Means and methods for counteracting myeloproliferative or lymphoproliferative disorders
11629200 · 2023-04-18
Assignee
Inventors
- Hergen Spits (Amsterdam Zuidoost, NL)
- Tim Beaumont (Amsterdam Zuidoost, NL)
- Marijn Aletta GILLISSEN (Amsterdam Zuidoost, NL)
- Adrianus Quirinus Bakker (Amsterdam Zuidoost, NL)
- Mette Deborah HAZENBERG (Amsterdam Zuidoost, NL)
- Martijn KEDDE (Amsterdam Zuidoost, NL)
Cpc classification
A61K47/6851
HUMAN NECESSITIES
C07K2317/33
CHEMISTRY; METALLURGY
C07K2317/732
CHEMISTRY; METALLURGY
C07K2317/73
CHEMISTRY; METALLURGY
G01N33/57492
PHYSICS
A61P35/00
HUMAN NECESSITIES
International classification
A61K47/68
HUMAN NECESSITIES
Abstract
The invention provides human AML-specific binding compounds that are able to bind a cell surface component of AML cells. Therapeutic uses of binding compounds against AML are also provided.
Claims
1. A synthetic or recombinant nucleic acid molecule or functional equivalent thereof, comprising: a sequence encoding the heavy chain CDR1 sequence of SEQ ID NO: 209, and a sequence encoding the heavy chain CDR2 sequence of SEQ ID NO: 213, and a sequence encoding the heavy chain CDR3 sequence of SEQ ID NO: 217, and a sequence encoding the light chain CDR1 sequence of SEQ ID NO: 221, and a sequence encoding the light chain CDR2 sequence of SEQ ID NO: 225, and a sequence encoding the light chain CDR3 sequence of SEQ ID NO: 229.
2. The synthetic or recombinant nucleic acid molecule or functional equivalent of claim 1 comprising: a heavy chain CDR1 encoding nucleic acid sequence which has at least 90% sequence identity to SEQ ID NO: 241, and a heavy chain CDR2 encoding nucleic acid sequence which has at least 90% sequence identity to SEQ ID NO: 245, and a heavy chain CDR3 encoding nucleic acid sequence which has at least 90% sequence identity to SEQ ID NO: 249, and a light chain CDR1 encoding nucleic acid sequence which has at least 90% sequence identity to SEQ ID NO: 253, and a light chain CDR2 encoding nucleic acid sequence which has at least 90% sequence identity to SEQ ID NO: 257, and a light chain CDR3 encoding nucleic acid sequence which has at least 90% sequence identity to SEQ ID NO: 261.
3. The synthetic or recombinant nucleic acid molecule or functional equivalent of claim 1 comprising: a heavy chain encoding nucleic acid sequence which has at least 90% sequence identity to SEQ ID NO: 265, and/or a light chain encoding nucleic acid sequence which has at least 90% sequence identity to SEQ ID NO: 269.
4. The nucleic acid molecule or functional equivalent of claim 1, comprising cDNA, peptide nucleic acid (PNA), locked nucleic acid (LNA), or a DNA/RNA helix.
5. The nucleic acid molecule or functional equivalent of claim 1, wherein the nucleic acid molecule or functional equivalent is codon-optimized for a non-human expression system.
6. A vector comprising: a nucleic acid sequence or functional equivalent thereof encoding the heavy chain CDR1 sequence of SEQ ID NO: 209, and a nucleic acid sequence or functional equivalent thereof encoding the heavy chain CDR2 sequence of SEQ ID NO: 213, and a nucleic acid sequence or functional equivalent thereof encoding the heavy chain CDR3 sequence of SEQ ID NO: 217, and a nucleic acid sequence or functional equivalent thereof encoding the light chain CDR1 sequence of SEQ ID NO: 221, and a nucleic acid sequence or functional equivalent thereof encoding the light chain CDR2 sequence of SEQ ID NO: 225, and a nucleic acid sequence or functional equivalent thereof encoding the light chain CDR3 sequence of SEQ ID NO: 229.
7. The vector of claim 6, comprising a nucleic acid sequence encoding the VH and/or VL of antibody AT14-013.
8. The vector of claim 6, wherein the vector is a retroviral or lentiviral vector.
9. A composition comprising one or more nucleic acid molecules or functional equivalents thereof, comprising: a sequence encoding the heavy chain CDR1 sequence of SEQ ID NO: 209, and a sequence encoding the heavy chain CDR2 sequence of SEQ ID NO: 213, and a sequence encoding the heavy chain CDR3 sequence of SEQ ID NO: 217, and a sequence encoding the light chain CDR1 sequence of SEQ ID NO: 221, and a sequence encoding the light chain CDR2 sequence of SEQ ID NO: 225, and a sequence encoding the light chain CDR3 sequence of SEQ ID NO: 229.
