 10 mg/kg to about 200 mg/kg, about 10 mg/kg to about 150 mg/kg, about 10 mg/kg to about 100 mg/kg, about 10 mg/kg to about 75 mg/kg, about 10 mg/kg to about 50 mg/kg, or about 15 mg/kg to about 35 mg/kg.
[0575] In some embodiments of the invention targeting human subjects, a diagnostically or therapeutically effective amount of one or more polymer particles of the invention or of one or more antigens comprising one or more polymer particles of the invention is, for example, from about 10 mg to about 10 g per dose. Other diagnostically or therapeutically effective dose ranges include, for example, from about 20 mg to about 9 g, from about 30 mg to about 8 g, from about 40 mg to about 7 g, from about 50 mg to about 6 g, from about 60 mg to about 5 g, from about 70 mg to about 4 g, about 80 mg to about 3 g, about 100 mg to about 2 g, about 100 mg to about 1.5 g, about 200 mg to about 1400 mg, about 200 mg to about 1300 mg, about 200 mg to about 1200 mg, about 200 mg to about 1100 mg, about 200 mg to about 1000 mg, about 300 mg to about 900 mg, about 300 mg to about 800, about 300 mg to about 700 mg or about 300 mg to about 600 mg per dose.
[0576] The invention also in part provides low dose compositions, formulations and devices comprising one or more one or more polymer particles of the invention. For example, low dose compositions, formulations and the like, are administered in an amount sufficient to provide, for example, dosages from about 0.001 mg/kg to about 5 mg/kg, about 0.01 mg/kg to about 4.5 mg/kg, about 0.02 mg/kg to about 4 mg/kg, about 0.02 to about 3.5 mg/kg, about 0.02 mg/kg to about 3 mg/kg, about 0.05 mg/kg to about 2.5 mg/kg, about 0.05 mg/kg to about 2 mg/kg, about 0.05-0.1 mg/kg to about 5 mg/kg, about 0.05-0.1 mg/kg to about 4 mg/kg, about 0.05-0.1 mg/kg to about 3 mg/kg, about 0.05-0.1 mg/kg to about 2 mg/kg, about 0.05-0.1 mg/kg to about 1 mg/kg, and/or any other doses or dose ranges within the ranges set forth herein, of one or more one or more polymer particles of the invention or of one or more antigens comprising one or more polymer particles of the invention.
[0577] The doses described herein, may be administered in a single dose or multiple doses or divided doses. For example, doses may be administered, once, twice, three, four or more times over a treatment regime, as is well known in the immunological arts.
[0578] The efficacy of a composition useful according to the invention can be evaluated both in vitro and in vivo. See, e.g., the examples below. Briefly, the composition can be tested in vitro or in vivo for its ability to induce a cell-mediated immune response. For in vivo studies, the composition can be fed to or injected into an animal (e.g., a mouse) and its effects on eliciting an immune response are then assessed. Based on the results, an appropriate dosage range and administration route are then determined.
[0579] In some embodiments of the invention, a diagnostically or therapeutically effective amount is an amount effective to elicit an immunological response, such as, for example, a concentration of IFN-gamma in the blood of from about 0.5 ng/mL to about 20 ng/mL, about 0.5 ng/mL to about 15 ng/mL, about 0.5 ng/mL to about 10 ng/mL, about 0.5 ng/mL to about 9 ng/mL, about 1 ng/mL to about 8 ng/mL, about 2 ng/mL to about 7 ng/mL or about 3 ng/mL to about 6 ng/mL.
[0580] In some circumstances, including post infection or during prolonged infection, elevated IFN-gamma blood concentrations are observed, and such elevated concentrations should be accounted for in assessing a baseline against which elicitation of an effective immunological response by the polymer particles of the invention is to be assessed.
8. Exemplary Uses of Polymer Particles of the Invention
[0581] It has been discovered that the polymer particles, e.g., polyhydroxyalkyl polymer particles, can be stably maintained as particles outside the host cell that produced them, and that these particles can be designed to suit a number of applications.
[0582] Functionalised polymer particles may comprise one or more surface-bound antigens capable of eliciting a cell-mediated or other immune response, one or more substances bound to binding domains of an antigen capable of eliciting a cell-mediated or other immune response, or a combination thereof.
[0583] In one embodiment, for example, a substance is immobilised on the particle surface during particle formation, bound to a binding domain capable of binding an antigen capable of eliciting a cell-mediated immune response, or integrated into the particle by loading, diffusion or incorporation.
[0584] In the context of use in the diagnosis or treatment of tuberculosis, for example, exemplary polymer particles comprise one or more surface-bound M. tuberculosis or M. Bovis antigens, and optionally one or more substances bound to M. tuberculosis or M. bovis antigen binding domains, or a combination thereof.
[0585] In one embodiment a substance may be immobilised on the particle surface during particle formation, bound to, for example, a M. tuberculosis or M. bovis antigen binding domain, or integrated into the particle by loading, diffusion or incorporation. Covalent linking to the surface of the polymer particle, for example, by cross-linking, is also specifically contemplated.
[0586] In one embodiment the substance is selected from the list comprising, for example, a protein or protein fragment, a peptide, a polypeptide, an antibody or antibody fragment, an antibody binding domain, an antigen, an antigenic determinant, an epitope, an immunogen or fragment thereof, or any combination of any two or more thereof.
[0587] In one embodiment DNA from an intracellular pathogen can be fragmented and inserted into expression constructs encoding fusion polypeptides that comprise a polymer synthase. In this way, polymer particles displaying intracellular pathogen antigenic determinants can be produced and screened using serum from infected patients and antigen-presenting particles identified, isolated and reproduced using well-known and scalable bacterial production systems.
[0588] In one embodiment multiple antigens capable of eliciting a cell-mediated (or other) immune response are immobilised on the surface of the polymer particles.
[0589] In one embodiment DNA from a M. tuberculosis or M. bovis bacterium, for example, can be fragmented and inserted into expression constructs encoding fusion polypeptides that comprise a polymer synthase. In this way, polymer particles displaying M. tuberculosis or M. bovis antigenic determinants, for example, can be produced and screened using serum from infected patients and antigen-presenting particles identified, isolated and reproduced using well-known and scalable bacterial production systems.
[0590] In one embodiment, for example, multiple M. tuberculosis or M. bovis or other antigens are immobilised on the surface of the polymer particles.
[0591] One aspect of the invention relates to the ability of the polymer particles carrying one or more antigens to elicit an immune response. In one embodiment, the polymer particles comprise at least one antigen capable of eliciting a cell-mediated or other immune response fused to the polymer particle. The polymer polymer particles display at least one antigens capable of eliciting a cell-mediated or other immune response on their surface to stimulate an optimal immune response to the antigenic moieties.
[0592] In one embodiment, the polymer particles carrying one or more antigens elicit an immune response. In one embodiment, the polymer particles comprise at least one M. tuberculosis antigen, for example, fused to the polymer particle. The polymer polymer particles display at least one M. tuberculosis antigen, for example, on their surface to stimulate an optimal immune response to the antigenic moieties.
[0593] In one embodiment, for example, more than one antigen or a combination of antigen and adjuvant or other immunomodulatory agent or molecule, such as an immunostimulatory agent or molecule, are present in or on the particle or present in a composition. Typically, the presence of the combination of antigens, adjuvants, or other immunomodulatory agents or molecules will be to further enhance the immune response.
[0594] The present invention also relates to a method of eliciting an immune response in a subject, wherein the method comprises administering to a subject in need thereof a polymer particle comprising a particle-forming protein, preferably a polymer synthase, for example, fused to one or more binding domain(s) capable of binding an antigen selected from an ESAT6, a CFP10, an Rv3615c, or an Rv3020c antigen. In this embodiment, on administration to the subject the binding domain(s) capable of binding said antigens bind endogenous antigen, thereby facilitating an immune response.
[0595] For example, antigens capable of eliciting a cell-mediated immune response that is present in the subject prior to administration of the particle comprising at least one M. tuberculosis antigen binding domain, for example, but is unable to elicit an effective immune response in the subject, is on binding to the particle able to elicit an effective immune response or is effective to enhance the subject's immune response.
[0596] In one embodiment, the invention provides a method of eliciting an immune response in a subject infected with tuberculosis, for example, or previously immunised against tuberculosis, for example, wherein the method comprises administering to a subject in need thereof a polymer particle comprising a particle-forming protein fused to a M. tuberculosis or M. bovis antigen binding domain, for example.
[0597] In this embodiment, for example, on administration to the subject the M. tuberculosis or M. bovis antigen binding domain may bind to an endogenous M. tuberculosis or M. bovis antigen. It will be appreciated that binding of a polymer particle comprising a M. tuberculosis or M. bovis antigen binding domain to endogenous M. tuberculosis or M. bovis antigen, for example, is able to elicit or enhance the subject's immune response.
[0598] For example, M. tuberculosis or M. bovis antigen that is present in the subject prior to administration of the particle comprising at least one M. tuberculosis or M. bovis antigen binding domain, but is unable to elicit an effective immune response in the subject, is on binding to the particle able to elicit an effective immune response or is effective to enhance the subject's immune response.
[0599] It will be appreciated that the present invention provides particles, compositions and methods that elicit an immune response in subjects to whom they are administered. Preferably, the magnitude of the immune response elicited in response to one or more antigens presented to a subject using the particles, compositions and methods of the invention is greater than that elicited in response to the antigen alone (that is, in the absence of a particle or composition of the invention or presented by a method other than those provided herein). Methods to quantify the magnitude of an immune response, and particularly a cell-mediated immune response, are well known in the art.
[0600] Particularly contemplated methods of eliciting an immune response, for example in the diagnosis of tuberculosis, comprise skin tests. The most common formats of the test for bovine are the caudal fold test (CFT), the single intradermal cervical tuberculin test (SIT) and the single intradermal comparative cervical tuberculin (SICCT) test (Monaghan et al. (1994) Vet. Microbiol, vol. 40 pp 111-24).
