Capping prone RNA polymerase enzymes and their applications

09540671 ยท 2017-01-10

Assignee

Inventors

Cpc classification

International classification

Abstract

The invention provides a chimeric enzyme comprising at least one catalytic domain of a RNA triphosphatase, at least one catalytic domain of a guanylyltransferase, at least one catalytic domain of a N.sup.7-guanine methyltransferase, and at least one catalytic domain of a DNA-dependant RNA polymerase. The invention also provides pharmaceutical composition comprising said chimeric enzyme and uses of said chimeric enzyme.

Claims

1. A hetero-oligomeric enzyme comprising: a catalytic domain of a RNA triphosphatase; a catalytic domain of a guanylyltransferase; a catalytic domain of a N7-guanine methyltransferase; and a catalytic domain of a DNA-dependent RNA polymerase, wherein the catalytic domain of a DNA-dependent RNA polymerase is linked covalently or non-covalently with the catalytic domain of a RNA triphosphatase, the catalytic domain of a guanylyltransferase, or the catalytic domain of a N7-guanine methyltransferase, and wherein the hetero-oligomeric enzyme is non-natural.

2. The hetero-oligomeric enzyme according to claim 1, wherein the catalytic domain of a N7-guanine methyltransferase and the catalytic domain of a DNA-dependent RNA polymerase are included in a monomer.

3. The hetero-oligomeric enzyme according to claim 1, wherein the catalytic domain of a RNA triphosphatase and the catalytic domain of a guanylyltransferase are included in a monomer.

4. The hetero-oligomeric enzyme according to claim 1, wherein the catalytic domain of a RNA triphosphatase, the catalytic domain of a guanylyltransferase and the catalytic domain of a DNA-dependent RNA polymerase are included in a monomer.

5. The hetero-oligomeric enzyme according to claim 1, further comprising a domain that enhances the activity of at least one catalytic domain of the hetero-oligomeric enzyme.

6. The hetero-oligomeric enzyme according to claim 1, wherein at least one of the catalytic domain of a N7-guanine methyltransferase, the catalytic domain of a RNA triphosphatase and the catalytic domain of a guanylyltransferase is a catalytic domain of the vaccinia mRNA capping enzyme.

7. The hetero-oligomeric enzyme according to claim 1, comprising: a first monomer comprising a catalytic domain of a N7-guanine methyltransferase and a catalytic domain of a DNA-dependent RNA polymerase, and a second monomer comprising a catalytic domain of a RNA triphosphatase and a catalytic domain of a guanylyltransferase, wherein the catalytic domain of a N7-guanine methyltransferase is a catalytic domain of the vaccinia mRNA capping enzyme encoded by the vaccinia virus D1R gene, and the catalytic domain of a RNA triphosphatase and the catalytic domain of a guanylyltransferase are catalytic domains of the vaccinia mRNA capping enzyme encoded by the vaccinia virus D1R gene, and wherein the hetero-oligomeric enzyme further comprises a 31-kDa subunit encoded by the vaccinia virus D12L gene.

8. The hetero-oligomeric enzyme according to claim 1, comprising: a first monomer comprising a catalytic domain of a N7-guanine methyltransferase, and a second monomer comprising a catalytic domain of a RNA triphosphatase, a catalytic domain of a guanylyltransferase, and a catalytic domain of a DNA-dependent RNA polymerase, wherein the catalytic domain of a N7-guanine methyltransferase is a catalytic domain of the vaccinia mRNA capping enzyme encoded by the vaccinia virus D1R gene, and the catalytic domain of a RNA triphosphatase and the catalytic domain of a guanylyltransferase are catalytic domains of the vaccinia mRNA capping enzyme encoded by the vaccinia virus D1R gene, and wherein the hetero-oligomeric enzyme further comprises a 31-kDa subunit encoded by the vaccinia virus D12L gene.

9. A method for producing an RNA molecule with a 5-terminal m.sup.7GpppN cap, comprising contacting a DNA sequence encoding the RNA molecule with the hetero-oligomeric enzyme according to claim 1, wherein the DNA sequence is operatively linked to a promoter for the catalytic domain of a DNA-dependent RNA polymerase.

10. A hetero-oligomeric enzyme comprising: a monomer comprising a catalytic domain of a RNA triphosphatase, a catalytic domain of a guanylyltransferase, and a catalytic domain of a N7-guanine methyltransferase; and a complex comprising a catalytic domain of a DNA-dependent RNA polymerase, wherein the monomer and the complex are linked covalently or non-covalently, and wherein the hetero-oligomeric enzyme is non-natural.

11. The hetero-oligomeric enzyme according to claim 10, comprising a complex comprising a catalytic domain of a bacterial DNA-dependent RNA polymerase.

12. The hetero-oligomeric enzyme according to claim 10, comprising a complex comprising a catalytic domain of the DNA-dependent RNA polymerase of Escherichia coli.

13. A method for producing an RNA molecule with a 5-terminal m.sup.7GpppN cap, comprising contacting a DNA sequence encoding the RNA molecule with the hetero-oligomeric enzyme according to claim 10, wherein the DNA sequence is operatively linked to a promoter for the catalytic domain of a DNA-dependent RNA polymerase.

Description

BRIEF DESCRIPTION OF DRAWINGS

(1) FIG. 1 represents a firefly luciferase gene reporter expression assay, which was used to monitor the translation yields triggered by a chimeric enzyme according to the invention the NP868R-T7RNAP. The pNP868R-T7RNAP or the pT7RNAP plasmids were co-transfected with the pT7p-Luciferase plasmid in the human HEK-293 cultured cells. The expression of NP868R-T7RNAP and T7RNAP enzymes is driven by the RNA polymerase II-dependent CMV promoter of the corresponding plasmids. The NP868R-T7RNAP and T7RNAP enzymes, in turn, are expected to initiate transcription at the T7 promoter of the pT7p-Luciferase gene reporter plasmid. If both the mRNA capping and DNA-dependent RNAP enzymatic activities of the NP868R-T7RNAP enzymes are retained, luciferase mRNA having a m.sup.7GpppGm cap structures are to be synthesized, which can be translated into firefly luciferase protein and detected by cell luminescence assay. In contrast, the T7RNAP enzyme is expected to synthesize RNA molecules without 5-terminal m.sup.7GpppN cap, which are therefore poorly translated.

(2) FIG. 2 (A-B) represents the physical maps of the pNP868R-T7RNAP and pT7RNAP plasmids. Physical maps of (A) pT7RNAP plasmid, which encodes for the wild-type phage DNA-dependent T7 RNA polymerase, (B) pNP868R-T7RNAP plasmids, which encodes for a fusion between the NP868R mRNA capping enzymes (African Swine Fever Virus) and the wild-type phage DNA-dependent T7 RNA polymerase (bacteriophage T7), via a flexible (Gly.sub.3Ser).sub.4 linker. These two plasmids have the same design: CMV promoter, Kozak sequence followed by the NP868R-T7RNAP or T7RNAP open-reading frames (ORFs), poly[A]-track, T terminator for phage RNA polymerase transcription, and SV40 polyadenylation signal.

(3) FIG. 3 (A-C) represents the physical maps of the firefly luciferase gene reporter plasmids. (A) pT7p-Luciferase: was designed to assay the activity of the NP868R-T7RNAP and the T7RNAP enzymes. It consist of an array of RNA polymerase promoters (T7, T3 and SP6 phage RNAP promoters, followed by the E. coli ribosomal rrnD1 promoter), a Lac operator sequence, the entire ORF of the firefly luciferase, a poly[A]-track, a hepatitis-D ribozyme encoding sequence for RNA auto-cleavage and the T terminator in pET-22b(+) backbone, (B) BamHI-digested pT7p-Luciferase: in which the physical connection between the luciferase ORF and the promoter array is disrupted by the restriction enzyme digestion. This plasmid is used as a negative control. Arrows indicate the sites of digestion. (C) pCMV-Luciferase: in which the entire ORF of the firefly luciferase is under control of the CMV promoter. This plasmid is used as a positive comparator.

(4) FIG. 4 (A-C) shows the Firefly luciferase gene reporter expression after plasmid transfection in HEK-293 cells. HEK-293 cells were cultured and transfected as described above. Cells were transfected with either the pNP868R-T7RNAP or the pT7RNAP plasmids (0.4 g DNA/well and 1 L/well Lipofectamine 2000), and/or the pT7p-Luciferase, BamHI-digested pT7p-Luciferase, or pCMV-T7RNAP (0.4 g DNA/well and 1 L/well Lipofectamine 2000), or none. The firefly luciferase luminescence was assayed at selected time points using the Luciferase Assay System (Promega, Madison Wis. USA). To normalize for transfection efficiency, cells were also transfected with the pORF-eSEAP plasmid, which encodes for the secreted placental alkaline phosphatase (SEAP) that was assayed in cell culture medium using the Quanti-Blue colorimetric enzyme assay kit (InvivoGen, San Diego, Calif.). Gene reporter expression was expressed as the luciferase luminescence in studied cells subtracted for luminescence in cells treated with the transfection reagent only (RLU; relative light units), then divided by SEAP absorbance (OD, optic density) ratio. Two independent repetitions of this experiment were performed. Errors bars represent standard error of the mean (SEM). Statistical analyses were performed using Student's t two-tailed test. (A) Firefly luciferase gene reporter expression in pNP868R-T7RNAP/pT7p-Luciferase, pT7RNAP/pT7p-Luciferase and pCMV-Luciferase transfected cells. Cells transfected with the pNP868R-T7RNAP/pT7p-Luciferase and the pCMV-Luciferase plasmids display 23- and 33-fold fold higher signal than the cells co-transfected with pT7RNAP/pT7p-Luciferase, respectively (*p<0.05). (B) Firefly luciferase gene reporter expression for cells transfected with pT7RNAP/pT7p-Luciferase, pT7RNAP/BamHI-digested pT7p-Luciferase (*p<0.05) and other control conditions (pT7RNAP alone, pT7p-Luciferase digested or not alone, or transfection reagent only). (C) Firefly luciferase gene reporter expression for the pNP868R-T7RNAP/pT7p-Luciferase, pNP868R-T7RNAP/BamHI-digested pT7p-Luciferase (*p<0.05) and other control conditions (pNP868R-T7RNAP alone, pT7p-Luciferase digested or not alone, or transfection reagent only).

(5) FIG. 5 (A-C) represents the Firefly luciferase gene reporter expression of HEK-293 transfected cells treated with -amanitin. (A) Schematic diagram of the assay. For the pCMV-Luciferase plasmid (expression of luciferase is driven by the RNA polymerase II-dependent CMV promoter), -amanitin was added to cell medium (at 0 or 20 g/ml) simultaneously to cell transfection. For the pNP868R-T7RNAP/pT7p-Luciferase plasmids, a first transfection with the pNP868R-T7RNAP plasmid (expression of NP868R-T7RNAP is driven by the RNA polymerase II-dependent CMV promoter) was performed 24 hours before addition of -amanitin to the cell medium (at concentrations ranging from 0 to 20 g/ml) and a second transfection with the pT7p-Luciferase plasmid. Two repetitions of these experiments were performed. Errors bars represent standard error of the mean (SEM). Statistical analysis was performed as described above. (B) -amanitin nearly completely abolished luciferase gene reporter expression of cells transfected with the pCMV-Luciferase plasmid; *p<0.05) (C) -amanitin triggered only a mild decrease of luciferase expression signal in cells transfected with the pNP868R-T7RNAP/pT7p-Luciferase plasmids (*p<0.05), which therefore suggest that the transcription by the NP868R-T7RNAP enzyme is dependent of its phage DNA-dependent T7 RNA polymerase moiety.