10. The composition of claim 9, wherein the composition is a pharmaceutical composition which comprises a pharmaceutically acceptable carrier, diluent or excipient.
11. The composition of claim 9, wherein the composition is for use as a medicament or prophylactic agent.
12. The composition of claim 9, wherein the composition is for use in a method for at least in part treating or preventing a myeloproliferative or lymphoproliferative disorder.
13. The composition of claim 9, wherein the composition is for use in diagnosis of a myeloproliferative or lymphoproliferative disorder.
14. The composition of claim 13, wherein the myeloproliferative disorder is acute myeloid leukemia (AML).
15. The composition of claim 13, wherein the lymphoproliferative disorder is lymphoma, B non-Hodgkin lymphoma or multiple myeloma.
16. A host cell comprising one or more nucleic acid molecules or functional equivalents thereof, comprising: a sequence encoding the heavy chain CDR1 sequence of SEQ ID NO: 209, and a sequence encoding the heavy chain CDR2 sequence of SEQ ID NO: 213, and a sequence encoding the heavy chain CDR3 sequence of SEQ ID NO: 217, and a sequence encoding the light chain CDR1 sequence of SEQ ID NO: 221, and a sequence encoding the light chain CDR2 sequence of SEQ ID NO: 225, and a sequence encoding the light chain CDR3 sequence of SEQ ID NO: 229.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
(24)
(25)
(26)
(27)
(28)
EXAMPLES
Example 1
(29) Materials & Methods
(30) Patient and Healthy Human Materials
(31) Study protocols were approved by the Medical Ethical Committee of the Academic Medical Centre. All participants signed informed consent. We selected two patients who had received an allogeneic stem cell transplantation (myeloablative sibling transplant for donor 59 and a matched unrelated donor-reduced intensity stem cell transplantation for donor 58) for AML and who, based on their clinical histories, can be assumed to have generated strong graft versus leukemia responses. These two SCT recipients donated 500 ml peripheral blood each, the products of one of many phlebotomies they underwent for post-transfusion hyperferritinemia. In addition, patients admitted to our clinic with newly diagnosed AML consented to donate 2-5 ml bone marrow or blood containing AML blasts to be used for antibody binding assays. Healthy bone marrow was donated by patients undergoing thoracotomy for cardiac surgery in our institute. B-non Hodgkin's lymphoma cells were obtained as rest material from biopsies of patients with newly diagnosed B-non Hodgkin's lymphoma. These B-non Hodgkin's lymphoma cells were used to test for binding of our antibodies as described below. Rest material of human umbilical vein endothelial cells (HUVECS), that were freshly isolated at the Department of Ophthalmology (AMC, Amsterdam, The Netherlands) were directly used for binding assays as described below. For purity, cells were co stained with and selected for anti human CD14+.
(32) Mononuclear cells were isolated from peripheral blood and bone marrow of healthy individuals and AML patients by Ficoll separation. Extra markers like CD45, CD33, CD34, CD14, CD3 and CD19 were used to isolate specific cell populations (AML blasts, monocytes, T and B lymphocytes, respectively, obtained from blood bank donors).
(33) Isolation of B Cells
(34) We obtained B cells from peripheral blood by Ficoll separation and CD22 MACS microbeads (Miltenyi Biotech). Subsequently we sorted these cells for CD27− or CD27+CD19+CD3−IgM−IgA− (naïve or memory IgG cells, respectively) and CD19+CD3−CD27+IgG−IgA− (memory IgM cells) on a FACSAria (Becton Dickinson).
(35) Cell Culture
(36) We maintained B cells (2×10.sup.5 cells/ml) in IMDM (Gibco) culture medium containing 8% FBS (HyClone) and penicillin/streptomycin (Roche), supplemented with recombinant mouse IL-21 (50 ng/ml, in house produced) and co-cultured them on γ-irradiated (50Gy) mouse L cell fibroblasts stably expressing CD40L (CD40L-L cells, 10.sup.5 cells/ml). The cultures were tested routinely for the presence of mycoplasma by PCR (data not shown).
(37) Retroviral Transduction
(38) Retroviral transduction was performed as described in Kwakkenbos ea, Nat Med 2010. Briefly, naïve and memory IgG and memory IgM B cells were cultured and activated during 36 hours on CD40L-L cells in the presence of mIL-21. Then, BCL6 and Bel-xL retroviral constructs that include the marker gene for GFP were used to transduce the B cells as described before (Diehl ea, J Immunol 2008), with the addition that we centrifuged cells and virus at room temperature for 60 min at 360×g (1800 RPM). Transduction efficiency ranged from 69-90%.