[0601] These test formats use a purified protein derivative (PPD) tuberculin prepared from a culture of M. bovis (PPD-B) as the primary diagnostic antigen. Additionally, the SICCT test attempts to address environmental sensitisation through the use of a M. avium derived PPD (PPD-A). The skin tests referred to herein may be any of a CFT, SIT or SICCT test, as described in the Office International des Epizooties (OIE) Manual of Diagnostic Tests and Vaccines for Terrestrial Animals 2009 (ISBN-10:92-9044-718-4; http://www.oie.int/fileadmin/Home/eng/Health_standards/tahm/2008/pdf/2.04.07_BOVINE_TB. pdf, accessed 8 Nov. 2013, in particular Chapter 2.4.7. Positive test criteria are outlined therein, and will be well understood by a person skilled in the art.
[0602] Therefore, when the polymer particles and diagnostic reagents of the invention elicit a positive result when administered in a skin test, this result is determined by, for example, detection of an increased thickness and/or induration of skin at the site of administration (e.g., injection). As outlined in the manual, callipers or other measurement devices are helpfully used, for example. In certain embodiments, the skin thickness is determined prior to administration/injection, and again at one or more of, for example, about 24, 36, 48, 72, 96 or about 120 hours after administration/injection. Determining skin thickness at about 72 hours after injection is typical, as exemplified herein.
[0603] Additional particularly contemplated methods of diagnosing tuberculosis comprise diagnostic assays such as cytokine or cell-based assays, including for example assays of cell-mediated immunity, in which a sample obtained from a subject is contacted with a polymer particle of the invention. Typically, the sample will contain a population of cells, including immune cells such as T cells, capable of mediating or modulating an immune response. Particularly contemplated assays include interferon-gamma assays, such as interferon-gamma ELISA. In particular examples, the response in an assay, such as an interferon-gamma ELISA, is capable of distinguishing between subjects suffering from tuberculosis, and subjects immunised against tuberculosis, for example with BCG.
9. Modulators of an Immune Response
[0604] In certain circumstances it will be desirable to produce polymer particles displaying a fusion protein comprising two or more antigens from the group comprising ESAT6, CFP10, Rv3615c, and Rv3020c. Alternatively, a fusion protein comprising at least one or more of these antigens with an adjuvant or other modulator of an immune response is desirable for eliciting an immune response.
[0605] In one example, a polymer particle of the invention comprises one or more antigens together with one or more toll-like receptors, including one or more toll-like receptors able to bind one or more of the group of ligands comprising LPS, lipoproteins, lipopeptides, flagellin, double-stranded RNA, unmethylated CpG islands, or bacterial or viral DNA or RNA. Similarly, a composition of the invention may comprise a population of polymer particles comprising one or more TB antigens, and a population of polymer particles comprising one or more immunomodulatory molecules, such as one or more toll-like receptors.
[0606] The presence of one or more immunomodulatory molecules may be useful in eliciting a humoral-specific immune response, or a cell-mediated-specific immune response, or in eliciting an immune response comprising a combination of both humoral and cell-mediated responses.
[0607] The invention consists in the foregoing and also envisages constructions of which the following gives examples only.
EXAMPLES
Example 1
Construction of Plasmids and Production of PHA Polymer Particles
[0608] This example describes the preparation of polymer particles of the invention, and their assessment as diagnostic reagents for tuberculosis.
[0609] Introduction
[0610] Three specific TB antigens, the 6-kDa early secretory antigenic target (ESAT6), the 10-kDa culture filtrate protein (CFP10), and Rv3615c are expressed by members of the pathogenic M. tuberculosis complex which includes M. bovis, but are not expressed by the majority of non-pathogenic environmental mycobacteria and the BCG vaccine strain (Millington, 2011; Waters et al, 2004). These immunodominant proteins have previously been evaluated in interferon- (IFN-) tests for the diagnosis of TB in cattle (Buddle et al, 1999). Recently, the skin testing of cattle using a combination of these three proteins indicated that they had a high sensitivity for detection of animals infected with M. bovis while differentiating against those vaccinated with BCG (Whelan et al, 2010; Casal et al, 2012). This example describes an investigation of the functional display of these three antigens on polyester particles and their performance in bovine TB skin tests.
Materials and Methods
[0611] Bacterial Strains and Growth Conditions.
[0612] The bacteria strains used in this study are listed in Table 1. The E. coli strain used for cloning, XL1-Blue (Stratagene) transformed with the expression plasmids were grown in Luria broth (Difco, Detroit, Mich.) supplemented with tetracycline (12.5 g/ml) and ampicillin (75 g/ml). Medium for growth of E. coli BL21 (DE3) used for production of polyester particles contained chloramphenicol (50 g/ml) instead of tetracycline.
[0613] Plasmids, Oligonucleotides and Generation of Plasmids for Production of Bioparticles Displaying Mycobacterial Antigens.
[0614] Plasmids and primers used in this study are listed in Tables 1 and 2, respectively. General molecular cloning procedures were implemented as described elsewhere (Sambrook et al, 1989). DNA sequences of new plasmid constructs were verified by DNA sequencing. The biosynthesis of polyester requires, in addition to the polyester synthase gene (phaC), the enzymes PhaA and PhaB for precursor synthesis, and these enzymes were encoded on the plasmid pMCS69 (Amara et al, 2003).
TABLE-US-00009 TABLE 1 Bacterial strains and plasmids Strains or plasmids Relevant characteristics References E. coli strains BL21 (DE3) F-dcm ompT hsdS(rB-mB-) gal (DE3) Stratagene XL1-Blue recA1 endA1 gyrA96 thi-1 hsdR17 supE44 relA1 lac [FproAB Stratagene lacIqZM15 Tn10 (Tetr)] Plasmid name pET-14b Apr; T7 promoter Novagen pET-14b phaC pET-14b derivative containing phaCgene fragment (Peters et al, 2005) pET-14b cfp10-phaC pET-14b derivative containing NdeI fragment gene cfp10fused to the Herein 5 end of phaC pET-14b rv3615c-phaC pET-14b derivative containing NdeI fragment generv3615cfused to Herein the 5 end of phaC pET-14b esat6-phaC pET-14b derivative containing NdeI fragment geneesat6fused to the Herein 5 end of phaC pET-14b cfp10-linker- pET-14b derivative containing SpeI fragment genes cfp10-linker- Herein rv3615c-phaC rv3615cfused to the 5 end of phaC pET-14b cfp10-linker- pET-14b derivative containing SpeI fragment Herein rv3615c-phaC-esat6 genescfp10-linker-rv3615cfused to the 5 end of phaCand XhoI/BamHI fragment gene esat6 fused to the 3 end of phaCvia a linker sequence pMCS69 Cm.sub.r; T7 promoter, pBBR1MCS derivative containing the genes phaA (Amara et al, and phaB from C. necator co-linear to lac promoter 2003) pUC57-esat6 Cloning vector, ColE1 origin, Apr, XhoI/BamHI fragment gene ESAT6 Herein Tetr, tetracycline resistance Apr, ampicillin resistance Cmr, chloramphenicol resistance
TABLE-US-00010 TABLE2 Primers Restriction site Sequencefrom SEQ. Primername (underlined) 5 to3 ID.No. CFP10_fwd NdeI AACATATGGCA 16 GAAATGAAAAC GGATGCGGC CFP10_rev NdeI TTCATATGGAA 17 ACCCATTTGAG AGCTCAGAGCC Rv3615c_fwd NdeI AACATATGACC 18 GAAAACCTGAC GGTTCAGCCGG Rv3615c_rev NdeI TTCATATGGGT 19 GAACAGGCCGT CGATTGCTTTA C ESAT6_fwd NdeI AACATATGACG 20 GAACAACAATG GAACTTTGCTG GC ESAT6_rev NdeI TTCATATGTGC 21 GAACATGCCCG TGACATTGCCT TC
[0615] To display the TB genes on the surfaces of the polyester particles, the genes encoding amino acid sequences of ESAT-6 (see Table 3, SEQ. ID. No. 1]), CFP-10 (see Table 3, SEQ. ID. No. 2, and RV3615c (see Table 3, SEQ. ID. No. 3) were synthesized by DNA2.0 (CA, USA) using the PCR primers identified in Table 2, optimized to the codon usage of E. coli. An NdeI restriction site was inserted at both the 5 and 3 ends of each gene.
TABLE-US-00011 TABLE3 AminoacidsequencesofTBantigens Seq. ID. Antigen AAsequence No. ESAT-6 MTEQQWNFAGIEAAASAIQGNVTSIHSLLDEGKQS 1 LTKLAAAWGGSGSEAYQGVQQKWDATATELNNALQ NLARTISEAGQAMASTEGNVTGMFA CFP-10 MAEMKTDAATLAQEAGNFERISGDLKTQIDQVEST 2 AGSLQGQWRGAAGTAAQAAVVRFQEAANKQKQELD EISTNIRQAGVQYSRADEEQQQALSSQMGF RV3615c MTENLTVQPERLGVLASHHDNAAVDASSGVEAAAG 3 LGESVAITHGPYCSQFNDTLNVYLTAHNALGSSLH TAGVDLAKSLRIAAKIYSEADEAWRKAIDGLFT
[0616] The respective synthesized NdeI fragments encoding CFP-10, ESAT-6 or Rv3615c were inserted into the plasmid pHAS-Ag85A-ESAT-6 (Parlane et al, 2009) after hydrolysis with NdeI which resulted in plasmids pET-14b cfp10-phaC, pET-14b Rv3615c-phaC and pET-14b Esat-6-PhaC, respectively. The codon-optimised nucleotide sequences encoding the CFP10-PhaC fusion polypeptide, the Rv3615c-PhaC fusion polypeptide, and the ESAT6-PhaC fusion polypeptide, are presented herein as SEQ. ID. NO. 12, SEQ. ID. NO. 13, and SEQ. ID. NO. 14, respectively.