(6) FIG. 6 (A-C) represents the cell viability, cytotoxicity and apoptosis assays of HEK-293 transfected cells. Cells were cultured and transfected as above with the pNP868R-T7RNAP or pT7RNAP plasmids. Cell viability, cytotoxicity and apoptosis were assessed at selected time points using the ApoTox-Glo Triplex Assay. Two repetitions of this experiment were performed. Errors bars represent standard error of the mean (SEM). Cell viability, cytotoxicity and apoptosis levels were expressed as the luminescence/fluorescence signal in studied cells subtracted for luminescence/fluorescence in untreated cells. Statistical analysis was performed as above. The transfection reagent (i.e. Lipofectamine 2000), with or without plasmid DNA, impairs cell viability, cytotoxicity and apoptosis. However, no statistically significant difference was observed between cells transfected with the pNP868R-T7RNAP plasmid and the pT7RNAP plasmid for (A) cell viability levels, at all time points, except at day 1 (two-tailed Student's t test, *p<0.05), (B) cytotoxicity levels at all time points, or (C) apoptosis levels at all time points.

(7) FIG. 7 (A-D) represents the physical maps of the plasmids used for the monomeric NP868R-T3RNAP and NP868R-SP6RNAP chimeric enzymes. Physical maps of: (A) pT3RNAP plasmid, which encodes for the phage DNA-dependent T3 RNA polymerase, (B) pSP6 RNAP plasmid, which encodes for the phage DNA-dependent SP6 RNA polymerase, (C) pNP868R-T3RNAP plasmid, which encodes for a fusion between the NP868R African Swine Fever Virus mRNA capping enzyme and the phage DNA-dependent T3 RNA polymerase, via the flexible (Gly.sub.3Ser).sub.4 linker, (D) pNP868R-SP6RNAP plasmid, which encodes for a fusion between the NP868R African Swine Fever Virus mRNA capping enzyme and the phage DNA-dependent SP6 RNA polymerase, via the flexible (Gly.sub.3Ser).sub.4 linker. These two plasmids have the same design: CMV promoter, Kozak sequence followed by the ORFs, poly[A]-track, T terminator for phage RNA polymerase transcription, and SV40 polyadenylation signal.

(8) FIG. 8 represents the expression of the luciferase reporter gene by the monomeric NP868R-T3RNAP and NP868R-SP6RNAP chimeric enzymes. Transfection and luciferase assay were performed as previously described. Gene reporter expression was expressed as the luciferase luminescence in studied cells subtracted for luminescence in cells treated with the transfection reagent only (RLU, relative light units), then divided by SEAP absorbance (OD, optic density) ratio. Four repetitions of this experiment were performed. Errors bars represent standard error of the mean (SEM).

(9) FIG. 9 (A-C) represents the schematic structure of heterodimeric and heterotrimeric chimeric enzymes. (A) Heterodimeric RR.sub.1234L-NP868R/EE.sub.1234L-T7RNAP enzyme. The leucine zippers EE.sub.1234L (acid) and RR.sub.1234L (basic) were added to the amino-terminal ends of NP868R and T7 RNA polymerase, respectively, which interact to form an heterodimer; (B) Heterodimeric D12L/D1R-T7RNAP CCPP enzyme. The D1R subunit of the vaccinia virus mRNA capping enzyme is fused to the amino-terminal end of the single-unit T7 RNA polymerase. When co-expressed with the D12L subunit of the mRNA capping enzyme, D1R-T7RNAP forms a heterodimer designated D12L/D1R-T7RNAP. For simplification, the other construction, i.e. D1R/D12L-T7RNAP chimeric enzyme, is not shown; (C) Heterotrimeric D12L/RR.sub.1234L-D1R/EE.sub.1234L-T7RNAP chimeric enzyme. The leucine zippers EE.sub.1234L (acid) and RR.sub.1234L (basic) were added to the amino-terminal ends of D1R and T7 RNA polymerase, respectively. The co-expression of RR.sub.1234L-D1R together with EE.sub.1234L-T7RNAP and the D12L subunit of the vaccinia virus mRNA capping enzyme form a heterotrimer. For simplification, the other construction, i.e. D1R/RR.sub.1234L-D12L/EE.sub.1234L-T7RNAP chimeric enzyme, is not shown. Open arrows indicate leucine-zipper binding in antiparallel orientation. Black arrows indicate other types of protein interaction.

(10) FIG. 10 (A-H) represents physical maps of the plasmids used for heterodimeric and heterotrimeric chimeric enzymes. Physical maps of (A) pD1R plasmid, which encodes for D1R, the large subunit of the vaccinia mRNA capping enzyme, (B) pD12L plasmid, which encodes for the D12L, the small subunit of the vaccinia mRNA capping enzyme, (C) pRR.sub.1234L-NP868R plasmid, which encodes for the RR.sub.1234L leucine-zipper fused to the amino-terminal end of NP868R, the African Swine Fever Virus mRNA capping enzyme, (D) pRR.sub.1234L-D1R plasmid, which encodes for the RR.sub.1234L leucine-zipper fused to the amino-terminal end of D1R, the large subunit of the vaccinia mRNA capping enzyme, (E) pRR.sub.1234L-D12L plasmid, which encodes for the RR.sub.1234L leucine-zipper fused to the amino-terminal end of D12L, the small subunit of the vaccinia mRNA capping enzyme, (F) pEE.sub.1234L-T7RNA plasmid, which encodes for the pEE.sub.1234L leucine-zipper fused to the phage DNA-dependent T7 RNA polymerase, (G) pD1R-T7RNAP plasmid, which encodes for a fusion between the large subunit of the vaccinia mRNA capping enzyme and the phage DNA-dependent T7 RNA polymerase, via the flexible (Gly.sub.3Ser).sub.4 linker, (H) pD12L-T7RNAP plasmid, which encodes for a fusion between the small subunit of the vaccinia mRNA capping enzyme and the phage DNA-dependent T7 RNA polymerase, via the flexible (Gly.sub.3Ser).sub.4 linker. All these plasmids have the same design: CMV promoter, Kozak sequence followed by the ORFs, poly[A]-track, T terminator for phage RNA polymerase transcription, and SV40 polyadenylation signal.

(11) FIG. 11 represents the expression of the luciferase reporter gene by the heterodimeric RR.sub.1234L-NP868R/EE.sub.1234L-T7RNAP chimeric enzymes. HEK-293 cells were cultured and transfected as described above. Cells were transfected with either the corresponding plasmids (0.4 g DNA/well and 1 L/well lipofectamine 2000) and pT7p-Luciferase, or pCMV-T7RNAP (0.4 g DNA/well and 1 L/well lipofectamine 2000). Gene reporter expression was expressed as the luciferase luminescence in studied cells subtracted for luminescence in cells treated with the transfection reagent only (RLU, relative light units), then divided by SEAP absorbance (OD, optic density) ratio. Four repetitions of this experiment were performed. Errors bars represent standard error of the mean (SEM).

(12) FIG. 12 represents the expression of the luciferase reporter gene by the heterodimeric D1R/D12L-T7RNAP and D12L/D1R-T7RNAP chimeric enzymes. Transfection and luciferase assay were performed as previously described. Gene reporter expression was expressed as the luciferase luminescence in studied cells subtracted for luminescence in cells treated with the transfection reagent only (RLU, relative light units), then divided by SEAP absorbance (OD, optic density) ratio. Two repetitions of this experiment were performed. Errors bars represent standard error of the mean (SEM).

(13) FIG. 13 represents the expression of the luciferase reporter gene by the heterotrimeric D1R/RR.sub.1234L-D12L/EE.sub.1234L-T7RNAP and D12L/EE.sub.1234L-D1R/EE.sub.1234L-T7RNAP chimeric enzymes. Transfection and luciferase assay were performed as previously described. Gene reporter expression was expressed as the luciferase luminescence in studied cells subtracted for luminescence in cells treated with the transfection reagent only (RLU, relative light units), then divided by SEAP absorbance (OD, optic density) ratio. Two repetitions of this experiment were performed. Errors bars represent standard error of the mean (SEM).

(14) FIG. 14 represents the expression of the luciferase reporter gene by the monomeric NP868R-SP6RNAP chimeric enzymes in presence of siRNAs targeting the large subunit of RNA polymerase II (POL2AR) or the human capping enzyme (RNGTT). Transfection and luciferase assay were performed as previously described, except that siRNA at 25 nM final concentration were added to the transfection reagent. The siRNA SI04364381, SI04369344, SI04250162 and SI04354420 target the POLR2A gene, whereas the siRNA SI00055986, SI03021508, SI00055972, and SI00055979 target RNGTT. Gene reporter expression was expressed as the luciferase luminescence in studied cells subtracted for luminescence in cells treated with the transfection reagent only (RLU, relative light units), then divided by SEAP absorbance (OD, optic density) ratio. Two repetitions of this experiment were performed. Errors bars represent standard error of the mean (SEM).

(15) FIG. 15 represents the dose effect activity of siRNAs targeting the large subunit of RNA polymerase II (POL2AR) and the human capping enzyme (RNGTT). Transfection and luciferase assay were performed as previously described, except that siRNA were added at concentration ranging from 0 to 100 nM to the transfection reagent. The siRNA SI04369344 and SI00055972 target the POLR2A and RNGTT genes, respectively. Gene reporter expression was expressed as the luciferase luminescence in studied cells subtracted for luminescence in cells treated with the transfection reagent only (RLU, relative light units), then divided by SEAP absorbance (OD, optic density) ratio. Three repetitions of this experiment were performed. Errors bars represent standard error of the mean (SEM).

(16) The present invention will be explained in detail with examples in the following, but the technical scope of the present invention is not limited to these examples.

EXAMPLES

Example 1

Example of Active Monomeric Chimeric Enzyme Np868R-T7RNAP

(17) I. Plasmids

(18) One plasmid has been synthesized, which encode for fusions between NP868R, the mRNA capping enzyme of the African Swine Fever Virus, and the wild-type phage DNA-dependent RNA polymerase of the bacteriophage T7. The capping enzyme was fused to the amino-terminal end of the T7 RNA polymerase via a (Gly.sub.3Ser).sub.4 linker. The pNP868R-T7RNAP plasmid was used to assess the activity of the encoded enzyme by a firefly luciferase gene reporter expression assay (FIG. 1). In brief, pNP868R-T7RNAP and pT7p-Luciferase plasmids were co-transfected in the human HEK-293 cultured cells. The expression of the NP868R-T7RNAP enzyme is driven by the RNA polymerase II-dependent CMV promoter of the corresponding plasmid. NP868R-T7RNAP enzyme, in turn, is expected to initiate the transcription of the pT7p-Luciferase plasmid at its T7 promoter. If both the mRNA capping and DNA-dependent RNAP enzymatic activities of the NP868R-T7RNAP enzyme are retained, luciferase mRNA having m.sup.7GpppGm cap structures are to be synthesized, which in turn can be translated into firefly luciferase protein and detected by cell luminescence assay. In addition, the pNP868R-T7RNAP plasmid was used to investigate the cellular distribution of the enzyme, as well as the cell viability, cytotoxicity and apoptosis related with the expression of the enzyme in the HEK-293 cells.