(39) Culture of Target Cell Lines
(40) Target AML cell lines THP-1 (ATCC; density of 2×10.sup.5 cells/ml to 1×10.sup.6 cells/ml) and Mono-Mac6 (a kind gift from Dr. Hamann of the Experimental Immunology department, density of 2×10.sup.5 cells/ml to 2×10.sup.6 cells/ml) were maintained in RPMI 1640 (Gibco) culture medium, containing 10% FBS (HyClone) and penicillin/streptomycin (Roche). Culture medium of Mono-Mac6 was enriched with non-essential amino acids (Invitrogen), 1 mM sodium pyruvate (Invitrogen) and 10 μg/ml human insulin (Sigma). The AML cell line Molm13 was maintained at a density of 5×10.sup.5 cells/ml to 1.5×10.sup.6 cells/ml in RPMI 1640 (Gibco) culture medium, containing 20% FBS (HyClone) and penicillin/streptomycin (Roche). The liver cell lines HepG2 and Huh7 and the colon cell line HT29 (a kind gift from the Tytgat Institute, AMC, Amsterdam, The Netherlands) were cultured in DMEM (Gibco) culture medium, containing 8% FBS (HyClone) and penicillin/streptomycin (Roche). The acute T-cell leukemia cell line Jurkat (ATCC) was maintained in RPMI 1640 (Gibco) culture medium, containing 10% FBS (HyClone) and penicillin/streptomycin (Roche) at a density of 1×10.sup.5 cells/ml to 2×10.sup.6 cells/ml. Skin primary fibroblasts (a kind gift of the University of Leiden, The Netherlands) were cultured twice a week in DMEM (Gibco) culture medium, containing 10% FBS (HyClone) and penicillin/streptomycin (Roche). Cells were passaged no more then 10 times. The diffuse large cell B cell lymphoma (DLBCL) cell lines OCI-Ly1 and OCI-Ly7 (DSMZ and ATCC, respectively) were maintained in IMDM (Gibco) culture medium containing 8% FBS (HyClone) and penicillin/streptomycin (Roche). The cultures were maintained at 0.5-2×10.sup.6 cells/ml. Finally, the multiple myeloma (MM) cell lines U266 and NCI-H929 were maintained and cultured as described for THP-1 cells.
(41) Generation of AML-Specific Clones
(42) Transduced naïve and memory IgG and IgM B cells of each patient were seeded at concentrations of 20 or 40 cells per well (hereafter named microcultures) and expanded with IL-21 and CD40L. Supernatants of expanded B cell micro cultures were then screened for antibody binding to leukemia cell lines (THP-1, MonoMac6 and the cell lines depicted in Table 4), to liver- and colon cell lines, and some supernatants also to the primary blasts isolated from patients with AML-M0, M1, M4 and M5, by FACS, using human-IgG-PE (Southern Biotech) or human IgG H+L AF647 (Life Technologies) as a secondary antibody. Several in-house generated antibodies were used as negative control antibodies, such as anti-CD30 (expressed on activated B and T lymphocytes), anti-CD33 (expressed on monocytes, myeloid progenitor cells and myeloid leukaemias), D25 (against RSV; described in WO 2008/147196), AT10-002, AT10-004 (against influenza; described in WO 2013/081463), and F1 (against MRSA; described in WO 2011/008092). In addition, some commercially available antibodies were used, such as Rituximab (anti-CD20), Palivizumab (anti-RSV), Panitumumab (anti-EGFR) and HLA-DR. Microcultures binding to AML cell lines but not to liver- and colon cell lines were selected and seeded at a concentration of 1 cell/well and their supernatants tested again for specificity for AML cell lines. Clones with supernatants specifically binding AML cell lines and not liver- or colon cell lines, or healthy PBMC and bone marrow were selected for sequencing. Clones were expanded under normal culture conditions in the presence of FBS IgG low serum (Hyclone) and antibodies purified from the supernatants of these cultures as described below for the recombinant antibodies.
(43) Cloning of AML-Specific Antibodies
(44) To produce recombinant antibodies we isolated total RNA with the RNeasy® mini kit (Qiagen), generated cDNA, performed PCR and cloned the heavy and light chain variable regions into the pCR2.1 TA cloning vector (Invitrogen). To rule out reverse transcriptase or DNA polymerase induced mutations, we performed several independent cloning experiments. To produce recombinant mAb we cloned heavy and light variable regions of each antibody in frame with human IgG1 or IgG3 and Kappa constant regions into a pcDNA3.1 (Invitrogen) based vector and transiently transfected 293T cells. We purified recombinant antibodies from the culture supernatant with Protein A or G, depending on the Ig subtype of the clone.