[0617] The plasmid construct, pET-14b cfp10-linker-rv3615c-phaC-esat6, encoding the three TB antigen genes was made as follows. The codon-optimised nucleotide sequence encoding the CFP10-linker-Rv3615c-PhaC-ESAT6 fusion polypeptide is presented herein as SEQ. ID. NO. 15.
[0618] The XhoI-BamHI fragment encoding the esat6 gene was sub-cloned into pET-14b cfp10-linker-rv3615c-phaC-MalE hydrolysed with XhoI-BamHI to generate the final plasmid, pET-14b cfp10-linker-rv3615c-phaC-esat6, which contained the three TB antigen genes.
[0619] A schematic representation of the plasmids used to display TB antigens on the surface of the polyester particles is shown in
[0620] Production and Isolation of Polyester Particles.
[0621] Polyester particles displaying mycobacterial proteins or control particles alone were produced in E. coli BL21 (DE3) as previously described (Parlane et al, 2009).
[0622] Briefly, E. Coli stains were grown at 37 C. in LB and induced with 1 mM isopropyl--D-thiogalactopyranoside to induce protein and cultured for a further 48 h at 25 C. The presence of polyester inclusions was observed by staining cells with the fluorescent lipophilic dye Nile Red and by using fluorescence microscopy (Spiekermann et al, 1999). Transmission electron microscopy (TEM) was employed to assess shape and size of polyester inclusion as well as the number per cell. Polyester granules were isolated as previously described (Peters et al, 2008). Protease inhibitors (Roche, USA) were added as required. To confirm functionality of the PhaC enzyme, the polyester content of the cells was quantitatively determined by gas chromatography-mass spectroscopy (GC-MS) (Bramd; et al. 1988).
[0623] Analysis of Proteins Attached to Polyester Particles.
[0624] Proteins attached to the polyester particles were separated by SDS-PAGE using 8% polyacrylamide gels and stained with Coomassie blue. Proteins of interest were excised from the gels and subjected to tryptic peptide finger printing using matrix-assisted laser desorption ionisation time-of-flight mass spectrometry (MALDI-TOF/MS) (Jahns et al, 2009).
[0625] Enzyme-Linked Immunosorbent Assay (ELISA).
[0626] Specific Activity of the Particles displaying the TB antigens was determined by ELISA as previously described (Parlane et al, 2009). Briefly, a high-binding capacity microtitre plate (Greiner bio-one) was coated overnight at 4 C. with 100 l of purified PHB particles displaying TB proteins or control particles, diluted in carbonate-bicarbonate coating buffer, pH 9.6 (Sigma-Aldrich) at protein concentrations ranging from 100 g/ml to 0.05 g/ml over serial dilutions. As positive controls, the microtitre plates were also coated overnight at 4 C. with 100 l of free single or a mixture of the three single TB antigens, kindly provided by Dr H. M. 183 Vordermeier (AHVLA, UK), diluted in carbonate-bicarbonate coating buffer, at protein concentrations ranging from 1 g/ml to 0.125 g/ml. Plates were washed with phosphate-buffered saline (PBS) containing 0.05% (vol/vol) Tween 20 (PBST) and blocked with 3% (wt/vol) bovine serum albumin for (BSA) for 1 hr at room temperature. Plates were washed with PBST and incubated with mouse monoclonal antibody to CFP-10 or ESAT-6 (both antibodies were from Abcam, Cambridge, UK) or polyclonal rabbit sera produced against recombinant Rv3615c (AgResearch, Hamilton, NZ) or pre-immune rabbit serum for 1 hr at room temperature. The rabbit antiserum against Rv3615c was produced by immunizing a rabbit with 100 g of Rv3615c mixed in Incomplete Freund's Adjuvant (Sigma) and revaccinating the rabbit twice at 3 week intervals. Following washing with PBST, plates were incubated for 1 hr with anti-mouse IgG-horseradish peroxidase (HRP) conjugate or anti-rabbit HRP-conjugate. After further washing, o-pheylenediamine (OPD) substrate (Abbott Diagnostics, Ill., USA) was added and incubated for 15 min at room. The reaction was stopped with 0.5N H.sub.2SO.sub.4, and the absorbance measured at 490 nm on an ELx808iu ultra microtiter plate reader (BIO-TEK Instruments Inc., USA) (Jahns et al, 2008). Results were expressed as optical density units at 490 nm.
[0627] TB skin test on cattle. Ten, 15-month old Friesian-cross cattle were experimentally infected with a dose of approximately 510.sup.3 colony forming units of M. bovis intratracheally as previously described (Buddle et al, 1995). These animals were kept on pasture in an isolation unit which was completely separate to paddocks where the 14 control cattle of equivalent age and breed were grazing. All cattle were sourced from TB-free herds and located in TB-free regions of New Zealand. Prior to the M. bovis inoculation, the cattle tested negative in the interferon-gamma test (BOVIGAM test; Prionics, Switzerland) for bovine TB and the control cattle were negative in this test throughout the study using the standard interpretation as described previously (Buddle et al, 2009). At 27 weeks after M. bovis infection, the infected and control cattle were tested in a comparative cervical skin test comparing responses for triple antigen TB polymer particles and control polymer particles with those for PPD from M. bovis (PPD-B; 5,000 IU/0.1 ml injection) and M. avium (PPD-A; 2,500 IU/0.1 ml injection; AsureQuality, Upper Hutt, New Zealand)). The 0.1 ml inoculum of the TB polyester particle reagent contained 3.3 g of fusion protein, comprising 0.9 g of the mycobacterial proteins and 2.4 g of PhaC protein, mixed in PBS, while the control polyester particles contained 3.3 g of PhaC protein in PBS. The skin thickness at the site of injection was measured with callipers immediately prior to injection and 72 h later and results expressed as the change in skin thickness (mm). The M. Bovis-infected animals were killed and necropsied at 28 weeks after infection. Tuberculous lesions typical of those found in naturally-infected animals were identified in the lungs and/or pulmonary lymph nodes of the animals and M. Bovis was cultured from the lesions of all these animals using the BACTEC method and confirmation by AccuProbe. All animal procedures were approved by the AgResearch Grasslands animal ethics committee.
[0628] Statistical Analyses.
[0629] The Kruskall-Wallis test was used to compare the in vitro ELISA responses for the antigen activity on the particles and analyses of the cross-reactivity of the antisera with heterologous antigens. Skin test responses to PPD-B and the triple TB antigen particles were compared by ANOVA. The correlation between the skin test responses for bovine PPB and the triple antigen particle in the experimentally-infected cattle was undertaken using Spearman's rank correlation test. Statistical analyses were conducted using package agricolae in R.3.0.1. and statistical significance was denoted when P<0.05.
Results
[0630] Production and Characterisation of Polyester Particles Displaying Mycobacterial Antigens.
[0631] Plasmids encoding PhaC and containing either esat-6, cfp-10 or Rv3615c or all three mycobacterial genes were constructed as described in Materials and Methods. The modular compositions of the various hybrid genes and encoded fusion proteins are outlined in
[0632] Display of Recombinant PhaC Antigen Fusion Protein on Polyester Particles.
[0633] To test whether recombinant fusion proteins were immobilized to polyester particles and whether proteins were susceptible to proteolytic degradation, SDS-PAGE was performed to analyze the polyester particle protein profile. Dominant protein bands were observed which corresponded to proteins with the oretical molecular masses of 63 kDa for PhaC, 69 kDa for the PhaC-ESAT-6 fusion, 73 kDa for CFP10-PhaC, 74 kDa for PhaC-Rv3615c and 90 kDa for CFP10-Rv3615c-PhaC-ESAT6 (