(19) The plasmid encoding for the NP868R-T7RNAP and T7RNAP (T7 RNA polymerase) enzymes were synthesized in four steps by GeneArt AG (Regensburg, Germany). The protein sequence encoded by pT7RNA plasmid corresponds to SEQ ID NO:19. The protein sequence encoded by pNP868R-T7RNAP plasmid corresponds to SEQ ID NO:20. Firstly, a DNA fragment containing the T7 RNA polymerase promoter and the multiple cloning site (MCS) was removed from the pCMV-Script plasmid (Stratagene, La Jolla, Calif. USA). Secondly, a cassette was introduced in the pCMV-Script plasmid between its CMV promoter and its SV40 polyadenylation signal. This cassette consisted of the Lac operator stem-loop (Gilbert and Maxam 1973), a MCS, a poly[A]-tract, and a T class-I hairpin terminator signal (Lyakhov, He et al. 1997). Thirdly, the Kozak consensus sequence for initiation of translation (Kozak 1987), followed by the entire open-reading frame (ORF) of the NP868R-T7RNAP or T7RNAP enzymes were assembled from synthetic oligonucleotides using a PCR-based method, cloned and fully sequence verified. The ORF of the NP868R-T7RNAP (SEQ ID NO:21) and of the ORF of the T7RNAP (SEQ ID NO:22) were optimized by altering for preferred codon usage, removing of cis-acting elements such as cryptic splice sites and poly(A) signals, as well as improving mRNA stability by removal of direct repeats and secondary structure elements. Fourthly, the entire ORFs of each NP868R-T7RNAP or T7RNAP were subcloned in the MCS of the cassette, resulting in the pNP868R-T7RNAP plasmid and the pT7RNAP plasmid. As a consequence of the construction strategy, two additional amino-acids (Glu, Phe) were added immediately downstream to the ATG of the Kozak sequence, two other were added immediately upstream to the (Gly.sub.3Ser).sub.4 linker (Gly, Pro), and two immediately downstream to this linker (Leu, Glu) of the NP868R-T7RNAP enzyme. Finally, the pNP868R-T7RNAP and pT7RNAP plasmids had the following design (FIGS. 2A and 2B): CMV promoter, Kozak sequence followed by the NP868R-T7RNAP or T7RNAP ORFs, poly[A]-track, T terminator for phage RNA polymerase transcription, and SV40 polyadenylation signal.

(20) Two plasmids encoding for the firefly luciferase reporter gene were synthesized by Eurofins/MWG/Operon (Ebersberg, Germany). The pET-22b(+)RNAPp-Luciferase plasmid (named pT7p-Luciferase thereafter) was designed to assay the activity of the chimeric enzyme according to the invention. A test sequence was introduced in the pET-22b(+) backbone (Novagen, San Diego, Calif. USA), which consisted of an array of RNA polymerase promoters (T7, T3 and SP6 phage RNAP promoters, followed by the E. coli ribosomal rrnD1 promoter), a Lac operator stem-loop sequence, the entire ORF of the firefly luciferase, a poly[A]-track, a hepatitis-D ribozyme encoding sequence for RNA auto-cleavage (Conzelmann and Schnell 1994; Garcin, Pelet et al. 1995; Bridgen and Elliott 1996; Schurer, Lang et al. 2002; Walker, Avis et al. 2003) and the T terminator for phage RNA polymerase transcription (FIG. 3A). A BamHI-digested version of the pT7p-Luciferase plasmid, which disrupts the physical connection between the luciferase ORF and the T7 promoter, was also used as negative control (FIG. 3B). Moreover, the pCMV-Luciferase plasmid, which was used as an active comparator, contained the firefly luciferase downstream to the RNA polymerase II-dependent CMV promoter of the pCMV-Script plasmid (FIG. 3C).

(21) II. Cell Culture and Transfection

(22) The Human Embryonic Kidney 293 cells (HEK-293, ATCC CRL 1573) were grown at 37 C. with 5% CO2. Cells were maintained in Dulbecco's Modified Eagle's Medium (DMEM) supplemented with 3.97 mM L-alanyl-L-glutamine (substituted on a molar equivalent basis for L-glutamine), 10% fetal bovine serum (FBS), 1% non-essential amino-acids, 1% penicillin and streptomycin, and 0.2% fungizone.

(23) The day before transfection, HEK-293 cells were plated in 24 well plates at densities of approximately 810.sup.4 cells per well. One hour prior to transfection, the medium was changed to fresh complete medium without antibiotics. Transfections were performed with Lipofectamine 2000 (Invitrogen, Carlsbad, Calif. USA) according to manufacturer's recommendations. In brief, plasmid DNA diluted in Opti-MEM I reduced serum medium (Invitrogen, Carlsbad, Calif. USA) and mixed with Lipofectamine 2000, were added to the cell medium. Following transfection, cells were incubated up to 120 hours prior to testing for luciferase and SEAP gene reporter expression.

(24) Cells were co-transfected with the pT7RNAP or pNP868R-T7RNAP (0.4 g DNA/well and 1 L/well Lipofectamine 2000), together with the pT7p-Luciferase reporter plasmid (0.4 g DNA/well and 1 L/well Lipofectamine 2000). A series of other transfection conditions were used as negative controls and included: (a) the same co-transfection as before, except that the pT7p-Luciferase was digested by the BamHI restriction enzyme, which disrupts the physical connection between the luciferase ORF and the T7 promoter, (b) the pNP868R-T7RNAP or pT7RNAP plasmids alone, (c) the pT7p-Luciferase reporter plasmid digested or not alone, (d) the transfection reagent alone (i.e. Lipofectamine 2000). Cells were also transfected with the pORF-eSEAP plasmid (InvivoGen, San Diego, Calif.; used to normalize for transfection efficacy), as well as with the pCMV-T7RNAP plasmid (used as an active comparator).

(25) III. Firefly Luciferase Luminescence and SEAP Colorimetric Assays

(26) The firefly luciferase luminescence was assayed with the Luciferase Assay System according to manufacturer's recommendations (Promega, Madison Wis. USA). In brief, HEK-293 cells were lysed in Cell Culture Lysis Reagent (CCLR) lysis buffer, and then centrifuged at 12,000g for 2 minutes at 4 C. Luciferase Assay Reagent (Promega; 100 l/well) was added to supernatant (20 l/well). Luminescence readout was taken on a luminometer reader (Fluostar; BMG Labtech, Offenburg Germany) according to the manufacturer's instructions.

(27) The expression of pORF-eSEAP plasmid was used to normalize for transfection efficiency. This plasmid encodes for the secreted placental alkaline phosphatase (SEAP), which was assayed for enzymatic activity in cell culture medium using the Quanti-Blue colorimetric enzyme assay kit (InvivoGen, San Diego, Calif.) at selected time points. Gene reporter expression was expressed as the luciferase luminescence in studied cells subtracted for luminescence in cells treated with the transfection reagent only (RLU; relative light units), then divided by SEAP absorbance to normalize for transfection efficacy (OD, optic density) ratio.

(28) IV. Statistical Analysis

(29) All statistical analyses were performed using Student's t two-tailed test adjusted by Holm-Bonferroni correction for multiple testing, if appropriate. A p-value of less than 0.05 was regarded as being significant.

(30) V. Gene Reporter Expression Assay

(31) A firefly luciferase reporter luminescence assay was used to assess the translatability of mRNA generated by the chimeric enzyme according to the invention or T7RNAP enzyme. The co-transfection of the pT7RNAP and pT7p-Luciferase plasmids triggered low but detectable luciferase expression signal in comparison to cells co-transfected with the pT7RNAP/BamHI-digested version of the pT7p-Luciferase plasmid (which therefore demonstrate that luciferase gene reporter expression is driven by the phage T7 promoter; FIGS. 4A and 4B). This is in agreement with previously published reports, which have shown that the T7RNAP expressed in eukaryotic cells can synthesize RNA molecules which are poorly translated because of their absence of 5-capping (Fuerst, Niles et al. 1986; Chen, Li et al. 1994). A drastic reduction of the firefly luciferase gene expression signal was also observed when the transfection was performed without the pT7RNAP plasmid (which confirm that luciferase expression require the presence of T7RNAP) or the pT7p-Luciferase plasmid (which confirm the specificity of the luminescence signal), or both.

(32) The pNP868R-T7RNAP plasmid was cotransfected with the pT7p-Luciferase plasmid and tested under same conditions as above. At peak, approximately 23-fold higher luciferase expression signal was observed with pNP868R-T7RNAP/pT7p-Luciferase than with the pT7RNAP/pT7p-Luciferase plasmids (FIG. 4A). The specificity of the above findings was confirmed by the co-transfection of BamHI-digested version of the pT7p-Luciferase plasmid, as well as the transfection by pNP868R-T7RNAP or pT7p-Luciferase plasmids digested or not alone, which gave drastically reduced luciferase expression signal (FIG. 4C). At peak, co-transfection of pNP868R-T7RNAP/pT7p-Luciferase plasmids gave 72% of the luciferase expression signal to that of pCMV-T7RNAP plasmid (FIG. 4A).

(33) In summary, the activity of the chimeric NP868R-T7RNAP enzyme according to the invention encoded by the pNP868R-T7RNAP plasmid has been demonstrated using a firefly luciferase reporter luminescence assay. The specificity of the present findings is supported by a series of controls, which suggest that both the mRNA capping and DNA-dependent RNA polymerase enzymatic activities of the NP868R-T7RNAP enzyme are retained when expressed in HEK-293 cells.

(34) VI. Gene Reporter Expression Assay in Alpha-Amanitin Treated Cells

(35) To further demonstrate that the transcription by pNP868R-T7RNAP is dependent of its phage DNA-dependent T7 RNA polymerase moiety, gene transfection assays were also performed in -amanitin treated cells. Alpha-amanitin is a specific inhibitor of the nuclear RNA polymerase II (Jacob, Sajdel et al. 1970; Kedinger, Gniazdowski et al. 1970; Lindell, Weinberg et al. 1970), which binds its Rpb1 subunit (Bushnell, Cramer et al. 2002). In contrast, alpha-amanitin has no effect on transcription by the phage T7 RNA polymerase which was used to engineer the NP868R-T7RNAP chimeric enzyme according to the invention (Kupper, McAllister et al. 1973; Engleka, Lewis et al. 1998).