(45) In Vitro Activity of AML-Specific Antibodies
(46) To measure the in vitro effect of AML-specific antibodies on AML cells we used several approaches. First, THP-1 cells (2×10.sup.4) were seeded in flat bottom 96 well plates (Costar). AML or control-antibodies were added on day 1, in a concentration of 5-10 μg/ml. Numbers of cells per well were counted daily. Induction of cell death on both THP-1 cells and primary leukemic cells by AML-specific antibodies was measured in parallel by costaining an aliquot of cells for Annexin V (BD Pharmingen) and 7-Aminoactinomycin D (7-AAD; Beckman Coulter), double-negative cells being the viable cells. In addition, we used a specific lysis assay. Target cells (THP-1) were labeled with Calcein AM (Becton Dickinson), a green fluorescent dye that is released from the cytoplasm when cells die. Briefly, 2 million THP-1 cells were incubated with 2 ml of 2 μM Calcein AM for 30 minutes at 37° C. AML or control antibodies were added for 4 hours, after which green fluorescence was measured using a fluorescence plate reader. The proportion of specific lysis was calculated as (experimental value-low control)/(high control-low control)×100, where low control means the spontaneous release of Calcein AM by unaffected cells and high control means the maximum amount of released Calcein AM when all cells are lysed. In addition to the Calcein AM release assay we applied the lactate dehydrogenase (LDH) release assay to measure the killing activity of AML specific antibodies. LDH is released by damaged cells, from the cytosol. Leukemic blasts, isolated at diagnosis from a patient with AML-M0, were incubated with AT13-024 at a maximum concentration of 10 μg/ml per 10.000 blasts. LDH release is measured after adding Reaction mixture and Stop Solution (Roche Diagnostics/Applied Science) according to the manufacturer's protocol on an ELISA reader. The percent cytotoxicity is calculated as the (experimental value-low control)/(high control-low control)×100, where low control means the spontaneous release of LDH by unaffected cells and high control means the maximum amount of LDH when all cells are lysed. To quantify death of target cells induced by AML-specific antibodies we used a FACS-based leukemia cell lysis assay as previously described (Schmiedel et al, 2013). In brief, FACS calibration beads (Accudrop Fluorescent Beads, BD Biosciences) were added to the cells in a 50/50 ratio after which a standard amount of beads was acquired with FACS. As an equal assay volume was ascertained by the calibration beads, the amount of dead or vanished cells can then be calculated as follows: 100−((Dapi negative cells in respective treatment/Dapi negative cells in control)×100).
(47) Finally, to discern between apoptotic and non-apoptotic pathways of cell death induced by our antibodies we co-stained target cells with DiOC6 and propidium iodide (PI). DiOC6 (3,3-dihexyloxacabocyanine iodide) is a cell-permeant, green-fluorescent, lipophilic dye that is selective for the mitochondria of live cells, when used at low concentrations. Apoptotic cells will lose their mitochondrial membrane potential (loss of DiOC6 stain) before the cell membrane becomes permeable (PI positive); necrotic cells become PI positive before they loose their mitochondrial membrane potential (and become DiOC6-negative). The methods used for staining were adapted from Hugh J. M et al., 2004. In brief, THP-1 cells were stained with 40 nM of DiOC6 (Invitrogen) for 20 minutes at 37° C. PI was added after which the samples were analyzed immediately by flow cytometry.
(48) Flow Cytometry
(49) Stained cells were analyzed on FACSAria (BD), FACSCanto (BD), FACS LSRFortessa X-20 (BD) and Guava (Millipore) flowcytometers and flow cytometry data were processed with FlowJo software (Tree Star).
(50) Phase Contrast Imaging
(51) THP-1 cells were added to a two chambered Cover glass system (LabTek). Using a phase contrast-imaging microscope (in-house manufactured), four fields of interest per chamber were chosen. The software was set to take a picture of every field of interest every other minute. Just prior to the run, the THP-1 binding, non-cytotoxic antibody AT13-023 and the THP-1 binding, cytotoxic antibody AT13-037 were added to their respective wells at a concentration of 10 ug/ml.
(52) Target Verification: Immunoprecipitation and Flow Cytometry
(53) THP-1 cells were lysed and precleared with an irrelevant antibody (in-house generated RSV antibody D25) and beads to remove non specific binding proteins. Precleared lysate was then incubated with bead-labeled AML-specific antibodies or with the influenza specific antibody AT10-002 as a negative control (3 hrs at 4° C.). Antibody-incubated lysates were washed five times, bound proteins were eluted from the THP-1 lysate and then run on an SDS-PAGE gel. Proteins were blotted and stained with Ponseau S to reveal total protein. The blot was blocked with BSA and incubated with mouse-anti-snRNP200 (Millipore, clone 3B6.1) or Rabbit-anti-HMGB1 (Abcam) for Western blot analysis. Intracelllar staining for snRNP200 was performed after fixing and permeabilizing THP-1 cells with methanol (Sigma) and permeabilization buffer containing triton X-100 (Sigma), EDTA (Gibco) and BSA (Roche), followed by incubation with rabbit-anti-human snRNP200 antibody (Sigma) overnight at 4° C.