TABLE-US-00012 TABLE4 IdentifiedpeptidefragmentsofTBfusionproteinanalyzed byMALDI-TOF/MS Peptidefragmentsassignedto Protein/Proteinsequence thevariousproteinregions CFP10-PhaC(MW:75.2kDa) MAEMKTDAATLAQEAGNFERISGDLKTQIDQVESTAGSLQ CFP10:A2-R20,T27-R57, GQWRGAAGTAAQAAVVRFQEAANKQKQELDEISTNIRQA Q78-R85 GVQYSRADEEQQQALSSQMGFHMATGKGAAASTQEGKS PhaC:V122-R137,I164-R175, QPFKVTPGPFDPATWLEWSRQWQGTEGNGHAAASGIPGL D179-R209,F216-R226, DALAGVKIAPAQLGDIQQRYMKDFSALWQAMAEGKAEA F247-R281,I296-R308,Y351- TGPLHDRRFAGDAWRTNLPYRFAAAFYLLNARALTELAD R400,I414-K514,L557-K599, AVEADAKTRQRIRFAISQWVDAMSPANFLATNPEAQRLLI F602-K619,S623-K663, ESGGESLRAGVRNMMEDLTRGKISQTDESAFEVGRNVAV A665-R674 TEGAVVFENEYFQLLQYKPLTDKVHARPLLMVPPCINKYY ILDLQPESSLVRHVVEQGHTVFLVSWRNPDASMAGSTWD DYIEHAAIRAIEVARDISGQDKINVLGFCVGGTIVSTALAV LAARGEHPAASVTLLTTLLDFADTGILDVFVDEGHVQLRE ATLGGGAGAPCALLRGLELANTFSFLRPNDLVWNYVVDN YLKGNTPVPFDLLFWNGDATNLPGPWYCWYLRHTYLQN ELKVPGKLTVCGVPVDLASIDVPTYIYGSREDHIVPWTAA YASTALLANKLRFVLGASGHIAGVINPPAKNKRSHWTND ALPESPQQWLAGAIEHHGSWWPDWTAWLAGQAGAKRA APANYGNARYRAIEPAPGRYVKAKA[SEQ.ID.NO.7] RV3615C-PhaC(MW:75.2kDa) MTENLTVQPERLGVLASHHDNAAVDASSGVEAAAGLGES RV3615C:T2-R11,I86-K96 VAITHGPYCSQFNDTLNVYLTAHNALGSSLHTAGVDLAKS PhaC:V125-R140,I167-R178, LRIAAKIYSEADEAWRKAIDGLFTHMATGKGAAASTQEG D182-R212,F219-R229, KSQPFKVTPGPFDPATWLEWSRQWQGTEGNGHAAASGIP F250-R284,I299-R311,Y354- GLDALAGVKIAPAQLGDIQQRYMKDFSALWQAMAEGKA R403,I417-K517,L560-K602 EATGPLHDRRFAGDAWRTNLPYRFAAAFYLLNARALTEL F605-K622,S626-K666, ADAVEADAKTRQRIRFAISQWVDAMSPANFLATNPEAQR A668-R677 LLIESGGESLRAGVRNMMEDLTRGKISQTDESAFEVGRNV AVTEGAVVFENEYFQLLQYKPLTDKVHARPLLMVPPCINK YYILDLQPESSLVRHVVEQGHTVFLVSWRNPDASMAGST WDDYIEHAAIRAIEVARDISGQDKINVLGFCVGGTIVSTAL AVLAARGEHPAASVTLLTTLLDFADTGILDVFVDEGHVQL REATLGGGAGAPCALLRGLELANTFSFLRPNDLVWNYVV DNYLKGNTPVPFDLLFWNGDATNLPGPWYCWYLRHTYL QNELKVPGKLTVCGVPVDLASIDVPTYIYGSREDHIVPWT AAYASTALLANKLRFVLGASGHIAGVINPPAKNKRSHWT NDALPESPQQWLAGAIEHHGSWWPDWTAWLAGQAGAK RAAPANYGNARYRAIEPAPGRYVKAKA[SEQ.ID.NO.8] ESAT6-PhaC(MW:74.3kDa) MTEQQWNFAGIEAAASAIQGNVTSIHSLLDEGKQSLTKLA ESAT6:M1-K33,W58-R74 AAWGGSGSEAYQGVQQKWDATATELNNALQNLARTISE PhaC:V117-R132,1159-R170, AGQAMASTEGNVTGMFAHMATGKGAAASTQEGKSQPFK D174-R204,F211-K235, VTPGPFDPATWLEWSRQWQGTEGNGHAAASGIPGLDALA F242-R276,I291-R303,Y346- GVKIAPAQLGDIQQRYMKDFSALWQAMAEGKAEATGPL R395,I409-K509,L552K594 HDRRFAGDAWRTNLPYRFAAAFYLLNARALTELADAVEA F597-K614,S618-K658, DAKTRQRIRFAISQWVDAMSPANFLATNPEAQRLLIESGG A660-R669 ESLRAGVRNMMEDLTRGKISQTDESAFEVGRNVAVTEGA VVFENEYFQLLQYKPLTDKVHARPLLMVPPCINKYYILDL QPESSLVRHVVEQGHTVFLVSWRNPDASMAGSTWDDYIE HAAIRAIEVARDISGQDKINVLGFCVGGTIVSTALAVLAAR GEHPAASVTLLTTLLDFADTGILDVFVDEGHVQLREATLG GGAGAPCALLRGLELANTFSFLRPNDLVWNYVVDNYLKG NTPVPFDLLFWNGDATNLPGPWYCWYLRHTYLQNELKVP GKLTVCGVPVDLASIDVPTYIYGSREDHIVPWTAAYASTA LLANKLRFVLGASGHIAGVINPPAKNKRSHWTNDALPESP QQWLAGAIEHHGSWWPDWTAWLAGQAGAKRAAPANYG NARYRAIEPAPGRYVKAKA[SEQ.ID.NO.9] CFP10-RV3615C-PhaC-ESAT6(MW:98.1kDa) MAEMKTDAATLAQEAGNFERISGDLKTQIDQVESTAGSLQ CFP10:A2-R20,T27-R57, GQWRGAAGTAAQAAVVRFQEAANKQKQELDEISTNIRQA Q78-R85 GVQYSRADEEQQQALSSQMGFGPGGGGGPMTENLTVQPE RV3615C:T108-R117,I192- RLGVLASHHDNAAVDASSGVEAAAGLGESVAITHGPYCS K202 QFNDTLNVYLTAHNALGSSLHTAGVDLAKSLRIAAKIYSE PhaC:V233-R248,I275-R286, ADEAWRKAIDGLFTTSATGKGAAASTQEGKSQPFKVTPGP D290-R320,F327-R337, FDPATWLEWSRQWQGTEGNGHAAASGIPGLDALAGVKIA F358-R392,I407-R419,Y462- PAQLGDIQQRYMKDFSALWQAMAEGKAEATGPLHDRRF R511,I525-K625,L668-K710, AGDAWRTNLPYRFAAAFYLLNARALTELADAVEADAKT F713-K730,S734-K774, RQRIRFAISQWVDAMSPANFLATNPEAQRLLIESGGESLRA A776-R785 GVRNMMEDLTRGKISQTDESAFEVGRNVAVTEGAVVFEN ESAT6:W877-R893 EYFQLLQYKPLTDKVHARPLLMVPPCINKYYILDLQPESSL VRHVVEQGHTVFLVSWRNPDASMAGSTWDDYIEHAAIRA IEVARDISGQDKINVLGFCVGGTIVSTALAVLAARGEHPAA SVTLLTTLLDFADTGILDVFVDEGHVQLREATLGGGAGAP CALLRGLELANTFSFLRPNDLVWNYVVDNYLKGNTPVPF DLLFWNGDATNLPGPWYCWYLRHTYLQNELKVPGKLTV CGVPVDLASIDVPTYIYGSREDHIVPWTAAYASTALLANK LRFVLGASGHIAGVINPPAKNKRSHWTNDALPESPQQWLA GAIEHHGSWWPDWTAWLAGQAGAKRAAPANYGNARYR AIEPAPGRYVKAKAHMVLAVAIDKRGGGGGLEMTEQQW NFAGIEAAASAIQGNVTSIHSLLDEGKQSLTKLAAAWGGS GSEAYQGVQQKWDATATELNNALQNLARTISEAGQAMA STEGNVTGMFA[SEQ.ID.NO.10]
[0634] Protein degradation was also assessed. As shown in
Assessment of TB Antigen Reactivity In Vitro
[0635] The use of polyester particles displaying one or more TB antigens as TB diagnostic reagents was assessed. ELISA was used to probe the accessibility and structural integrity of TB antigens displayed on the surface of polyester particles in vitro (
[0636] In the reactivity test for the immobilized TB antigens (
[0637] Moreover, the negative control experiment using rabbit pre-immune sera instead of the three specific antibodies showed that all the samples have very low antibody binding to the negative control serum (
Assessment of TB Antigen Reactivity In Vivo
[0638] To test the immunogenicity and specificity of the triple TB antigen displaying particles in vivo, the respective particles were intradermally injected into cattle. Four reagents, particles displaying the triple TB antigens, control particles, PPD-B, and PPD-A were administered for the TB skin tests (
[0639] Responses to a 0.9 g/injection of TB antigen fusion proteins displayed on polyester particles were also positive for all animals and there were no significant differences in the responses between PPD-B and TB polyester particles (P>0.05). Two animals produced a weak response (2.5 mm increase in skin thickness to the control polyester particles. In contrast, when testing these skin test reagents in 14 equivalent-aged cattle, naturally-sensitized to environmental mycobacteria, none responded positively to the TB polyester particle reagents, while 11 responded positively to PPD-A and three to PPD-B. The skin test responses to PPD-Band the triple antigen particles were compared in the cattle experimentally infected with M. bovis. Although all the cattle responded to the two different antigen preparations, there was no correlation between the sizes of these responses for individual animals.
Discussion
[0640] The aim of this study was to produce fusion proteins which mediate formation of polyester particles displaying selected TB antigens (CFP10, ESAT6, Rv3615c) suitable for TB skin test applications. The display of selected TB antigens at the surface of immunogenic polyester particles is anticipated by the applicants to be important for the sensitivity and specificity of the TB skin test.
[0641] As outlined in
[0642] Polyester particle surface display of the respective TB antigen fused to PhaC was investigated by using specific anti-TB antigen antibodies in combination with ELISA (
[0643] The various particles were found to display the respective TB antigen(s). Interestingly, the triple TB antigen displaying particles showed greater reactivity with the specific antibodies when compared with the respective single TB antigen displaying particles. This was not due to varying expression levels as similar amounts of fusion protein were detected per particle mass (
[0644] The polyester particle containing the triple TB antigens was assessed as TB skin test reagent due to its high reactivity with specific antibodies. In addition, the applicants believe, without wishing to be bound by any theory, the manufacture of only one multiple antigen polyester particle type will be a cost-effective strategy preferred to produce several single antigen particles. There is also a demand for a specific diagnostic reagent which distinguishes TB-infected from environmental strain-sensitized or BCG-vaccinated individuals.
[0645] A comparative cervical skin test is used in many countries for the diagnosis of bovine TB as both PPD-A and PPD-B contain antigens common to many environmental mycobacteria and a stronger response to PPD-B compared to that for PPD-A is indicative of infection with M. bovis (Monaghan et a (Monaghan et al, 1994). TB antigens, CFP10, Rv5c, and ESAT6 (27) are found in members of the pathogenic M. tuberculosis complex which includes M. bovis and therefore responses to these antigens would indicate a more specific response compared to that for PPD-B, containing a crude mix of antigens.
[0646] In this TB skin test study (
[0647] On the basis of these results, the applicants believe that CFP10-Rv3615c-ESAT6 immobilized on the surface of polyester particle provides a more sensitive, specific, and cost effectively diagnostic reagent when compared to other tests, including free antigens.
[0648] Applicants further believe, again without wishing to be bound by any theory, that triple TB antigen displaying polyester particles also have utility in the diagnosis of human TB, mainly caused by M. tuberculosis. Indeed, CFP10, ESAT6, and Rv3615c from M. tuberculosis strongly cross-react with the orthologous proteins in M. bovis, a causative agent of bovine TB (Millington et al, 2011; Waters et al, 2004), and these antigens are immunodominant in both active and latent human TB infection (Millington et al, 2011; Sidders et al, 2008).