(36) To initiate the expression of the NP868R-T7RNAP enzyme, which is driven by the RNA polymerase II-dependent CMV promoter, cells were transfected with the pNP868R-T7RNAP 24 hours before addition of -amanitin to cell medium (at concentrations ranging from 0 to 20g/ml) and a second transfection with the pT7p-Luciferase plasmid (FIG. 5A). For the pCMV-Luciferase plasmid, cells were simultaneously transfected and treated with -amanitin (at 0 or 20 g/ml; FIG. 5A). Gene reporter expression was expressed as the luciferase luminescence in studied cells subtracted for luminescence in cells treated with the transfection reagent only (RLU; relative light units), then divided by SEAP absorbance to normalize for transfection efficacy (OD, optic density) ratio.

(37) As expected, -amanitin nearly completely abolished firefly luciferase gene reporter expression of pCMV-Luciferase transfected cells (FIG. 5B). In contrast, only a mild decrease of luciferase expression was triggered by -amanitin at all concentrations in pNP868R-T7RNAP/pT7p-Luciferase transfected cells (FIG. 5C).

(38) The present findings, therefore confirms that the transcription by NP868R-T7RNAP enzyme depends of the enzymatic activity of its phage T7 DNA-dependent RNA polymerase moiety.

(39) VII. Immunofluorescence

(40) The subcellular distribution of the NP868R-T7RNAP enzyme was investigated by indirect immunofluorescence. HEK-293 cells were plated in 24 well plates at 810.sup.4 cells/well, on poly-L-lysine coated coverslips (BD BioCoat; Bioscience, Mississauga, ON USA), then transfected as previously described. Six and 24-hours after transfection, cells were washed in phosphate buffered saline (PBS), and then fixed in 4% paraformaldehyde for 15 minutes. After fixation, cells were washed with PBS, and then permeabilised for 30 minutes in PBS containing 5% goat serum (Invitrogen), 0.1% Triton X-100 and 0.02% sodium azide. Cells were incubated overnight at 4 C. with the mouse monoclonal antibody raised against T7 RNA Polymerase (1:200, Novagen). After extensive washing with PBS, cells were incubated for 3 hours at room temperature with fluorescein isothiocyanate-conjugated (FITC) goat anti-mouse IgG (Sigma-Aldrich). Cell nuclei were stained with 4-6-Diamidino-2-phenylindole (DAPI) for 5 minutes. Cells were then washed and mounted in the anti-fade medium Mowiol 4-88 (Calbiochem, Gibbstown, N.J. USA). Cells were analyzed by using an epifluorescence microscope with appropriate filters.

(41) As expected, a weak but detectable FITC signal was observed at both 6 and 24-hours in the cytoplasm of cells transfected with the pNP868R-T7RNAP plasmid, while their nuclei were stained by DAPI.

(42) VIII. Cell Viability, Cytotoxicity and Apoptosis Assays

(43) The ApoTox-Glo Triplex Assay (Promega, Madison Wis.) was used to investigate whether the expression of the NP868R-T7RNAP enzyme impair viability, or induce toxicity or apoptosis of transfected cells. Two protease activities were assayed by fluorescence: one is a marker of cell viability (i.e. the peptide substrate GF-AFC), and the other is a marker of cytotoxicity (i.e. the peptide substrate bis-AAF-R110). Apoptosis was assayed by the luminogenic caspase-3/7 substrate, which contains the tetrapeptide sequence DEVD, in a reagent optimized for caspase activity.

(44) Cell culture and transfections were performed as previously, except that HEK-293 cells were plated in 96-well plates at densities ranging of 1.210.sup.4 cells per well. Cells were transfected with the pNP868R-T7RNAP plasmid, the pT7RNAP plasmid, or the transfection reagent only. ApoTox-Glo Triplex Assay was performed according to manufacturer's recommendations. In brief, at selected time points, the viability/cytotoxicity reagent containing both GF-AFC Substrate and bis-AAF-R110 substrates were added to the wells and incubated for 30 minutes at 37 C., before fluorescence assessment at two different wavelength sets for viability and cytotoxicity. The caspase reagent was then added to all wells, and luminescence was measured after 30 minutes incubation at room temperature. Statistical analysis was performed as above. Cell viability, cytotoxicity and apoptosis levels were expressed as the luminescence/fluorescence signal in studied cells subtracted for luminescence/fluorescence in untreated cells.

(45) As previously reported (Patil, Rhodes et al. 2004), the cell viability, cytotoxicity and apoptosis were significantly impaired in cells treated with the transfection reagent (i.e. Lipofectamine 2000) as compared to untreated cells (FIGS. 6A, 6B and 6C). As also expected, cell viability, cytotoxicity and apoptosis were generally more impaired when plasmid DNA were added to transfection mixture (FIGS. 6A, 6B and 6C). However, at all studied time points, the cell viability, cytotoxicity or apoptosis markers of cells transfected with the pNP868R-T7RNAP plasmid were not statistically different to that of pT7RNAP plasmid, except 24 hours after transfection for cell viability only, which is possibly due to hazard only (FIGS. 6A, 6B and 6C; two-tailed Student's t test for individual time points, P-value<0.05).

(46) In conclusion, no obvious difference in cytotoxicity, cell viability, and apoptosis of the NP868R-T7RNAP enzyme can be demonstrated in comparison to T7RNAP, which has no recognized capping enzymatic activity.

Example 2

Examples of Active Monomeric Chimeric ENZYMES NP868R-T3RNAP and NP868R-SP6RNAP

(47) Two other types of monomeric chimeric enzymes according to the invention have been generated, which consist of NP868R, the monomeric mRNA capping enzyme of the African Swine Fever Virus, fused to the amino-terminal end of the wild type T3 or SP6 monomeric bacteriophage DNA-dependent RNA polymerases, via the flexible linker (Gly.sub.3Ser).sub.4.

(48) I. Methods

(49) The sequences used to generate said monomeric chimeric enzymes were assembled from synthetic oligonucleotides using a PCR-based method, cloned and fully sequence verified. These sequences were subcloned in the pCMV-Script plasmid containing the subcloning cassette previously described. Finally, all the plasmids used for expression had the similar design: CMV IE1 promoter/enhancer promoter, Kozak sequence followed by the ORFs, poly[A]-track, T terminator for phage RNA polymerase transcription, and SV40 polyadenylation signal (FIG. 7 (A-D)).

(50) As a consequence of the subcloning strategy, amino-acids were added immediately downstream to the ATG of the Kozak sequence encoded by the plasmids (Glu-Phe-Leu-Glu for pT3RNAP and pSP6RNAP; Glu-Phe for pNP868R-T3RNAP and pNP868R-SP6RNAP). In addition, two amino-acids were added immediately upstream (Gly-Pro for pNP868R-T3RNAP and pNP868R-SP6RNAP) or downstream to the (Gly.sub.3Ser).sub.4 linker (Leu-Glu for pNP868R-T3RNAP and pNP868R-SP6RNAP).

(51) HEK-293 cells were grown as previously described in 24-wells plates and transfected using the Lipofectamine 2000 reagent, and the appropriate plasmids (0.4 g DNA/well, plus 1 L/well lipofectamine 2000, per transfected plasmid). The firefly luciferase luminescence was assayed as previously described using the pT7p-Luciferase (which also contains both the T3 and SP6 promoters) and the Luciferase Assay System. The expression of pORF-eSEAP plasmid was used to normalize for transfection efficacy as previously described. Statistical analyses were performed using Student's t two-tailed test adjusted by Holm-Bonferroni correction for multiple testing, if appropriate. A p-value of less than 0.05 was regarded as being statistically significant.

(52) II. Results

(53) As shown in FIG. 8, when co-transfected with the reporter pT7p-luciferase plasmid, both pNP868R-T3RNAP and NP868R-SP6RNAP show strong luciferase gene reporter signal, which was 14- and 56-folds higher than pT3RNAP or pSP6RNAP, respectively (p<0.001 for each comparisons, Student's t-test). The NP868R-T3RNAP enzyme has 36% activity to that of pCMV-T7RNAP plasmid (p<0.001, Student's t-test), whereas or NP868R-SP6RNAP heterodimeric enzyme shows 1.1-fold luciferase reporter gene expression to that of pCMV-T7RNAP plasmid (non-statistically significant difference, Student's t-test).

(54) These results demonstrate the activity of different types of monomeric chimeric enzymes according to the invention.

Example 3

Examples of Active Dimeric and Trimeric Chimeric Enzymes

(55) Different types of active oligomeric chimeric enzymes according to the invention have been generated as shown in FIG. 9: one heterodimeric chimeric enzyme, resulting of the non-covalent linkage between the monomeric African Swine Fever Virus mRNA capping enzyme NP868R and the monomeric T7 RNA polymerase, via the EE.sub.1234L and RR.sub.1234L leucine-zippers, which form the heterodimeric RR.sub.1234L-pNP868R/EE.sub.1234L-T7RNAP chimeric enzyme, two heterodimeric chimeric enzymes obtained by fusion between each of the two subunits of the vaccinia virus mRNA capping enzyme (i.e. D1R or D12L) with the monomeric T7 RNA polymerase, via the flexible (Gly.sub.3Ser).sub.4 linker. Each fusion proteins are coexpressed with the other subunit of the vaccinia virus mRNA capping enzyme, in order to form the heterodimeric D12L/D1R-T7RNAP and D1R/D12L-T7RNAP chimeric enzymes, two heterotrimeric chimeric enzymes, which are generated by fusion of the EE.sub.1234L and RR.sub.1234L leucine-zippers to the amino-terminal ends of one of the subunits of the vaccinia virus mRNA capping enzyme and the T7 RNA polymerase, respectively. Co-expression of RR.sub.1234L-D1R or pRR.sub.1234L-D12L, with the other subunit of the vaccinia virus mRNA capping enzyme, plus EE.sub.1234L-T7RNAP, form the heterotrimeric D1R/RR.sub.1234L-D12L/EE.sub.1234L-T7RNAP and D12L/RR.sub.1234L-D1R/EE.sub.1234L-T7RNAP chimeric enzymes.

(56) I. Methods

(57) The sequences used to generate the chimeric enzymes were assembled from synthetic oligonucleotides using a PCR-based method, cloned and fully sequence verified. These sequences were subcloned in the pCMV-Script plasmid with the subcloning cassette previously described. Finally, all the plasmids used for expression had the similar design: CMV IE1 promoter/enhancer promoter, Kozak sequence followed by the open-reading frames (ORFs), poly[A]-track, T terminator for phage RNA polymerase transcription, and SV40 polyadenylation signal (FIG. 10 (A-H)).

(58) As a consequence of the subcloning strategy, two amino-acids were added immediately downstream to the ATG of the Kozak sequence of some plasmids (Leu-Glu for pT7RNAP; Glu-Phe for pNP868R, pD1R, pD12L, pD1R-T7RNAP, and pD12L-T7RNAP), immediately downstream to the leucine-zipper sequences (Leu-Glu for pEE.sub.1234L-T7RNAP; Glu-Phe for pRR.sub.1234L-NP868R, pRR.sub.1234L-D1R and pRR.sub.1234L-D12L), and at the carboxyl-terminal end of some encoded proteins (Gly-Pro for pNP868R, pRR.sub.1234L-NP868R, pD1R, pD12L, pRR.sub.1234L-D1R and pRR.sub.1234L-D12L). In addition, two amino-acids were added immediately upstream (Gly-Pro for pD1R-T7RNAP and pD12L-T7RNAP) or downstream to the (Gly.sub.3Ser).sub.4 linker (Leu-Glu for pD1R-T7RNAP and pD12L-T7RNAP).