(54) Target Conformation: snRNP200 ELISA
(55) HEK 293T cells were transfected with an expression vector containing the full-length open reading frame of snRNP200 with an N-terminal FLAG tag. At 2 days after transfection cells were harvested and lysed in lysis buffer containing protease inhibitors. This lysate was cleared and protein concentration was measured. AML specific antibodies AT12-019, AT12-023, AT13-031 and AT13-037 or commercially available snRNP200 specific antibodies (Bethyl labs) were then coated on an ELISA plate. The lysate was added at a concentration of 3 μg/ml for capturing. After extensive washing, captured snRNP200-flag was detected with a monoclonal mouse anti-flag HRP antibody (Sigma-Aldrich, clone M2).
(56) Results
(57) Generation of AML-Specific Antibodies
(58) In our project we use a unique technology that was recently developed in our laboratory (WO 2007/067046; incorporated herein by reference) that allows for selection of naturally occurring leukemia-specific B cells and the antibodies produced by these cells. We employed this technology to generate leukemia-specific B cell lines from two AML patients who developed potent GvL responses in parallel with severe GvHD of the liver and skin. With our B cell immortalization technique, it became possible to identify B cell responses of leukemia patients and to create leukemia-specific B cell lines that allow functional studies of the antibodies these cell lines produce and allow generation of larger numbers of antibodies, as compared to other methods known in the art, with diagnostic and therapeutic potential.
(59) First, we applied our technique as described in WO 2007/067046 to perform a set of pilot experiments, where we isolated and immortalized B lymphocytes from a carefully selected patient (donor 59) who developed a potent GvL response following extensive GvHD of liver and skin. This patient was diagnosed with AML at the age of 36 years. She obtained complete remission after the first of two courses induction chemotherapy after which she received a myeloablative, HLA-matched sibling donor SCT as consolidation therapy. Only 5 months after SCT, shortly after immunosuppressive therapy had been tapered, her AML relapsed. With one cycle of high-dose cytarabine she obtained complete remission again, after which she spontaneously, before the scheduled donor-lymphocyte infusion, developed stage III GvHD of the liver and stage II GvHD of the skin. She was successfully treated with high-dose corticosteroid therapy but during tapering of therapy hepatic GvHD relapsed twice. In the end, corticosteroid therapy was successfully phased out about 6 months before the current experiments were started (1.5 yrs after AML relapse) and she has remained in complete remission from her leukemia for more than three years now (
(60) From this patient, we generated B cell clones using our technique to immortalize B cells. Briefly, PBMC were isolated from the peripheral blood by ficoll centrifugation, and B lymphocytes sorted by FACS. Isolated B lymphocytes were then cultured with IL21 and CD40L and transduced with BCL6 and BCL-xL, with a transduction efficiency of around 70%. Using this technique, unique B cell clones that concurrently express the B cell receptor and secrete monoclonal antibodies were generated. Immortalized CD27− naïve and CD27+ memory IgG+ B cells were seeded at concentrations of 20 or 40 cells per well and expanded with IL21 and CD40L. Supernatants of expanded B cell micro cultures were then screened for antibody binding to leukemia-, liver- and colon cell lines by FACS, using human-IgG-PE as a secondary detection antibody.
(61) As the patient had been diagnosed with AML-M5 according to the French-American-British (FAB) classification (Bennett et al., 1976), we selected the THP-1 cell line that morphologically and phenotypically is roughly similar to AML-M5 for these screening essays (Tsuchiya et al., 1988). In addition, because the patient suffered from extensive GvHD of the liver we screened for the identification of liver-binding B cell clones using the liver cell line HepG2. As a negative control, and to select out cross-binding B cell clones we used the colon cell lines HT-29 and LSTR. Micro cultures with the highest binding to either of these cell lines were then sorted and single cells were deposited in 96 well formats, expanded and the supernatants of these expanded clones were again screened for binding against leukemia cell lines (
(62) Properties of AML-specific Antibodies
(63) With this approach we generated eight B cell lines from this one patient, producing antibodies that bind to THP-1 (
(64) Interestingly, the antibodies are of the IgG1 and IgG3 isotypes, and several of the DNA sequences showed somatic hypermutations. Antibodies AT12-023, AT12-025, AT13-023 and AT13-031 belong to the VH4-34 family, which is a family of VH sequences known for their potential killing properties (Bhat et al, 1997). The antibodies are of donor-origin, as confirmed by microchimerism analyses.