[0649] This polyester particle TB diagnostic reagent comprising the triple antigens has high specificity and sensitivity, allowing for quick and accurate screening of subjects infected by TB. In addition, the polyester particle based TB skin test has the potential to differentiate between infected and BCG vaccinated subjects
[0650] This example demonstrates that bacterial polyester particles have been prepared to simultaneously display three TB specific antigens and that these recombinant particles show specific and sensitive performance as TB skin test reagents. This improved skin test showed less false positive results in subjects when compared to the commercial skin test reagents and which in turn reduces a significant economic loss for the end-user.
Example 2
Production of Tetravalent Antigen Polymer Particles
[0651] This example describes the preparation of tetravalent polymer particles of the invention comprising 4 TB antigens for use as diagnostic reagents for tuberculosis, including the construction and expression of the plasmid, pET-14b cfp10-linker-rv3615c-phaC-linker-esat6-linker-rv3020c.
Materials and Methods
[0652] The construction of pET-14b cfp10-linker-rv3615c-phaC-linker-esat6-linker-rv3020c is depicted in
[0653] Expression In Vivo
[0654] Plasmid pET-14b cfp10-rv3615c-phaC-esat6-rv3020c was expressed as described above in Example 1. SDS-PAGE analysis of the crude lysate, together with samples taken from various steps in the purification of the polymer particle as previously described (Peters et al, 2008), was performed. Again, MALDI-TOF analysis was used to confirm the presence of each of the various protein components in the expressed fusion polypeptide.
Results
[0655]
[0656] The results of tryptic peptide fingerprinting using MALDI-TOF/MS are shown in Table 5 below. As shown therein, each of the five component proteins comprising the fusion polypeptide CFP10-Rv3615c-PhaC-ESAT6-Rv3020c (SEQ. ID. NO. 22) were identified, as underlined.
TABLE-US-00013 TABLE5 Identifiedpeptidefragmentsofarecombinantfusionproteincontaining fourTBantigensanalyzedbyMALDI-TOF/MS Peptidefragmentsassigned Protein/Proteinsequence tothevariousproteinregions CFP10-Rv3615c-PhaC-ESAT6-Rv3020c(MW:109.4kDa) MAEMKTDAATLAQEAGNFERISGDLKTQIDQVESTA CFP10:T6-R20,T27-R57, GSLQGQWRGAAGTAAQAAVVRFQEAANKQKQELDE A86-P102 ISTNIRQAGVQYSRADEEQQQALSSQMGFGPGGGGG PMTENLTVQPERLGVLASHHDNAAVDASSGVEAAAG Rv3615c:P108-R119,I194-K204 LGESVAITHGPYCSQFNDTLNVYLTAHNALGSSLHTA GVDLAKSLRIAAKIYSEADEAWRKAIDGLFTTS ATGKGAAASTQEGKSQPFKVTPGPFDPATWLEWSRQ PhaC:V233-R248,I275-R286, WQGTEGNGHAAASGIPGLDALAGVKIAPAQLGDIQQ D290-K302,R313-R320, RYMKDFSALWQAMAEGKAEATGPLHDRRFAGDAWR F327-R337,F358-R392,I407- TNLPYRFAAAFYLLNARALTELADAVEADAKTRQRIR R419,Y462-R511,D518-K625, FAISQWVDAMSPANFLATNPEAQRLLIESGGESLRAG L668-K710,A776-R785, VRNMMEDLTRGKISQTDESAFEVGRNVAVTEGAVVF A801-R812 ENEYFQLLQYKPLTDKVHARPLLMVPPCINKYYILDL QPESSLVRHVVEQGHTVFLVSWRNPDASMAGSTWD DYIEHAAIRAIEVARDISGQDKINVLGFCVGGTIVSTAL AVLAARGEHPAASVTLLTTLLDFADTGILDVFVDEGH VQLREATLGGGAGAPCALLRGLELANTFSFLRPNDLV WNYVVDNYLKGNTPVPFDLLFWNGDATNLPGPWYC WYLRHTYLQNELKVPGKLTVCGVPVDLASIDVPTYIY GSREDHIVPWTAAYASTALLANKLRFVLGASGHIAGV INIPPAKNKRSHWTNDALPESPQQWLAGAIEHHGSWW PDWTAWLAGQAGAKRAAPANYGNARYRAIEPAPGR YVKAKAHMVLAVAIDKRGGGGG LEMTEQQWNFAGIEAAASAIQGNVTSIHSLLDEGKQS ESAT6:W877-R893 LTKLAAAWGGSGSEAYQGVQQKWDATATELNNALQ NLARTISEAGQAMASTEGNVTGMFAGGGGG MSLLDAHIPQLIASHTAFAAKAGLMRHTIGQAEQQA Rv3020c:H946-R976 MSAQAFHQGESAAAFQGAHARFVAAAAKVNTLLDI AQANLGEAAGTYVAADAAAASSYTGF[SEQ.ID.NO.22]
Discussion
[0657] This example established that multivalent TB antigen-comprising polymer particles of the invention were able to be successfully prepared by expression of a fusion polypeptide comprising a particle-forming polypeptide fused to 4 different TB antigens. Furthermore, tetravalent particles have been purified for use in the invention.
Example 3
Assessment of Tetravalent PHA Polymer Particles as Diagnostic Reagents
[0658] This example describes the assessment of tetravalent polymer particles of the invention as diagnostic reagents for tuberculosis. The stability and efficacy of the tetravalent TB antigen-comprising polymer particles (TTPP) described in Example 2 above was assessed in bovine TB skin tests.
Materials and Methods
[0659] The materials and methods used in this study were as described in Examples 1 and 2 above, with the addition of the following.
[0660] Intradermal AssaysIn Vivo Study Design
[0661] TTPP compositions prepared for intradermal assessment in the various in vivo studies presented in this Example are outlined in Tables 6-10 below.
TABLE-US-00014 TABLE 6 Compositions for Dose response/Sensitivity assessment Sample code Formulation dose (g antigens) Comments A1 PBS, Dextran 3.00 3 fold dilution series A2 PBS, Dextran 1.00 A3 PBS, Dextran 0.33 A4 PBS, Dextran 0.11 A5 PBS, Dextran 0.04 A6 PBS, Dextran 0.012
TABLE-US-00015 TABLE 7 Compositions for Formulation assessment Sample code Formulation dose (g antigens) Comments C1 PBS, Dextran 3.00 High C2 PBS, Dextran 0.11 Mid C3 PBS, Dextran 0.012 Low C4 2% Ethanol 3.00 High C5 2% Ethanol 0.11 Mid C6 2% Ethanol 0.012 Low C7 10 mM Tris pH 8.5 3.00 High C8 10 mM Tris pH 8.5 0.11 Mid C9 10 mM Tris pH 8.5 0.012 Low
TABLE-US-00016 TABLE 8 Compositions for Stability assessment Storage Sample code Formulation dose (g antigens) temperature B1 PBS, Dextran 3 4 C. B2 PBS, Dextran 3 25 C. B3 PBS, Dextran 3 37 C.
TABLE-US-00017 TABLE 9 Compositions for Particle size assessment Sample code Formulation dose (g antigens) Size B4 2% Ethanol 3 Large B5 2% Ethanol 3 Medium B6 2% Ethanol 3 Small
TABLE-US-00018 TABLE 10 Compositions for Batch variability assessment Sample code Formulation dose (g antigens) Production batch D1 PBS, Dextran 3 DS498 D2 PBS, Dextran 3 DS504 D3 PBS, Dextran 3 DS507 D4 PBS, Dextran 3 DS560 D5 PBS, Dextran 3 DS585 D6 PBS, Dextran 3 DS625?
[0662] Intradermal Administration
[0663] TTPP compositions were administered intradermally according to the following protocol.
[0664] Injections of 0.1 mL were made intradermally. Syringes were calibrated to 0.1 mL and the needle of the syringe was 22-26 gauge and 3-4 mm long. Syringes were kept clean and sterilized. Contamination of the syringe with disinfectants or alcohol, which may interfere with testing, was avoided, and care was taken to prevent contamination of vials.
[0665] Preferred Site of Injection:
[0666] Cattle: Caudal fold for the single intradermal test and the cervical site for the comparative cervical test (CCT);
[0667] Deer: the mid cervical site for both the single and the CCT. When using the cervical sites, care was required to evenly clip hair close to the skin surface (2 mm or less mean length) prior to injecting. The recommended size of the clipped area was 1010 cm for each injection site.
[0668] Test Interpretation:
[0669] The test was read within 72 hours after injection.
[0670] Skin test reactions were classified in accordance with the requirements of the New Zealand Animal Health Board and National Pest Management Strategy for Bovine TB.
Results
[0671] In Vivo Functional Characterisation of Tetravalent Polyester Particles
[0672] Dose Response.
[0673] TTPP were effective in eliciting an immune response at doses as low as 0.11 ug, as shown in Table 11 below and in
TABLE-US-00019 TABLE 11 Dose response/Sensitivity to TTPP Skin thickness (mm) Controls Sub- Bovine Avian Compositions ject (PPDB) (PPDA) BB A1 A2 A3 A4 A5 C6 7258 11 5 8 4.5 8 5 7.5 0.5 1.5 7202 23.5 3 10.5 11 14 11.5 11.5 9.5 9.5 7203 15.5 3.5 10.5 9.5 7.5 8.5 8 5 3 7214 8.5 2.5 14.5 19 12 12 12 8.5 10.5 7225 21 5.5 11 14.5 13.5 15.5 12.5 7 10 7229 14 4.5 10 10 10 9 7.5 6 6 Me- 14.75 4 10.5 10.5 11 10.25 9.75 6.5 7.75 dian
[0674] Formulation.