(59) As previously described, the Human Embryonic Kidney 293 cells (HEK-293) were grown in 24-wells plates. HEK-293 cells were transfected using the lipofectamine 2000 reagent, and the appropriate plasmids (0.4 g DNA/well, plus 1 L/well lipofectamine 2000, per transfected plasmid) as previously described. The firefly luciferase luminescence was assayed as previously described using the pET-22b(+)T7RNAPp-Luciferase reporter plasmid (designated pT7p-Luciferase thereafter) and the Luciferase Assay System. The expression of pORF-eSEAP plasmid was used to normalize the transfection efficacy as previously described.

(60) Gene reporter expression was expressed as the luciferase luminescence in studied condition subtracted by the luminescence in cells treated with the transfection reagent only (RLU, relative light units), then divided by SEAP absorbance (OD, optic density) ratio. Statistical analyses were performed using Student's t two-tailed test adjusted by Holm-Bonferroni correction for multiple testing, if appropriate. A p-value of less than 0.05 was regarded as being statistically significant.

(61) II. Results

(62) II.1 Heterodimeric RR.sub.1234L-NP868R/EE.sub.1234L-T7RNAP Chimeric Enzyme

(63) The activity of the heterodimeric enzyme RR.sub.1234L-NP868R/EE.sub.1234L-T7RNA chimeric enzyme (encoded by pRR.sub.1234L-pNP868R and pEE.sub.1234L-T7RNAP plasmids, respectively) has been demonstrated. This heterodimeric enzyme is generated by non-covalent linkage between the monomeric African Swine Fever Virus mRNA capping enzyme pNP868R and the monomeric T7 RNA polymerase, via the EE.sub.1234L and RR.sub.1234L leucine-zippers (FIG. 9). The EE.sub.1234L (acidic leucine-zipper; LEIAAFLEQENTALETEVAELEQEVQRLENIVSQYETRYGPLGGGK (SEQ ID NO:51), one letter amino-acid code) and RR.sub.1234L leucine-zippers (basic leucine-zipper with slight modification of the GGGK orientation, which is not involved in leucine-zipper dimerization (Moll, Ruvinov et al. 2001); LEIRAAFLRRRNTALRTRVAELRQRVQRLRNIVSQYETRYGPLGGGK (SEQ ID NO:52), one letter amino-acid code), which were respectively added to the amino-terminal end of NP868R and T7RNAP, respectively. The RR.sub.1234L and EE.sub.1234L leucine zippers are dimeric coiled-coil peptide structures consisting of two amphipathic -helices that preferably melt as heterodimer in antiparallel orientation (Moll, Ruvinov et al. 2001).

(64) As expected, the transfection of the plasmid encoding for the African Swine Fever Virus mRNA capping enzyme alone with or without leucine-zipper sequences (i.e. pRR.sub.1234L-NP868R and pNP868R, respectively) do not induce any detectable luciferase reporter gene expression (FIG. 11). As also expected, cells transfected with the plasmid encoding for the T7 RNA polymerase with the EE.sub.1234L leucine zipper (encoded by pEE.sub.1234L-T7RNA) show very similar activity to the T7 RNA polymerase without leucine-zipper (encoded by pT7RNA), which provide further evidence that the native amino-terminal end of the T7 RNA polymerase can be modified without major impairment of its enzymatic processivity.

(65) The HEK293 cells co-transfected with the pRR.sub.1234L-NP868R and pEE.sub.1234L-T7RNA plasmids (encoding for NP868R and T7RNAP with leucine-zippers), together with the reporter pT7p-luciferase plasmid, show strong luciferase reporter gene expression signal, which is 87% to that of pCMV-T7RNAP plasmid (non-statistically significant difference, Student's t-test; (FIG. 11). Furthermore, cells co-transfected in presence of the reporter pT7p-luciferase plasmid with the pRR.sub.1234L-NP868R and pEE.sub.1234L-T7RNA plasmids, displays 3.7-fold higher luciferase reporter gene expression than cells cotransfected with pNP868R and pT7RNAP (encoding for NP868R and T7RNAP without leucine-zippers; p<0.05, Student's t-test).

(66) These results demonstrate the activity of heterodimeric chimeric enzymes according to the invention and that the non-covalent linkage between NP868R and T7RNAP by leucine-zippers increases significantly the expression of the gene reporter driven by said chimeric enzymes.

(67) II.2 Heterodimeric D1R/D12L-T7RNAP and D12L/D1R-T7RNAP Chimeric Enzymes

(68) The activity of other types of heterodimeric chimeric enzyme has also been demonstrated, using the vaccinia mRNA capping enzyme.

(69) By itself, the vaccinia mRNA capping enzyme is a heterodimer consisting of: (i) a 95 kDa subunit encoded by the vaccinia virus D1R gene (genomic sequence ID# NC_006998.1; GeneID#3707562; UniProtKB/Swiss-Prot ID# YP_232988.1), designated hereafter as D1R, which has RNA-triphosphatase, RNA guanylyltransferase and RNA N7-guanine methyltransferase enzymatic activities (Cong and Shuman 1993; Niles and Christen 1993; Higman and Niles 1994; Mao and Shuman 1994; Gong and Shuman 2003), (ii) and a 31-kDa subunit encoded by the vaccinia virus D12L gene (genomic sequence ID# NC_006998.1; GeneID#3707515; UniProtKB/Swiss-Prot ID#YP_232999.1), designated hereafter as D12L, which has no intrinsic enzymatic activity, but enhances drastically the RNA N7-guanine methyltransferase activity of the D1R subunit (Higman, Bourgeois et al. 1992; Higman, Christen et al. 1994; Mao and Shuman 1994).

(70) D1R or D12L were fused to the amino-terminal end of the T7 RNA polymerase, via the (Gly.sub.3Ser).sub.4 linker (encoded by D1R-T7RNAP or D12L-T7RNAP, respectively). When co-expressed, each fusion proteins, together with the other vaccinia mRNA capping enzyme subunit (encoded by pD12L or D1R, respectively), generate two different heterodimeric chimeric enzymes designated as D12L/D1R-T7RNAP and D1R/D12L-T7RNAP, respectively (FIG. 9). In presence of the reporter pT7p-luciferase plasmid, the heterodimeric chimeric enzymes generate a strong luciferase gene reporter signal in HEK293 cells (FIG. 12). The heterodimeric D12L/D1R-T7RNAP chimeric enzyme has 32% activity to that of pCMV-T7RNAP plasmid (p<0.01, Student's t-test), whereas the D1R/D12L-T7RNAP heterodimeric enzyme has 1.5-fold higher luciferase reporter gene expression than the pCMV-T7RNAP plasmid (non-statistically significant difference, Student's t-test). Furthermore, the coexpression of the two subunits of vaccinia mRNA capping enzyme unbound to the T7 RNA polymerase (encoded by pD1R, pD12L and pT7RNAP) shows 9- and 42-fold lower luciferase reporter gene expression signal than the heterodimeric D12L/D1R-T7RNAP and D1R/D12L-T7RNAP chimeric enzymes, respectively (P<0.05 for both statistical comparison, Student's t-test).

(71) These results demonstrate the activity of different types of heterodimeric chimeric enzymes according to the invention and that covalent linkage between the subunits of the vaccinia mRNA capping enzyme and the T7RNAP stimulates significantly the gene reporter expression. As also expected, in presence of the reporter pT7p-luciferase plasmid, the expression of D1R and/or D12L without T7 RNA polymerase induces virtually no detectable luciferase expression.

(72) II.3 Heterotrimeric D12L/RR.sub.1234L-D1R/EE.sub.1234L-T7RNAP and D1R/RR.sub.1234L-D12L/EE.sub.1234L-T7RNAP Chimeric Enzymes

(73) The activity of heterotrimeric chimeric enzyme has also been demonstrated.

(74) The basic RR.sub.1234L leucine zipper was fused to the amino-terminal ends of either the D1R or D12L subunits of the vaccinia virus mRNA capping enzyme (encoded by pRR.sub.1234L-D1R and RR.sub.1234L-D12L, respectively), while the complementary acidic EE.sub.1234L leucine-zipper was added to the amino-terminal end of T7 RNA polymerase (encoded by the pEE.sub.1234L-T7RNA plasmid). The co-expression of pEE.sub.1234L-T7RNAP, together with either pRR.sub.1234L-D1R or pRR.sub.1234L-D12L, plus the other vaccinia mRNA capping enzyme subunit (pD12L and pD1R plasmids, respectively), therefore generate two different heterotrimeric CCPP enzymes, designated as D12L/RR.sub.1234L-D1R/EE.sub.1234L-T7RNAP and D1R/RR.sub.1234L-D12L/EE.sub.1234L-T7RNAP, respectively (FIG. 9).

(75) The T7 RNA polymerase displayed 7-fold higher luciferase gene reporter signal when coexpressed with the D1R/D12L subunits of the vaccinia virus mRNA capping enzyme than in their absence. These results are therefore in line with those obtained by the vaccinia virus/bacteriophage RNAP hybrid expression system, in which the translatability of uncapped T7 transcripts is increased by the expression of the vaccinia mRNA capping enzyme provided by a recombinant virus (Fuerst, Niles et al. 1986; Fuerst, Earl et al. 1987; Elroy-Stein, Fuerst et al. 1989; Fuerst, Fernandez et al. 1989; Fuerst and Moss 1989; Elroy-Stein and Moss 1990).

(76) A strong luciferase gene reporter signal was shown in HEK-293 cells expressing either the D1R/RR.sub.1234L-D12L/EE.sub.1234L-T7RNAP or the D12L/RR.sub.1234L-D1R/EE.sub.1234L-T7RNAP CCPP enzymes, in presence of the reporter pT7p-luciferase plasmid (FIG. 13). The heterodimeric D12L/RR.sub.1234L-D1R/EE.sub.1234L-T7RNAP and D1R/RR.sub.1234L-D12L/EE.sub.1234L-T7RNAP chimeric enzymes have respectively 57% and 33% activity to that of pCMV-T7RNAP plasmid (non-statistically significant difference, Student's t-test). The heterodimeric D12L/RR.sub.1234L-D1R/EE.sub.1234L-T7RNAP and D1R/RR.sub.1234L-D12L/EE.sub.1234L-T7RNAP chimeric enzymes show respectively 11- and 6.7-fold stronger luciferase gene reporter expression signal than cells expressing D1, D12L and T7RNAP without leucine-zippers (p=0.05 and non-statistically significant difference, respectively; Student's t-test).

(77) These results demonstrate the activity of heterotrimeric chimeric enzymes according to the invention and that the non-covalent linkage between any of the subunits of the vaccinia mRNA capping enzyme and the T7 RNA polymerase increases significantly the gene reporter expression.

(78) III. Conclusion

(79) These present results show the activity of different types of heterodimeric and heterotrimeric chimeric enzymes according to the invention, generated by covalent or non-covalent linkage.