(65) We then determined the breadth of binding within the spectrum of AML subtypes, and tested the generated AML-specific B cell clones for binding to other AML FAB classification types. Selected leukemia-specific clones also bound to the AML-M5 cell line MonoMac6 (Table 3) (see for review of AML cell lines (Drexler and Minowada, 1998)).
(66) Our AML-specific antibodies also bound to freshly isolated AML blasts of newly diagnosed patients (Table 3 and
(67) Furthermore, some antibodies also bound other hematopoietic malignancy-cell lines, such as the diffuse large cell B cell lymphoma cell lines OCI-Ly1 and OCI-Ly7 and the multiple myeloma cell lines U266 and NCI-H929, and/or patient-derived hematologic tumor cells (Table 4 and
(68) In Vitro Activity of AML Specific Antibodies
(69) While testing the specificity of the AML-binding antibodies, we made a striking observation. Three of the eight antibodies spontaneously induced death of the leukemic cells they were binding to. THP-1 cells were killed by AT12-023 and AT12-025, and primary AML blasts isolated from patients diagnosed with AML were killed by AT12-025 and AT12-024 (Table 5 and
(70)
(71) Confirmation of Our Findings by Generating AML-Specific B Cell Lines from a Second Patient
(72) About 0.05 to 0.1% of the B cells that we screened from the first patient were found to be AML-specific. To confirm our findings, we selected a second patient with relapsed AML who obtained durable remission after an allogeneic SCT (donor 58;
(73) Discussion
(74) These preliminary date are highly exciting, as—to the best of our knowledge—we are the first to generate several human, non-chimeric, leukemia-specific B lymphocyte clones from patients that developed a robust, lasting GvL response against AML. The observation that some of these antibodies spontaneously show killing activity against leukemic blasts in vitro is highly exciting and very promising. In addition, the observation that some of the antibodies have a germline sequence and are of the IgG3 subclass, a type of antibody that can be induced without T cell help, warrants further attention as these findings demonstrate that ‘natural’ antibodies generated in a T-cell-independent way affect GvL responses in SCT patients. Importantly, these data offer proof of concept that using this technique, we can select leukemia-specific B cell clones.
Example 2
(75) AML-Specific Antibodies from a Third Patient
(76) To further confirm our approach and to show this anti-AML response is not only reserved for female patients, we selected a male patient as well. This patient (
(77) Using the same methods as described in Example 1, four B cell clones have been generated from this patient that bind to the AML cell lines THP-1 and/or Molm13 (
(78) It was also tested whether the four antibodies of donor 101 could bind primary AML blasts (Materials & Methods: see Example 1).
Example 3
(79) In Vitro Activity of AML-Specific Antibodies of Donors 59, 58 and 101
(80) In Example 1, the breadth of binding of the antibodies of donor 59 within the spectrum of AML subtypes was determined (Table 3). Using the same methods, this has also been determined for the antibodies of donor 58. The results are shown in Table 9A: all five antibodies of donor 58 (AT13-033, AT13-034, AT13-035, AT13-036 and AT13-037) bound to the AML-M5 cell line THP-1, as well as to the AML-M5 cell line MonoMac6. These AML-specific antibodies did not significantly bind to freshly isolated AML blasts of newly diagnosed patients of FAB classification M0, M1 or M4. AT13-034 could only weakly bind M0 blasts. This indicates that these antibodies have a specificity for (at least) AML M5 blasts.