[0675] TTPP were effective in eliciting an immune response in each of the three formulations (Dextran, Ethanol, Tris) tested, as shown in Table 12 below and in
TABLE-US-00020 TABLE 12 Effect of formulation on immunological response to TTPP Skin thickness (mm) Controls Bovine Avian Compositions Subject (PPDB) (PPDA) C1 C2 C3 C4 C5 C6 C7 C8 C9 7223 21 8.5 18 9 6.5 13.5 11 6.5 13.5 12.5 6.5 7233 27.5 4 24 13 11.5 24.5 11.5 9 22 15.5 11 7201 22.5 5.5 15.5 7.5 6 16 9 5.5 10.5 7.5 6 7238 13 4.5 12.5 9 5 13 3.5 4 13.5 7.5 4 7224 25 3 12.5 13 6 17.5 9 2.5 14.5 5.5 2.5 7218 36 13.5 19.5 18.5 13 16.5 8.5 5 25 6.5 4 Median 23.75 5 16.75 11 6.25 16.25 9 5.25 14 7.5 5
[0676] Stability/Aggregation.
[0677] TTPP were effective in eliciting an immune response even after 6 months storage at 4 C., at 25 C., and at 37 C. (see Table 13 and
TABLE-US-00021 TABLE 13 TTPP Stability/aggregation assessment Skin thickness (mm) Controls Bovine Avian Compositions Subject (PPDB) (PPDA) BB B1 B2 B3 80 um 20 um 16 um 7217 16.5 4.5 8 16 8 11.5 17.5 18 15.5 7205 21.5 5 9.5 16 13 13.5 17.5 5 3.5 7215 19.5 12 12 14 12 13.5 10.5 12.5 17 7208 19.5 7.5 11.5 7.5 7 12.5 8.5 12 14.5 7256 21.5 3.5 13.5 12 15.5 1.5 16 18.5 24 Median 19.5 5 11.5 14 12 12.5 16 12.5 15.5
[0678] Particle Size.
[0679] The efficacy of TTPP present at average particle sizes of 16 um to 80 um in different compositions was assessed herein, as shown in
[0680] Batch Variability.
[0681] The immunological efficacy of TTPP was very consistent and showed little batch-to-batch variation, as shown in Table 14 below and in
TABLE-US-00022 TABLE 14 TTPP batch variability Skin thickness (mm) Controls Bovine Avian Compositions Subject (PPDB) (PPDA) D1 D2 D3 D4 D5 D6 7234 21 4.5 16.5 13.5 16.5 13.5 14.5 15.5 7244 23 7.5 15 14.5 13.5 14 17 22 7220 22 7.5 6.5 6 5.5 6 4 4.5 7240 25.5 5 22.5 18 22 19.5 19.5 21 7222 16.5 5 15 10.5 12 14.5 15 19 7263 26.5 7 20 17.5 19.5 22 21.5 20.5 Median 22.5 6 15.75 14 15 14.25 16 19.75
Discussion
[0682] This example established that tetravalent TB antigen-comprising polymer particles of the invention were effective in eliciting diagnostically informative skin responses in animals when present in compositions of various formulations, at very low doses, and that efficacy was largely unaffected by particle size or aggregation, or production batch.
Example 4
Assessment of Tetravalent PHA Polymer Particles as Diagnostic Reagents
[0683] This example describes further assessment of TTPP of the invention as diagnostic reagents for tuberculosis. The sensitivity and selectivity of the TTPP of the invention was assessed in bovine interferon-gamma assays.
Materials and Methods
[0684] The materials and methods used in this study were as described in Example 3 above, with the addition of the following.
[0685] Lipopolysaccharide-free E. coli (ClearColi, Lucigen) was used as an additional production host for the preparation of TTPP.
[0686] Assessment of TB Antigen ReactivityIFN- Assays.
[0687] To test the sensitivity and specificity of the TTPP, blood samples were obtained from TB-infected and non-infected cattle, and assayed using IFN- specific ELISA in multiwell plates and absorbance measured at 450 nm.
[0688] The following reagents were assayed: various dilutions of compositions comprising TTPP expressed in LPS+ and LPS-free E. coli (undiluted, 1/4, 1/16, 1/64, and 1/256 dilutions, providing 0.38 g, 0.1 g, 25 ng, 6 ng, and 1.5 ng total antigen in-well, respectively), PhaC-only control particles ( dilution, providing the same amount of PhaC protein in-well as undiluted tetravalent polymer particles), soluble ESAT6/CFP10 peptide (4 g protein in-well), PPDB (20 g protein in-well), PPDA (20 g protein in-well), and a PBS buffer-only control, were assayed.
[0689] Blood Sample Preparation and IFN- Assay
[0690] The IFN- assays used in this example were conducted using sterile consumables under aseptic conditions, on unrefrigerated blood samples, as follows. [0691] 1. Mix blood gently by inversion 10 times. [0692] 2. Add 1 ml of fresh blood (<6 h post collection) to sterile 48 well plate. [0693] 3. Add 700 of tetravalent TB-antigen particles (6 ng total antigens per mL, or if a 4-fold dilution is used 1.5 ng/mL), or controls (PBS, dH.sub.2O, PPDA, PPDB, etc). [0694] 4. Incubate at 37 C. for 20 hours in humidified air with 5% CO.sub.2. [0695] 5. Centrifuge and collect plasma. [0696] 6. Measure IFN- levels using a sandwich ELISA kit (Bovigam (Prionics AG)).
Results
[0697] As can be seen in Table 15 below and in
TABLE-US-00023 TABLE 15 Tetravalent TB antigen-comprising particles - IFN- assays. Controls Absorbance (450 nm) Group Animal PBS PPDA PPDB ESAT6/CFP10 PhaC () infected 7202 0.007 0.357 0.668 0.454 0.404 7203 0.004 0.295 0.660 0.428 0.080 7205 0.019 1.155 2.620 2.034 1.183 7208 0.029 1.169 3.099 2.465 0.251 7214 0.009 3.385 2.788 2.086 0.601 7215 0.017 1.593 0.895 0.249 0.110 7217 0.005 0.641 1.949 1.465 0.300 7225 0.015 0.573 1.739 1.738 1.061 7229 0.185 1.859 1.468 1.419 0.997 7256 0.837 2.628 3.930 3.957 3.129 7258 0.631 3.218 3.773 3.554 0.774 non infected 1 891 0.016 1.012 0.220 0.065 0.283 2 227 0.010 0.242 0.031 0.016 0.161 3 424 0.005 0.092 0.031 0.009 0.230 4 422 0.011 0.119 0.041 0.007 0.145 5 156 0.003 0.700 0.159 0.073 0.775 6 115 0.006 0.024 0.015 0.010 0.063 7 904 0.009 0.050 0.023 0.008 0.055 8 909 0.006 0.052 0.035 0.013 0.083 9 425 0.006 0.007 0.007 0.005 0.030 10 291 0.005 0.021 0.009 0.004 0.025 Tetravalent Absorbance (450 nm) particles LPS + LPS + LPS + LPS + LPS LPS LPS LPS Group Animal LPS + 1 1/16 1/64 1/256 LPS 1 1/16 1/64 1/256 infected 7202 1.620 1.546 1.173 0.705 0.424 1.990 1.917 1.415 1.112 0.491 7203 1.110 1.134 0.987 0.568 0.441 1.068 0.961 1.022 0.897 0.558 7205 3.349 3.361 2.979 2.406 1.592 3.398 3.148 2.749 2.968 1.585 7208 3.365 3.742 3.359 2.873 1.740 3.675 3.784 3.675 3.601 3.011 7214 3.958 3.793 3.851 3.314 2.911 3.650 3.617 3.055 3.234 2.753 7215 0.259 0.306 0.312 0.268 0.137 1.474 0.468 0.365 0.337 0.241 7217 3.053 3.579 2.986 1.664 1.086 3.805 3.710 2.441 3.957 2.138 7225 2.582 2.790 2.538 1.959 1.353 3.122 2.729 2.092 2.426 1.689 7229 1.288 1.763 2.038 1.364 0.814 1.029 0.778 1.298 1.908 1.647 7256 3.467 3.659 3.709 3.560 2.956 3.874 3.808 3.846 3.890 3.818 7258 2.884 2.890 3.313 2.800 2.451 3.655 3.648 3.609 3.720 3.619 non infected 1 891 0.191 0.224 0.140 0.090 0.044 0.450 0.209 0.225 0.183 0.085 2 227 0.121 0.117 0.051 0.029 0.023 0.206 0.135 0.087 0.081 0.043 3 424 0.127 0.130 0.084 0.034 0.011 0.929 0.515 0.254 0.251 0.099 4 422 0.072 0.048 0.027 0.017 0.013 0.047 0.032 0.022 0.010 0.003 5 156 0.638 0.609 0.386 0.139 0.071 1.063 0.512 0.275 0.228 0.092 6 115 0.053 0.122 0.124 0.052 0.011 0.140 0.064 0.072 0.099 0.054 7 904 0.035 0.029 0.022 0.015 0.019 0.096 0.040 0.020 0.017 0.014 8 909 0.066 0.052 0.035 0.018 0.011 0.092 0.050 0.026 0.012 0.012 9 425 0.019 0.021 0.009 0.006 0.005 0.027 0.003 0.010 0.007 0.006 10 291 0.017 0.022 0.014 0.005 0.004 0.049 0.018 0.009 0.006 0.003
Discussion
[0698] This example established that TTPP of the invention were highly sensitive in IFN- blood assays, eliciting diagnostically informative responses in samples from infected animals when present at extremely low concentrations (6 ng and 1.5 ng total antigen), and highly specific with no to little responses in samples from non-infected animals.
[0699] The tetravalent particles of the invention were diagnostically informative at concentrations orders of magnitude lower than control reagents, such as PPDA and PPDB.
Example 5
Assessment of Tetravalent PHA Polymer ParticlesSensitisation Trial
[0700] This example describes a study testing sensitisation to TTPP of the invention.
Materials and Methods
[0701] A sensitisation study of guinea pigs after injection with TTPP (DS498)) was conducted according to the EU Pharmacopeia method. A test group of immunised animals were intradermally injected with tetravalent polymer particles providing 3 g total antigen (0.1 mL) on days zero, day 5 and day 10. The immunised test group and a control group were then intradermally injected with tetravalent polymer particles providing 3 g total antigen (0.1 mL) on days 25 to 31. All animals were observed for erythema and induration at 24 hours post injection.