(80) The present results also provide evidences that covalent or non-covalent linkage between the different catalytic domain of the chimeric enzyme and in particular between capping enzymes and RNA polymerases allows the optimization of the gene reporter expression by the chimeric enzymes.

Example 4

Stimulation of Luciferase Reporter Gene Expression by Silencing Sequences Against the Cellular RNA Polymerase II and Capping Enzyme

(81) I. Methods

(82) HEK-293 cells were grown as previously described in 24-wells plates and transfected using the Lipofectamine 2000 reagent, and the appropriate concentration of siRNA (Qiagen; Hilden, Germany) and plasmids (0.4 g DNA/well, plus 1 L/well lipofectamine 2000, per transfected plasmid). The NP868R-SP6 chimeric enzyme, which has strong demonstrated activity, was used in the present experiment. The firefly luciferase luminescence was assayed as previously described using the pT7p-Luciferase (which also contains both the T3 and SP6 promoters) and the Luciferase Assay System. The expression of pORF-eSEAP plasmid was used to normalize for transfection efficacy as previously described.

(83) Four siRNA that target the human POLR2A (NCBI Gene ID#5430; mRNA sequence ID# NM_000937.4; NCBI protein sequence ID# NP_000928.1) were used: SI04364381 (mRNA sequence 1255-1275: CAGCGGTTGAAGGGCAAGGAA (SEQ ID NO:43)), SI04369344 (mRNA sequence 830-850: ATGCGGAATGGAAGCACGTTA (SEQ ID NO:44)), SI04250162 (mRNA sequence 2539-2559: ATGGTCGTGTCCGGAGCTAAA (SEQ ID NO:45)), and SI04354420 (mRNA sequence 4896-4916: CAGCGGCTTCAGCCCAGGTTA (SEQ ID NO:46)).

(84) In addition, four siRNA that target the human RNGTT (Gene ID#8732; mRNA sequence ID# NM_003800.3; NCBI protein sequence ID# NP_003791.3) were used: SI00055986 (mRNA sequence 3187-3207: ATGGATTTAAAGGGCGGCTAA (SEQ ID NO:47)), SI03021508 (mRNA sequence 430-450: TTCAAGGTTCTATGACCGAAA (SEQ ID NO:48)), SI00055972 (mRNA sequence 2530-2550: CAGGGTTGTTAAGTTGTACTA (SEQ ID NO:49)) and SI00055979 (mRNA sequence 4132-4152: TACCATCTGCAGTATTATAAA (SEQ ID NO:50)).

(85) II. Results

(86) In a first series of experiments, the effects of four POLR2A siRNA and four RNGTT siRNA were tested at 25 nM final concentration (FIG. 14). The siRNA were co-transfected with the pNP868R-SP6RNAP chimeric enzyme plasmid and the reporter pT7p-luciferase plasmid. Collectively, the POLR2A siRNA trend to increase the luciferase gene reporter expression by 127% on average, in comparison the same condition without siRNA. Similarly, the addition of RNGTT siRNA collectively increased the luciferase gene reporter expression to 147% on average in comparison the same condition without siRNA.

(87) The POLR2A SI04369344 and the RNGTT SI00055972 siRNA, which have show the highest stimulation rate, were selected for a second series of experiments. Expression of the luciferase reporter gene driven by NP868R-SP6RNAP was assayed in presence of siRNA at concentrations ranging from 0 to 100 nM (FIG. 15). Dose-response was observed with both siRNA. The strongest expression stimulation of 3.8-folds was observed at 100 nM with POLR2A SI04369344, and of 5.1-folds with the RNGTT SI00055972 siRNA at 100 nM.

(88) III. Conclusion

(89) The present findings demonstrate that the silencing of the cellular transcription and post-transcriptional machineries by siRNA stimulate the reporter gene expression driven by the NP868R-SP6RNAP chimeric enzyme.