(81) In Example 1, it was also determined that antibodies AT12-023 and AT12-025 of donor 59 killed THP-1 cells (Table 5 and
(82) The capability of inducing death of primary AML blasts was also tested (Materials & Methods: see Example 1). Similar to some of the antibodies obtained from donor 59, some of the antibodies derived from donor 58 are also capable of inducing cell death of primary AML cells. This is shown in
Example 4
(83) In Vitro Activity of AML Antibodies is Rapid and Involves a Non-Apoptotic Cell Death Pathway
(84) To investigate the pathway through which several of the above-mentioned antibodies induced death of their target cells, we visualized death of target cells with time-lapse microscopy (
(85) Cell Death Mediated Through Interference with the Target Cell Membrane
(86) Non-apoptotic death pathways include necroptosis and oncosis. Necroptosis is, similar to apoptosis, an active cell death pathway that depends on the activation of defined molecular pathways including the activation of receptor-interacting protein kinase 3 (RIPK3). To investigate whether AML-antibody-induced cell death was dependent on the activation of intracellular molecular pathways we tested whether antibody-induced cytotoxicity was dependent of temperature. We found that under these experimental conditions the cytotoxic activities of at least antibodies AT13-033, AT13-035, AT13-036, AT13-037, AT12-023 and AT12-025 were equally potent at 4° C. as compared to their activities at 37° C. (
(87) Oncosis is a mode of cell death characterized by swelling of the cell, through selective membrane injury, resulting in increased membrane permeability and ultimately cell death. Oncosis-inducing antibodies have been described that mediate cell death by forming large pores in the membrane through destabilization of the membrane (Hernandez et al, 2011). Cytocholasin D is an actin polymerization inhibitor that can stabilize the cytoskeleton. Treatment of the target cell line THP-1 with cytochalasin D did not prevent antibody binding to these cells (
Example 5
(88) One of the Targets Recognized by Our Antibodies is snRNP200
(89) We then set out to determine the target recognized by several AML-specific antibodies. For this we used immunoprecipitation of cell membrane lysates of THP-1 cells with AT12-023 and AT13-031. We found a clear protein band at 250 kD that was sent for mass-spectometry analysis which revealed snRNP200 as the target antigen which could be confirmed by Western blot analysis (
(90) snRNP200 is part of the spliceosome in all eukaryotic cells and is therefore expected to be located in the nucleus. To confirm that AML cells express this protein on their cell surface we stained the cell membrane of THP-1 cells with a commercially available, anti-snRNP200 antibody.
(91) All eukaryotic cells have snRNP200 (also known as U5-snRNP) protein in the nucleus, as part of the spliceosome (Kattah, 2010). The spliceosome consists of a number of proteins. At least one of these proteins, U1-snRNP, has been described to be expressed on apoptotic cells in patients with systemic lupus erythematosus (SLE) and mixed connective tissue disease (MCTD) leading to auto-immune responses (Kattah, 2010).
(92) We propose that snRNP200 expression by AML cells has triggered an allo-immune response (graft vs leukemia response) that has kept the patients in durable remission. Therefore, this protein can now be used as a new AML target. Moreover, since antibodies AT12-023 and AT13-031 specifically recognize snRNP200 and also recognize B-NHL cells, snRNP200 can now also be used as a target for B-NHL.