Results
[0702] No differences between controlled and immunised animals were observed, showing that immunization with tetravalent polymer particles (3 ug of total antigen) and subsequent skin testing showed that the guinea pigs did not become sensitised. This means that the animals did show immune reactions when injected with the tetravalent polymer particles more than once. Swellings were noticed at the injection sites; however, the absence of sensitisation shows that the tetravalent polymer particles of the invention do not produce a memory immune response which would interefere with a repeated testing regime.
Example 6
Assessment of Tetravalent PHA Polymer ParticlesField Trial
[0703] This example describes the assessment of tetravalent polymer particles of the invention as diagnostic reagents for tuberculosis. The specificity of the TTPP described in Example 2 above was assessed in large scale field trials in bovine and cervine using skin test assays.
Materials and Methods The materials and methods used in this study were as described in Examples 1 and 2 above, with the addition of the following.
[0704] Field Trial
[0705] 4628 cattle and 4265 deer were administered TTPP and a commercially available TB skin test reagent by intradermal administration, as follows.
[0706] Intradermal Administration
[0707] The commercially available TB skin test was administered according to the manufacturer's instructions. TTPP compositions were administered intradermally according to the following protocol.
[0708] Injections of 0.1 mL (3 g of total antigen) were made intradermally. Syringes were calibrated to 0.1 mL and the needle of the syringe was 22-26 gauge and 3-4 mm long. Syringes were kept clean and sterilized. Contamination of the syringe with disinfectants or alcohol, which may interfere with testing, was avoided, and care was taken to prevent contamination of vials.
[0709] Preferred Site of Injection:
[0710] Cattle: Caudal fold for the single intradermal test and the cervical site for the comparative cervical test (CCT);
[0711] Deer: the mid cervical site for both the single and the CCT. When using the cervical sites, care was required to evenly clip hair close to the skin surface (2 mm or less mean length) prior to injecting. The recommended size of the clipped area was 1010 cm for each injection site.
[0712] Test Interpretation:
[0713] Skin thickness was measured 72 hours after injection.
[0714] Skin test reactions were classified in accordance with the requirements of the New Zealand Animal Health Board and National Pest Management Strategy for Bovine TB.
[0715] Positive reactors were verified by IFN- assay, culture, and PCR assays.
Results
[0716] Deer. The 4265 animals were assigned an ID value from 1 to 4265. 63 animals were identified as being positive for TB using the commercially available TB skin test (Observe), while 18 animals were identified as positive to TB using the TTPP of the invention. [0717] Observe: observe result with value 1 (n=63) and 0 (n=4202) [0718] TTPP:TTPP result with value 1 (n=18) and 0 (n=4247).
TABLE-US-00024 TABLE 16 Paired T-Test and CI: b_TB, Observe - Deer N Mean StDev SE Mean TTPP 4265 0.00422 0.06483 0.00099 Observe 4265 0.01477 0.12065 0.00185 Difference 4265 0.01055 0.10668 0.00163
[0719] 95% CI for mean difference: (0.01375, 0.00735)
[0720] T-Test of mean difference=0 (vs0): T-Value=6.46
[0721] P-Value=0.000
Post Hoc Power of the Paired t Test
[0722] Testing mean paired difference=0 (versus0)
[0723] Calculating power for mean paired difference=difference
[0724] =0.05 Assumed standard deviation of paired differences=0.107
[0725] The difference of 0.01 for the sample size of 4265 gives a power for the above test of 0.999983.
[0726] Cattle. The 4628 animals were assigned an ID value from 1 to 4628. 76 animals were identified as being positive for TB using the Observe test, while 3 animals were identified as positive to TB using the TTPP of the invention. [0727] Observe: observe result with value 1 (n=76) and 0 (n=4552) [0728] TTPP: TTPP result with value 1 (n=3) and 0 (n=4625).
TABLE-US-00025 TABLE 17 Paired T-Test and CI: b_TB, Observe - Cattle N Mean StDev SE Mean TTPP 4628 0.00065 0.02545 0.00037 Observe 4628 0.01642 0.12710 0.00187 Difference 4628 0.01577 0.12803 0.00188
[0729] 95% CI for mean difference: (0.01946, 0.01208)
[0730] T-Test of mean difference=0 (vs0): T-Value=8.38
[0731] P-Value=0.000
Post Hoc Power of the Paired t Test
[0732] Testing mean paired difference=0 (versus0)
[0733] Calculating power for mean paired difference=difference
[0734] =0.05 Assumed standard deviation of paired differences=0.128
[0735] The difference of 0.016 for the sample size of 4628 gives a power for the above test of 1.0.
Discussion
[0736] The highly statistically significant results presented in this example established that diagnostic assays using TTPP of the invention were highly specific, eliciting accurate diagnostic information and able to discern false positives identified using art standard methods.
[0737] Furthermore, the assays presented in Examples 3-6 established that TTPP of the invention were diagnostically informative even at amounts that provided very low total doses of the TB antigens, showing that the TTPP of the invention are highly sensitive, in addition to being highly selective.
INDUSTRIAL APPLICATION
[0738] Aspects of the invention described herein, including methods, polymer particles and fusion proteins have utility in the diagnosis, therapy and prevention of tuberculosis.
[0739] Those persons skilled in the art will understand that the above description is provided by way of illustration only and that the invention is not limited thereto.
PUBLICATIONS
[0740] Amara A A, Rehm B H A. 2003. Replacement of the catalytic nucleophile 533 cysteine-296 by serine in class II polyhydroxyalkanoate synthase from Pseudomonas 534 aeruginosa-mediated synthesis of a new polyester: identification of catalytic residues. 535 Biochem. J. 374:413-421. [0741] Anderson, P. Tuberculosis vaccinesan update Nature (2007) 5: 484-487 [0742] Barnard et al. High level recombinant protein expression in Ralstonia eutropha using T7 RNA polymerase based amplification Protein Expr Puri (2004) 38: 264-71 [0743] Barnes and Cave Current concepts:molecular epidemiology of tuberculosis New England Journal of Medicine (2003) 349: 1149-1156 [0744] Beach, D. and Nurse. P. High-frequency transformation of the fission yeast Schizosaccharomyces pombe Nature 290: 140-1421981 [0745] Belisle, J. T. et al. Tuberculosis and the Tubercle Bacillus ASM Press, Washington D.C. (2005) [0746] Bowie, J. U. et al Deciphering the message in protein sequences: tolerance to amino acid substitutions Science (1990) 247: 1306-1310 [0747] Brockelbank J. A. et al. Recombinant Escherichia coli Strain Produces a ZZ Domain Displaying Biopolyester Granules Suitable for Immunoglobulin G Purification Applied and Environmental Microbiology (2006) 72: 7394-7397 [0748] Brunschwig, E and Darzins, A. A two-component T7 system for the overexpression of genes in Pseudomonas aeruginosa Gene (1992) 111: 35-41 [0749] Buddle B M, Keen D, Thomson A, Jowett G, McCarthy A R, Heslop J, Delisle G W, Stanford J L, Aldwell F E. 1995. Protection of cattle from bovin tuberculosis by vaccination with BCG by the respiratory or subcutaneous route, but not by vaccination with killed Mycobacterium-vaccae Res. Vet. Sci. 59:10-16. [0750] Buddle B M, Livingstone P G, Lisle G Wd. 2009. Advances in ante-mortem diagnosis of tuberculosis in cattle. New Zealand Veterinary Journal 57:173-180. [0751] Buddle B M, Parlane N A, Keen D L, Aldwell F E, Pollock J M, LighTBody K, Andersen P. 1999. Differentiation between Mycobacterium bovis BCG-vaccinated and M-bovis-infected cattle by using recombinant mycobacterial antigens. Clinical and Diagnostic Laboratory Immunology 6:1-5. [0752] Casal C, Bezos J, Diez-Guerrier A, Alvarez J, Romero B, de Juan L, 449 Rodriguez-Campos S, Vordermeier M, Whelan A, Hewinson R G, Mateos A, 450 Dominguez L, Aranaz A. 2012. Evaluation of two cocktails containing ESAT-6, 451 CFP-10 and Rv-3615c in the intradermal test and the interferon-gamma assay for 452 diagnosis of bovine tuberculosis. Prev. Vet. Med. 105:149- [0753] Case et al., Proceedings of the National Academy of Science USA (1979) 76: 5259-5263 [0754] Chang et al., Nature, 275: 615 (1978) [0755] DeBoer et al., The tac promoter: a functional hybrid derived from the trp lac promoters Proceedings of the National Academy of Science USA (1983) 80: 21-25 [0756] Fleer, R. et al., Stable multicopy vectors for high-level secretion of recombinant human serum albumin in Kluyveromyces yeasts Bio/Technology 9: 968-975 [0757] Friehs & Reardon Parameters Influencing the Productivity of Recombinant E. coli Cultivations. Advances in Biochemical Engineering Technology Vol 48 Springer Verlag (1991) [0758] Goeddel, D. V. et al. Direct expression in Escherichia coli of a DNA sequence coding for human growth hormone (1979) Nature 281: 544-548 [0759] Goeddel, D. V. Synthesis of human fibroblast interferon by E. coli Nucleic Acids Research (1980) 8: 4057-4074 [0760] Hess, B. et al. Cooperation of glycolytic enzymes Advances in Enzyme Regulation (1968) 7: 149-167. [0761] Hitzeman et al., J. Biol. Chem., 255:2073 (1980)] [0762] Holland, M. J. and Holland, J. P. Isolation and identification of yeast messenger ribonucleic acids coding for enolase, glyceraldehyde-3-phosphate dehydrogenase, and phosphoglycerate kinase Biochemistry (1978) 17: 4900-4907 [0763] Huang, X. On global sequence alignment Computer Application in the Biosciences (1994) 10: 227-235 [0764] Jahns A C, Rehm B H A. 2009. Tolerance of the Ralstonia eutropha Class I polyhydroxyalkanoate synthase for translational fusions to its C terminus reveals a new mode of functional display. Appl. Environ. Microbiol. 