BIBLIOGRAPHIC REFERENCES

(90) Bedzyk, W. D., K. M. Weidner, et al. (1990). Immunological and structural characterization of a high affinity anti-fluorescein single-chain antibody. J Biol Chem 265(30): 18615-18620. Bengal, E., 0. Flores, et al. (1991). Role of the mammalian transcription factors IIF, IIS, and IIX during elongation by RNA polymerase II. Mol Cell Biol 11(3): 1195-1206. Benton, B. M., W. K. Eng, et al. (1990). Signal-mediated import of bacteriophage T7 RNA polymerase into the Saccharomyces cerevisiae nucleus and specific transcription of target genes. Mol Cell Biol 10(1): 353-360. Bird, R. E., K. D. Hardman, et al. (1988). Single-chain antigen-binding proteins. Science 242(4877): 423-426. Bridgen, A. and R. M. Elliott (1996). Rescue of a segmented negative-strand RNA virus entirely from cloned complementary DNAs. Proc Natl Acad Sci USA 93(26): 15400-15404. Brisson, M., Y. He, et al. (1999). A novel T7 RNA polymerase autogene for efficient cytoplasmic expression of target genes. Gene Ther 6(2): 263-270. Busch, R., A. Pashine, et al. (2002). Stabilization of soluble, low-affinity HLA-DM/HLA-DR1 complexes by leucine zippers. J Immunol Methods 263(1-2): 111-121. Busch, R., Z. Reich, et al. (1998). Secondary structure composition and pH-dependent conformational changes of soluble recombinant HLA-DM. J Biol Chem 273(42): 27557-27564. Bushnell, D. A., P. Cramer, et al. (2002). Structural basis of transcription: alpha-amanitin-RNA polymerase II cocrystal at 2.8 A resolution. Proc Natl Acad Sci USA 99(3): 1218-1222. Chang, H. C., Z. Bao, et al. (1994). A general method for facilitating heterodimeric pairing between two proteins: application to expression of alpha and beta T-cell receptor extracellular segments. Proc Natl Acad Sci USA 91(24): 11408-11412. Chen, X., Y. Li, et al. (1994). A self-initiating eukaryotic transient gene expression system based on contransfection of bacteriophage T7 RNA polymerase and DNA vectors containing a T7 autogene. Nucleic Acids Res 22(11): 2114-2120. Chen, Z. and T. D. Schneider (2005). Information theory based T7-like promoter models: classification of bacteriophages and differential evolution of promoters and their polymerases. Nucleic Acids Res 33(19): 6172-6187. Cho, E. J., T. Takagi, et al. (1997). mRNA capping enzyme is recruited to the transcription complex by phosphorylation of the RNA polymerase II carboxy-terminal domain. Genes Dev 11(24): 3319-3326. Clayton, D. A. (1991). Replication and transcription of vertebrate mitochondrial DNA. Annu Rev Cell Biol 7: 453-478. Cong, P. and S. Shuman (1993). Covalent catalysis in nucleotidyl transfer. A KTDG motif essential for enzyme-GMP complex formation by mRNA capping enzyme is conserved at the active sites of RNA and DNA ligases. J Biol Chem 268(10): 7256-60. Cong, Y. S., D. Yarrow, et al. (1994). Linear DNA plasmids from Pichia etchellsii, Debaryomyces hansenii and Wingea robertsiae. Microbiology 140 (Pt 6): 1327-1335. Conzelmann, K. K. and M. Schnell (1994). Rescue of synthetic genomic RNA analogs of rabies virus by plasmid-encoded proteins. J Virol 68(2): 713-719. Crasto, C. J. and J. A. Feng (2000). LINKER: a program to generate linker sequences for fusion proteins. Protein Eng 13(5): 309-312. Cronan, J. E., Jr. (1990). Biotination of proteins in vivo. A post-translational modification to label, purify, and study proteins. J Biol Chem 265(18): 10327-33. Davanloo, P., A. H. Rosenberg, et al. (1984). Cloning and expression of the gene for bacteriophage T7 RNA polymerase. Proc Natl Acad Sci USA 81(7): 2035-2039. Dias, N. and C. A. Stein (2002). Antisense oligonucleotides: basic concepts and mechanisms. Mol Cancer Ther 1(5): 347-55. Dower, K. and M. Rosbash (2002). T7 RNA polymerase-directed transcripts are processed in yeast and link 3 end formation to mRNA nuclear export. Rna 8(5): 686-697. Drummond, D. R., J. Armstrong, et al. (1985). The effect of capping and polyadenylation on the stability, movement and translation of synthetic messenger RNAs in Xenopus oocytes. Nucleic Acids Res 13(20): 7375-7394. Elroy-Stein, O., T. R. Fuerst, et al. (1989). Cap-independent translation of mRNA conferred by encephalomyocarditis virus 5 sequence improves the performance of the vaccinia virus/bacteriophage T7 hybrid expression system. Proc Natl Acad Sci USA 86(16): 6126-6130. Elroy-Stein, O. and B. Moss (1990). Cytoplasmic expression system based on constitutive synthesis of bacteriophage T7 RNA polymerase in mammalian cells. Proc Natl Acad Sci USA 87(17): 6743-6747. Engleka, K. A., E. W. Lewis, et al. (1998). Mechanisms of replication-deficient vaccinia virus/T7 RNA polymerase hybrid expression: effect of T7 RNA polymerase levels and alpha-amanitin. Virology 243(2): 331-339. Epicentre Biotechnologies website. ScriptCap 2-O-Methyltransferase. Fancy, D. A. and T. Kodadek (1999). Chemistry for the analysis of protein-protein interactions: rapid and efficient cross-linking triggered by long wavelength light. Proc Natl Acad Sci USA 96(11): 6020-4. Fernandez-Silva, P., F. Martinez-Azorin, et al. (1997). The human mitochondrial transcription termination factor (mTERF) is a multizipper protein but binds to DNA as a monomer, with evidence pointing to intramolecular leucine zipper interactions. Embo J 16(5): 1066-1079. Finn, J., I. MacLachlan, et al. (2005). Factors limiting autogene-based cytoplasmic expression systems. Faseb J 19(6): 608-610. Fire, A., M. Samuels, et al. (1984). Interactions between RNA polymerase II, factors, and template leading to accurate transcription. J Biol Chem 259(4): 2509-2516. Fisher, R. P. and D. A. Clayton (1985). A transcription factor required for promoter recognition by human mitochondrial RNA polymerase. Accurate initiation at the heavy- and light-strand promoters dissected and reconstituted in vitro. J Biol Chem 260(20): 11330-11338. Fisher, R. P. and D. A. Clayton (1988). Purification and characterization of human mitochondrial transcription factor 1. Mol Cell Biol 8(8): 3496-3509. Fisher, R. P., J. N. Topper, et al. (1987). Promoter selection in human mitochondria involves binding of a transcription factor to orientation-independent upstream regulatory elements. Cell 50(2): 247-258. Fortes, P., Y. Cuevas, et al. (2003). Inhibiting expression of specific genes in mammalian cells with 5 end-mutated U1 small nuclear RNAs targeted to terminal exons of pre-mRNA. Proc Natl Acad Sci USA 100(14): 8264-9. Fuerst, T. R., P. L. Earl, et al. (1987). Use of a hybrid vaccinia virus-T7 RNA polymerase system for expression of target genes. Mol Cell Biol 7(7): 2538-2544. Fuerst, T. R., M. P. Fernandez, et al. (1989). Transfer of the inducible lac repressor/operator system from Escherichia coli to a vaccinia virus expression vector. Proc Natl Acad Sci USA 86(8): 2549-2553. Fuerst, T. R. and B. Moss (1989). Structure and stability of mRNA synthesized by vaccinia virus-encoded bacteriophage T7 RNA polymerase in mammalian cells. Importance of the 5 untranslated leader. J Mol Biol 206(2): 333-348. Fuerst, T. R., E. G. Niles, et al. (1986). Eukaryotic transient-expression system based on recombinant vaccinia virus that synthesizes bacteriophage T7 RNA polymerase. Proc Natl Acad Sci USA 83(21): 8122-8126. Furuichi, Y., A. LaFiandra, et al. (1977). 5-Terminal structure and mRNA stability. Nature 266(5599): 235-239. Furuichi, Y. and A. J. Shatkin (2000). Viral and cellular mRNA capping: past and prospects. Adv Virus Res 55: 135-184. Gallie, D. R. (1991). The cap and poly(A) tail function synergistically to regulate mRNA translational efficiency. Genes Dev 5(11): 2108-2116. Gao, X. and L. Huang (1993). Cytoplasmic expression of a reporter gene by co-delivery of T7 RNA polymerase and T7 promoter sequence with cationic liposomes. Nucleic Acids Res 21(12): 2867-2872. Garcin, D., T. Pelet, et al. (1995). A highly recombinogenic system for the recovery of infectious Sendai paramyxovirus from cDNA: generation of a novel copy-back nondefective interfering virus. Embo J 14(24): 6087-6094. Ghosh, I., A. D. Hamilton, et al. (2000). Antiparallel Leucine Zipper-Directed Protein Reassembly:&nbsp; Application to the Green Fluorescent Protein. Journal of the American Chemical Society 122(23): 5658-5659. Gilbert, W. and A. Maxam (1973). The nucleotide sequence of the lac operator. Proc Natl Acad Sci USA 70(12): 3581-3584. Gill, D. R., S. E. Smyth, et al. (2001). Increased persistence of lung gene expression using plasmids containing the ubiquitin C or elongation factor 1alpha promoter. Gene Ther 8(20): 1539-1546. Gingras, A. C., B. Raught, et al. (1999). eIF4 initiation factors: effectors of mRNA recruitment to ribosomes and regulators of translation. Annu Rev Biochem 68: 913-963. Golomb, M. and M. Chamberlin (1974). Characterization of T7-specific ribonucleic acid polymerase. IV. Resolution of the major in vitro transcripts by gel electrophoresis. J Biol Chem 249(9): 2858-2863. Gong, C. and S. Shuman (2003). Mapping the active site of vaccinia virus RNA triphosphatase. Virology 309(1): 125-34. Gregoire, C., S. Y. Lin, et al. (1996). Covalent assembly of a soluble T cell receptor-peptide-major histocompatibility class I complex. Proc Natl Acad Sci USA 93(14): 7184-7189. Gustavsson, M., J. Lehtio, et al. (2001). Stable linker peptides for a cellulose-binding domain-lipase fusion protein expressed in Pichia pastoris. Protein Eng 14(9): 711-715. Han, Y. T., C. S. Tsai, et al. (2007). Mutational analysis of a helicase motif-based RNA 5-triphosphatase/NTPase from bamboo mosaic virus. Virology. Hennecke, F., C. Krebber, et al. (1998). Non-repetitive single-chain Fv linkers selected by selectively infective phage (SIP) technology. Protein Eng 11(5): 405-410. Higman, M. A., N. Bourgeois, et al. (1992). The vaccinia virus mRNA (guanine-N7-)-methyltransferase requires both subunits of the mRNA capping enzyme for activity. J Biol Chem 267(23): 16430-7. Higman, M. A., L. A. Christen, et al. (1994). The mRNA (guanine-7-)methyltransferase domain of the vaccinia virus mRNA capping enzyme. Expression in Escherichia coli and structural and kinetic comparison to the intact capping enzyme. J Biol Chem 269(21): 14974-81. Higman, M. A. and E. G. Niles (1994). Location of the S-adenosyl-L-methionine binding region of the vaccinia virus mRNA (guanine-7-)methyltransferase. J Biol Chem 269(21): 14982-7. Hu, W., F. Li, et al. (2004). A flexible peptide linker enhances the immunoreactivity of two copies HBsAg preS1 (21-47) fusion protein. J Biotechnol 107(1): 83-90. Huang, Y. and J. A. Steitz (2005). SRprises along a messenger's journey. Mol Cell 17(5): 613-615. Huston, J. S., D. Levinson, et al. (1988). Protein engineering of antibody binding sites: recovery of specific activity in an anti-digoxin single-chain Fv analogue produced in Escherichia coli. Proc Natl Acad Sci USA 85(16): 5879-5883. Izban, M. G. and D. S. Luse (1992). Factor-stimulated RNA polymerase II transcribes at physiological elongation rates on naked DNA but very poorly on chromatin templates. J Biol Chem 267(19): 13647-13655. Jacob, S. T., E. M. Sajdel, et al. (1970). Specific action of alpha-amanitin on mammalian RNA polymerase protein. Nature 225(5227): 60-62. Kedinger, C., M. Gniazdowski, et al. (1970). Alpha-amanitin: a specific inhibitor of one of two DNA-pendent RNA polymerase activities from calf thymus. Biochem Biophys Res Commun 38(1): 165-171. Kohler, A. and E. Hurt (2007). Exporting RNA from the nucleus to the cytoplasm. Nat Rev Mol Cell Biol 8(10): 761-773. Komarnitsky, P., E. J. Cho, et al. (2000). Different phosphorylated forms of RNA polymerase II and associated mRNA processing factors during transcription. Genes Dev 14(19): 2452-2460. Kozak, M. (1987). At least six nucleotides preceding the AUG initiator codon enhance translation in mammalian cells. J Mol Biol 196(4): 947-950. Kozak, M. (2005). Regulation of translation via mRNA structure in prokaryotes and eukaryotes. Gene 361: 13-37. Kruse, B., N. Narasimhan, et al. (1989). Termination of transcription in human mitochondria: identification and purification of a DNA binding protein factor that promotes termination. Cell 58(2): 391-397. Kuge, H., G. G. Brownlee, et al. (1998). Cap ribose methylation of c-mos mRNA stimulates translation and oocyte maturation in Xenopus laevis. Nucleic Acids Res 26(13): 3208-3214. Kupper, H. A., W. T. McAllister, et al. (1973). Comparison of Escherichia coli and T3 RNA polymerases. Differential inhibition of transcription by various drugs. Eur J Biochem 38(3): 581-586. Lamla, T. and V. A. Erdmann (2004). The Nano-tag, a streptavidin-binding peptide for the purification and detection of recombinant proteins. Protein Expr Purif 33(1): 39-47. Lang, I., M. Scholz, et al. (1986). Molecular mobility and nucleocytoplasmic flux in hepatoma cells. J Cell Biol 102(4): 1183-1190. Langberg, S. R. and B. Moss (1981). Post-transcriptional modifications of mRNA. Purification and characterization of cap I and cap II RNA (nucleoside-2-)-methyltransferases from HeLa cells. J Biol Chem 256(19): 10054-10060. Lee, D. N., L. Phung, et al. (1990). Transcription pausing by Escherichia coli RNA polymerase is modulated by downstream DNA sequences. J Biol Chem 265(25): 15145-15153. Li, Y. I., Y. J. Chen, et al. (2001). Characterization of the AdoMet-dependent guanylyltransferase activity that is associated with the N terminus of bamboo mosaic virus replicase. J Virol 75(2): 782-788. Li, Y. I., Y. M. Cheng, et al. (1998). Identification and characterization of the Escherichia coli-expressed RNA-dependent RNA polymerase of bamboo mosaic virus. J Virol 72(12): 10093-10099. Li, Y. I., T. W. Shih, et al. (2001). The helicase-like domain of plant potexvirus replicase participates in formation of RNA 5 cap structure by exhibiting RNA 5-triphosphatase activity. J Virol 75(24): 12114-12120. Lian, Y., M. B. De Young, et al. (1999). The sCYMV1 hairpin ribozyme: targeting rules and cleavage of heterologous RNA. Gene Ther 6(6): 1114-9. Lieschke, G. J., P. K. Rao, et al. (1997). Bioactive murine and human interleukin-12 fusion proteins which retain antitumor activity in vivo. Nat Biotechnol 15(1): 35-40. Lindell, T. J., F. Weinberg, et al. (1970). Specific inhibition of nuclear RNA polymerase II by alpha-amanitin. Science 170(956): 447-449. Lisser, S. and H. Margalit (1993). Compilation of E. coli mRNA promoter sequences. Nucleic Acids Res 21(7): 1507-1516. Liu, Z. and G. G. Carmichael (1994). Nuclear antisense RNA. An efficient new method to inhibit gene expression. Mol Biotechnol 2(2): 107-18. Liu, Z., J. Jian-Bo, et al. (2005). Anti-proteolysis Study of Recombinant IIn-UK Fusion Protein in CHO Cell Prog. Biochem. Biophys 32(6): 544-550. Lo, H. J., H. K. Huang, et al. (1998). RNA polymerase I-promoted HIS4 expression yields uncapped, polyadenylated mRNA that is unstable and inefficiently translated in Saccharomyces cerevisiae. Mol Cell Biol 18(2): 665-675. Lodish, H., A. Berk, et al. (2008). Molecular Cell Biology. New York, USA, Freeman, W. H. and Co. Loser, P., G. S. Jennings, et al. (1998). Reactivation of the previously silenced cytomegalovirus major immediate-early promoter in the mouse liver: involvement of NFkappaB. J Virol 72(1): 180-190. Lumb, K. J. and P. S. Kim (1995). A buried polar interaction imparts structural uniqueness in a designed heterodimeric coiled coil. Biochemistry 34(27): 8642-8. Lyakhov, D. L., B. He, et al. (1997). Mutant bacteriophage T7 RNA polymerases with altered termination properties. J Mol Biol 269(1): 28-40. Makarova, O. V., E. M. Makarov, et al. (1995). Transcribing of Escherichia coli genes with mutant T7 RNA polymerases: stability of lacZ mRNA inversely correlates with polymerase speed. Proc Natl Acad Sci USA 92(26): 12250-12254. Malone, R. W., P. L. Felgner, et al. (1989). Cationic liposome-mediated RNA transfection. Proc Natl Acad Sci USA 86(16): 6077-6081. Mantile, G., C. Fuchs, et al. (2000). Stable, long-term bacterial production of soluble, dimeric, disulfide-bonded protein pharmaceuticals without antibiotic selection. Biotechnol Prog 16(1): 17-25. Mao, X. and S. Shuman (1994). Intrinsic RNA (guanine-7) methyltransferase activity of the vaccinia virus capping enzyme D1 subunit is stimulated by the D12 subunit. Identification of amino acid residues in the D1 protein required for subunit association and methyl group transfer. J Biol Chem 269(39): 24472-9. Martinez-Costas, J., G. Sutton, et al. (1998). Guanylyltransferase and RNA 5-triphosphatase activities of the purified expressed VP4 protein of bluetongue virus. J Mol Biol 280(5): 859-866. McClain, D. L., H. L. Woods, et al. (2001). Design and characterization of a heterodimeric coiled coil that forms exclusively with an antiparallel relative helix orientation. J Am Chem Soc 123(13): 3151-3152. McCracken, S., N. Fong, et al. (1997). 5-Capping enzymes are targeted to pre-mRNA by binding to the phosphorylated carboxy-terminal domain of RNA polymerase II. Genes Dev 11(24): 3306-3318. McCulloch, V., B. L. Seidel-Rogol, et al. (2002). A human mitochondrial transcription factor is related to RNA adenine methyltransferases and binds S-adenosylmethionine. Mol Cell Biol 22(4): 1116-1125. Miao, C. H., A. R. Thompson, et al. (2001). Long-term and therapeutic-level hepatic gene expression of human factor IX after naked plasmid transfer in vivo. Mol Ther 3(6): 947-957. Miao, C. H., X. Ye, et al. (2003). High-level factor VIII gene expression in vivo achieved by nonviral liver-specific gene therapy vectors. Hum Gene Ther 14(14): 1297-1305. Mifflin, R. C. and R. E. Kellems (1991). Coupled transcription-polyadenylation in a cell-free system. J Biol Chem 266(29): 19593-19598. Moffatt, B. A., J. J. Dunn, et al. (1984). Nucleotide sequence of the gene for bacteriophage T7 RNA polymerase. J Mol Biol 173(2): 265-269. Moll, J. R., S. B. Ruvinov, et al. (2001). Designed heterodimerizing leucine zippers with a ranger of pls and stabilities up to 10(15) M. Protein Sci 10(3): 649-55. Natalizio, B. J., N. D. Robson-Dixon, et al. (2009). The Carboxyl-terminal Domain of RNA Polymerase II Is Not Sufficient to Enhance the Efficiency of Pre-mRNA Capping or Splicing in the Context of a Different Polymerase. J Biol Chem 284(13): 8692-8702. Newton, D. L., Y. Xue, et al. (1996). Angiogenin single-chain immunofusions: influence of peptide linkers and spacers between fusion protein domains. Biochemistry 35(2): 545-553. Nicol, F., M. Wong, et al. (2002). Poly-L-glutamate, an anionic polymer, enhances transgene expression for plasmids delivered by intramuscular injection with in vivo electroporation. Gene Ther 9(20): 1351-1358. Niles, E. G. and L. Christen (1993). Identification of the vaccinia virus mRNA guanyltransferase active site lysine. J Biol Chem 268(33): 24986-9. O'Shea, E. K., J. D. Klemm, et al. (1991). X-ray structure of the GCN4 leucine zipper, a two-stranded, parallel coiled coil. Science 254(5031): 539-544. O'Shea, E. K., K. J. Lumb, et al. (1993). Peptide Velcro: design of a heterodimeric coiled coil. Curr Biol 3(10): 658-667. Oakley, M. G. and P. S. Kim (1998). A buried polar interaction can direct the relative orientation of helices in a coiled coil. Biochemistry 37(36): 12603-12610. Ojala, D., J. Montoya, et al. (1981). tRNA punctuation model of RNA processing in human mitochondria. Nature 290(5806): 470-474. Osumi-Davis, P. A., M. C. de Aguilera, et al. (1992). Asp537, Asp812 are essential and Lys631, His811 are catalytically significant in bacteriophage T7 RNA polymerase activity. J Mol Biol 226(1): 37-45. Osumi-Davis, P. A., N. Sreerama, et al. (1994). Bacteriophage T7 RNA polymerase and its active-site mutants. Kinetic, spectroscopic and calorimetric characterization. J Mol Biol 237(1): 5-19. Paguirigan, A. L. and D. J. Beebe (2007). Protocol for the fabrication of enzymatically crosslinked gelatin microchannels for microfluidic cell culture. Nat Protoc 2(7): 1782-8. Palancade, B. and O. Bensaude (2003). Investigating RNA polymerase II carboxyl-terminal domain (CTD) phosphorylation. Eur J Biochem 270(19): 3859-3870. Pantoliano, M. W., R. E. Bird, et al. (1991). Conformational stability, folding, and ligand-binding affinity of single-chain Fv immunoglobulin fragments expressed in Escherichia coli. Biochemistry 30(42): 10117-10125. Pashine, A., R. Busch, et al. (2003). Interaction of HLA-DR with an acidic face of HLA-DM disrupts sequence-dependent interactions with peptides. Immunity 19(2): 183-192. Patil, S. D., D. G. Rhodes, et al. (2004). Anionic liposomal delivery system for DNA transfection. Aaps J 6(4): e29. Pavlinkova, G., G. W. Beresford, et al. (1999). Pharmacokinetics and biodistribution of engineered single-chain antibody constructs of MAb CC49 in colon carcinoma xenografts. J Nucl Med 40(9): 1536-1546. Platt, T. (1986). Transcription termination and the regulation of gene expression. Annu Rev Biochem 55: 339-372. Prieto-Martin, A., J. Montoya, et al. (2001). A study on the human mitochondrial RNA polymerase activity points to existence of a transcription factor B-like protein. FEBS Lett 503(1): 51-55. Ramadevi, N., N. J. Burroughs, et al. (1998). Capping and methylation of mRNA by purified recombinant VP4 protein of bluetongue virus. Proc Natl Acad Sci USA 95(23): 13537-13542. Ramadevi, N., J. Rodriguez, et al. (1998). A leucine zipper-like domain is essential for dimerization and encapsidation of bluetongue virus nucleocapsid protein VP4. J Virol 72(4): 2983-2990. Ramsey-Ewing, A. and B. Moss (1996). Recombinant protein synthesis in Chinese hamster ovary cells using a vaccinia virus/bacteriophage T7 hybrid expression system. J Biol Chem 271(28): 16962-16966. Rhoads, R. E. (1999). Signal transduction pathways that regulate eukaryotic protein synthesis. J Biol Chem 274(43): 30337-30340. Robinson, C. R. and R. T. Sauer (1998). Optimizing the stability of single-chain proteins by linker length and composition mutagenesis. Proc Natl Acad Sci USA 95(11): 5929-5934. Salehi-Ashtiani, K. and J. W. Szostak (2001). In vitro evolution suggests multiple origins for the hammerhead ribozyme. Nature 414(6859): 82-4. Schmidt, T. G. and A. Skerra (1993). The random peptide library-assisted engineering of a C-terminal affinity peptide, useful for the detection and purification of a functional Ig Fv fragment. Protein Eng 6(1): 109-22. Schroeder, S. C., B. Schwer, et al. (2000). Dynamic association of capping enzymes with transcribing RNA polymerase II. Genes Dev 14(19): 2435-2440. Schurer, H., K. Lang, et al. (2002). A universal method to produce in vitro transcripts with homogeneous 3 ends. Nucleic Acids Res 30(12): e56. Shao, W. H., X. E. Zhang, et al. (2000). Anchor-chain molecular system for orientation control in enzyme immobilization. Bioconjug Chem 11(6): 822-826. Spehner, D., S. Gillard, et al. (1988). A cowpox virus gene required for multiplication in Chinese hamster ovary cells. J Virol 62(4): 1297-1304. Studier, F. W., A. H. Rosenberg, et al. (1990). Use of T7 RNA polymerase to direct expression of cloned genes. Methods Enzymol 185: 60-89. Tang, Y., N. Jiang, et al. (1996). Selection of linkers for a catalytic single-chain antibody using phage display technology. J Biol Chem 271(26): 15682-15686. Ting, A. (2003). Genetically encoded fluorescent reporters of kinase, methyltransferase, and acetyl-transferase activities. Ting, A. Y., K. H. Kain, et al. (2001). Genetically encoded fluorescent reporters of protein tyrosine kinase activities in living cells. Proc Natl Acad Sci USA 98(26): 15003-15008. Tiranti, V., A. Savoia, et al. (1997). Identification of the gene encoding the human mitochondrial RNA polymerase (h-mtRPOL) by cyberscreening of the Expressed Sequence Tags database. Hum Mol Genet 6(4): 615-625. Tommasino, M., S. Ricci, et al. (1988). Genome organization of the killer plasmid pGK12 from Kluyveromyces lactis. Nucleic Acids Res 16(13): 5863-5878. Topper, J. N. and D. A. Clayton (1989). Identification of transcriptional regulatory elements in human mitochondrial DNA by linker substitution analysis. Mol Cell Biol 9(3): 1200-1211. Turner, D. J., M. A. Ritter, et al. (1997). Importance of the linker in expression of single-chain Fv antibody fragments: optimisation of peptide sequence using phage display technology. J Immunol Methods 205(1): 43-54. Ucker, D. S. and K. R. Yamamoto (1984). Early events in the stimulation of mammary tumor virus RNA synthesis by glucocorticoids. Novel assays of transcription rates. J Biol Chem 259(12): 7416-7420. Uptain, S. M. and M. J. Chamberlin (1997). Escherichia coli RNA polymerase terminates transcription efficiently at rho-independent terminators on single-stranded DNA templates. Proc Natl Acad Sci USA 94(25): 13548-13553. Walker, S. C., J. M. Avis, et al. (2003). General plasmids for producing RNA in vitro transcripts with homogeneous ends. Nucleic Acids Res 31(15): e82. Wells, J. A. and D. B. Powers (1986). In vivo formation and stability of engineered disulfide bonds in subtilisin. J Biol Chem 261(14): 6564-6570. Whitlow, M., B. A. Bell, et al. (1993). An improved linker for single-chain Fv with reduced aggregation and enhanced proteolytic stability. Protein Eng 6(8): 989-995. Wickham, T. J., M. E. Carrion, et al. (1995). Targeting of adenovirus penton base to new receptors through replacement of its RGD motif with other receptor-specific peptide motifs. Gene Ther 2(10): 750-756. Wu, S. C., J. C. Yeung, et al. (2002). Design, production, and characterization of an engineered biotin ligase (BirA) and its application for affinity purification of staphylokinase produced from Bacillus subtilis via secretion. Protein Expr Purif 24(3): 357-65. Wyatt, L. S., B. Moss, et al. (1995). Replication-deficient vaccinia virus encoding bacteriophage T7 RNA polymerase for transient gene expression in mammalian cells. Virology 210(1): 202-205. Yue, Z., E. Maldonado, et al. (1997). Mammalian capping enzyme complements mutant Saccharomyces cerevisiae lacking mRNA guanylyltransferase and selectively binds the elongating form of RNA polymerase II. Proc Natl Acad Sci USA 94(24): 12898-12903. Zabner, J., A. J. Fasbender, et al. (1995). Cellular and molecular barriers to gene transfer by a cationic lipid. J Biol Chem 270(32): 18997-19007. Zhang, X. and F. W. Studier (1997). Mechanism of inhibition of bacteriophage T7 RNA polymerase by T7 lysozyme. J Mol Biol 269(1): 10-27.