75:5461-5466. [0765] Kelly, J. M. and Hynes, M. J. Transformation of Aspergillus niger by the amdS 22 gene of Aspergillus nidulans EMBO Journal (1985) 4:475-479 [0766] Kingsman, A. J. et al., Replication in Saccharomyces cerevisiae of plasmid pBR313 carrying DNA from the yeast trp1 region Gene (1979) 7:141-152 [0767] Louvencourt et al. Transformation of Kluyveromyces lactis by killer plasmid DNA Journal of Bacteriology (1983)154: 737-742 [0768] Madison, L. L. et al, Metabolic Engineering of Poly(3-hydroxyalkanoates): From DNA to Plastic, Microbiology and Molecular Biology Reviews (1999) 63: 21-53 [0769] Mather, J. P. Establishment and characterization of two distinct mouse testicular epithelial cell lines Biology of Reproduction (1980) 23: 243-251 [0770] Mather, J. P. et al. Culture of Testicular Cells in Hormone-Supplemented Serum-Free Medium Annals of the N.Y. Academy of Science (1982) 383:44-68 [0771] Millington K A, Fortune S M, Low J, Garces A, Hingley-Wilson S M, Wickremasinghe M, Kon O M, Lalvani A. 2011. Rv3615c is a highly immunodominant RD1 (Region of Difference 1)-dependent secreted antigen specific for Mycobacterium tuberculosis infection. Proceedings of the National Academy of Sciences of the United States of America 108:5730-5735. [0772] Monaghan M L, Doherty M L, Collins J D, Kazda J F, Quinn P J. 1994. The tuberculin test Veterinary Microbiology 40:111-124. [0773] Mustafa, A. S. Biotechnology in the development of new vaccines and diagnostic reagents against tuberculosis Current Pharmaceutical Biotechnology (2001) 2: 157-173 [0774] Parlane N A, Wedlock D N, Buddle B M, Rehm B H A. 2009. Bacterial polyester inclusions engineered to display vaccine candidate antigens for use as a novel class of safe and efficient vaccine delivery agents. Appl. Environ. Microbiol. 503 75:7739-7744. [0775] Peters, V. and Rehm, B. H. A. In vivo enzyme immobilization by use of engineered polyhydroxyalkanoate synthase Applied and Environmental Microbiology (2006) 72: 1777-83 [0776] Peters V, Rehm B H A. 2008. Protein engineering of streptavidin for in vivo assembly of streptavidin beads. Journal of Biotechnology 134:266-274 [0777] Rehm, B. H. A. Polyester synthesis; natural catalysts for plastics Biochemical Journal (2003) 376: 15-33 [0778] Rehm, B. H. A. Biopolyester particles produced by microbes or using polyester synthases: self assembly and potential applications Microbial Biotechnology: biological self-assembly systems and biopolymer-based nanostructures Horizon Bioscience (2006) [0779] Sambrook, et al Molecular Cloning; a Laboratory Manual (2.sup.nd ed) Cold Spring Harbor Press (1987) [0780] Sambrook J. Fritsch E F, Maniatis T. 1989. Molecular cloning: a laboratory manual. Cold Spring Harbor
[0781] Laboratory Press, New York, USA. [0782] Sidders B, Pirson C, Hogarth P J, Hewinson R G, Stoker N G, Vordermeier H M, Ewer K. 2008. Screening of highly expressed mycobacterial genes identifies Rv3615c as a useful differential diagnostic antigen for the Mycobacterium tuberculosis complex. Infectin and Immunity 76:3932-3939. [0783] Spiekermann P, Rehm B H A, Kalscheuer R, Baumeister D, Steinbuchel A. 1999. A sensitive, viable-colony staining method using Nile red for direct screening of bacteria that accumulate polyhydroxyalkanoic acids and other lipid storage compounds. Arch. Microbiol. 171:73-80. [0784] Sreekrishna K et al. High level expression of heterologous proteins in methylotropic yeast Pichia pastoris Journal of Basic Microbiology (1988) 28: 265-278 [0785] Stinchcomb, D. T. et al. Isolation and characterisation of a yeast chromosomal replicator Nature (1979) 282: 39-43 [0786] Tilburn, J. et al. Transformation by integration in Aspergillus nidulans Gene (1983) 26: 205-221 [0787] Tschemper, G and Carbon, J. Sequence of a yeast DNA fragment containing a chromosomal replicator and the TRP1 gene Gene (1980) 10:157-166 [0788] Urlaub, G. and Chasin, L. A. Isolation of Chinese hamster cell mutants deficient in dihydrofolate reductase activity Proceedings of the National Academy of Science USA (1980) 77:4216-4220. [0789] Van den Berg, G. et al. Kluyveromyces as a host for heterologous gene expression: expression and secretion of prochymosin Bio/Technology (1990) 8: 135-139. [0790] Vordermeier H M, Whelan A, Cockle P J, Farrant L, Palmer N, Hewinson R G. 2001. Use of synthetic peptides derived from the antigens ESAT-6 and CFP-10 for differential diagnosis of bovine tuberculosis in cattle. Clinical and Diagnostic Laboratory Immunology 8:571-578.526 [0791] Waters W R, Nonnecke B J, Palmer M V, Robbe-Austermann S, Bannantine J P, Stabel J R, Whipple D L, Payeur J B, Estes D M, Pitzer J E, Minion F C. 2004. Use of recombinant ESAT-6: CFP-10 fusion protein for differentiation of infections of cattle by Mycobacterium bovis and by M. avium subsp aviumand M. avium subsp paratuberculosis. Clinical and Diagnostic Laboratory Immunology 11:729-735. [0792] Whelan A O, Clifford D, Upadhyay B, Breadon E L, McNair J, Hewinson G R, 445 Vordermeier M H. 2010. Development of a skin test for bovine tuberculosis for differentiating infected from vaccinated animals. Journal of Clinical Microbiology 48:3176-3181. [0793] Yelton, M. M. et al. Transformation of Aspergillus nidulans by using a trpC plasmid Proceedings of the National Academy of Science USA (1984) 81: 1470-1474
[0794] All patents, publications, scientific articles, web sites, and other documents and materials referenced or mentioned herein are indicative of the levels of skill of those skilled in the art to which the invention pertains, and each such referenced document and material is hereby incorporated by reference to the same extent as if it had been incorporated by reference in its entirety individually or set forth herein in its entirety. Applicants reserve the right to physically incorporate into this specification any and all materials and information from any such patents, publications, scientific articles, web sites, electronically available information, and other referenced materials or documents.
[0795] The written description portion of this patent includes all claims. Furthermore, all claims, including all original claims as well as all claims from any and all priority documents, are hereby incorporated by reference in their entirety into the written description portion of the specification, and Applicants reserve the right to physically incorporate into the written description or any other portion of the application, any and all such claims. Thus, for example, under no circumstances may the patent be interpreted as allegedly not providing a written description for a claim on the assertion that the precise wording of the claim is not set forth in haec verba in written description portion of the patent.
[0796] All of the features disclosed in this specification may be combined in any combination. Thus, unless expressly stated otherwise, each feature disclosed is only an example of a generic series of equivalent or similar features.
[0797] It is to be understood that while the invention has been described in conjunction with the detailed description thereof, the foregoing description is intended to illustrate and not limit the scope of the invention, which is defined by the scope of the appended claims. Thus, from the foregoing, it will be appreciated that, although specific nonlimiting embodiments of the invention have been described herein for the purpose of illustration, various modifications may be made without deviating from the spirit and scope of the invention. Other aspects, advantages, and modifications are within the scope of the following claims and the present invention is not limited except as by the appended claims.
[0798] The specific methods and compositions described herein are representative of preferred nonlimiting embodiments and are exemplary and not intended as limitations on the scope of the invention. Other objects, aspects, and embodiments will occur to those skilled in the art upon consideration of this specification, and are encompassed within the spirit of the invention as defined by the scope of the claims. It will be readily apparent to one skilled in the art that varying substitutions and modifications may be made to the invention disclosed herein without departing from the scope and spirit of the invention. The invention illustratively described herein suitably may be practiced in the absence of any element or elements, or limitation or limitations, which is not specifically disclosed herein as essential. Thus, for example, in each instance herein, in nonlimiting embodiments or examples of the present invention, the terms comprising, including, containing, etc. are to be read expansively and without limitation. The methods and processes illustratively described herein suitably may be practiced in differing orders of steps, and that they are not necessarily restricted to the orders of steps indicated herein or in the claims.
[0799] The terms and expressions that have been employed are used as terms of description and not of limitation, and there is no intent in the use of such terms and expressions to exclude any equivalent of the features shown and described or portions thereof, but it is recognized that various modifications are possible within the scope of the invention as claimed. Thus, it will be understood that although the present invention has been specifically disclosed by various nonlimiting embodiments and/or preferred nonlimiting embodiments and optional features, any and all modifications and variations of the concepts herein disclosed that may be resorted to by those skilled in the art are considered to be within the scope of this invention as defined by the appended claims.
[0800] The invention has been described broadly and generically herein. Each of the narrower species and subgeneric groupings falling within the generic disclosure also form part of the invention. This includes the generic description of the invention with a proviso or negative limitation removing any subject matter from the genus, regardless of whether or not the excised material is specifically recited herein.
[0801] It is also to be understood that as used herein and in the appended claims, the singular forms a, an, and the include plural reference unless the context clearly dictates otherwise, the term X and/or Y means X or Y or both X and Y, and the letter s following a noun designates both the plural and singular forms of that noun. In addition, where features or aspects of the invention are described in terms of Markush groups, it is intended, and those skilled in the art will recognize, that the invention embraces and is also thereby described in terms of any individual member and any subgroup of members of the Markush group, and applicants reserve the right to revise the application or claims to refer specifically to any individual member or any subgroup of members of the Markush group.