(93) TABLE-US-00001 TABLE 1A Preferred anti-AML antibodies according to the invention (CDR numbering according to Kabat et al. 1991) SEQ ID NO. Antibody Identity Sequence 1 AT12-023 Heavy GYYWS chain CDR1 2 AT12-025 Heavy GYYWS chain CDR1 3 AT13-024 Heavy SYGMH chain CDR1 4 AT12-019 Heavy SYAMS chain CDR1 5 AT13-022 Heavy SYGMH chain CDR1 6 AT13-023 Heavy GYFWT chain CDR1 7 AT13-031 Heavy GYYWS chain CDR1 8 AT12-020 Heavy TYSMN chain CDR1 9 AT13-033 Heavy NYGMH chain CDR1 10 AT13-034 Heavy SHAIH chain CDR1 11 AT13-035 Heavy SYGMH chain CDR1 12 AT13-036 Heavy SYSMN chain CDR1 13 AT13-037 Heavy TYGMH chain CDR1 14 AT12-023 Heavy EINHSGSTNYNPSLKS chain CDR2 15 AT12-025 Heavy EINHSGSTNYNPSLKS chain CDR2 16 AT13-024 Heavy FIRYDGSNKYFADSVRG chain CDR2 17 AT12-019 Heavy TIRASGGSTSYADSVKG chain CDR2 18 AT13-022 Heavy ISYDGSNKYYADSVKG chain CDR2 19 AT13-023 Heavy ETVHSGGTNYNPSLKS chain CDR2 20 AT13-031 Heavy EINHSGSTNYNPSLKS chain CDR2 21 AT12-020 Heavy SISSSSGYIYYADSVKG chain CDR2 22 AT13-033 Heavy VISHDGSKTYYGHSVKG chain CDR2 23 AT13-034 Heavy LIWYDGSNNYYADSVKG chain CDR2 24 AT13-035 Heavy VISYDGSNKYYADSVKG chain CDR2 25 AT13-036 Heavy SISSSSTYIYYADSVKG chain CDR2 26 AT13-037 Heavy VIWYDGSNTYYADSVKG chain CDR2 27 AT12-023 Heavy GRSTSPLDYYYYYMDV chain CDR3 28 AT12-025 Heavy GSMARPKPFDY chain CDR3 29 AT13-024 Heavy DPQERIYYSDTSGYLDY chain CDR3 30 AT12-019 Heavy SPAMIRGVRGGDYFDY chain CDR3 31 AT13-022 Heavy DGKGIVVIYYYYGMDV chain CDR3 32 AT13-023 Heavy GLNSPFDY chain CDR3 33 AT13-031 Heavy GPRGMYSSSSGDY chain CDR3 34 AT12-020 Heavy DGTFSYYYYMDV chain CDR3 35 AT13-033 Heavy AGLNYYGNLLSNYFYYGMDV chain CDR3 36 AT13-034 Heavy ARDGCTGGSCCYFDN chain CDR3 37 AT13-035 Heavy AKDSYYYGSGRRWGYYFDY chain CDR3 38 AT13-036 Heavy ARRREVGRDGYSLYPRGYHYGMDV chain CDR3 39 AT13-037 Heavy ARGRGYSAQGNRNRAYYFDY chain CDR3 40 AT12-023 Light QGDFLRSYYAS chain CDR1 41 AT12-025 Light RASQSISRYLN chain CDR1 42 AT13-024 Light RASQSISSWLA chain CDR1 43 AT12-019 Light RASQAFSSYLV chain CDR1 44 AT13-022 Light SGDKLGDKYAC chain CDR1 45 AT13-023 Light RASQGIRNVLG chain CDR1 46 AT13-031 Light RASQGIRNDLG chain CDR1 47 AT12-020 Light RASQDISSSLA chain CDR1 48 AT13-033 Light TGTSSDIGGYNYVS chain CDR1 49 AT13-034 Light RASQSISNNLG chain CDR1 50 AT13-035 Light QGDSLRSYYAS chain CDR1 51 AT13-036 Light TGTSSDVGGYNYVS chain CDR1 52 AT13-037 Light RASQSVSSNLA chain CDR1 53 AT12-023 Light GKNKRPS chain CDR2 54 AT12-025 Light AASSLQS chain CDR2 55 AT13-024 Light KASSLES chain CDR2 56 AT12-019 Light ATSTLQG chain CDR2 57 AT13-022 Light QDSKRPS chain CDR2 58 AT13-023 Light AASSLQS chain CDR2 59 AT13-031 Light AAVSLQS chain CDR2 60 AT12-020 Light AASTLQS chain CDR2 61 AT13-033 Light EVTKRPS chain CDR2 62 AT13-034 Light GASTRAT chain CDR2 63 AT13-035 Light GKNNRPS chain CDR2 64 AT13-036 Light DVNDRPS chain CDR2 65 AT13-037 Light GAFTRVT chain CDR2 66 AT12-023 Light NSRDRSGNHLV chain CDR3 67 AT12-025 Light QQSYSTPRT chain CDR3 68 AT13-024 Light QQYNTYPYT chain CDR3 69 AT12-019 Light QQYYSYPPT chain CDR3 70 AT13-022 Light QAWDSSTVVF chain CDR3 71 AT13-023 Light LQHNSHPRT chain CDR3 72 AT13-031 Light LQHNSYPRT chain CDR3 73 AT12-020 Light QQYYSYPPT chain CDR3 74 AT13-033 Light SSYAGSNDLL chain CDR3 75 AT13-034 Light QQYNNWPRLT chain CDR3 76 AT13-035 Light NSRDSSGNHVV chain CDR3 77 AT13-036 Light SSYTRSNTVI chain CDR3 78 AT13-037 Light QQYNDRPPYT chain CDR3 79 AT12-023 Heavy QVQLQQWGAGLLKPSETLSLTCAVYGGSFSGYYWSWIRQPPGKGLEWIGEINHSGSTNYNPSLKSRVTISV chain DTSKNQFSLKLSSVTAADTAVYYCARGRSTSPLDYYYYYMDVWAKGTTVTVSS 80 AT12-025 Heavy QVQLQQWGAGLLKPSETLSLTCAVYGGSFSGYYWSWIRQPPGKGLEWIGEINHSGSTNYNPSLKSRVTISV chain DTSKNQFSLKLSSVTAADTAVYYCARGSMARPKPFDYWGQGTLVTVSS 81 AT13-024 Heavy QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAFIRYDGSNKYFADSVRGRFTIS chain RDNSKNTLFLQMNSLRAEDTAVYYCAKDPQERIYYSDTSGYLDYWGQGTLVTVSS 82 AT12-019 Heavy EVHLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSTIRASGGSTSYADSVKGRFTISR chain DNSQSRLYLQMNSLTAEDTAVYYCAKSPAMIRGVRGGDYFDYWGQGTLVTVSS 83 AT13-022 Heavy QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTIS chain RDNSKNTLYLQMNSLRAEDTAVYYCAKDGKGIVVIYYYYGMDVWGQGTTVTVSS 84 AT13-023 Heavy QVQLQQWGAGLLKPSETLSLTCAVYGGSFSGYFWTWIRQPPGKGLEWIGETVHSGGTNYNPSLKSRVTISV chain DTSKNQFSLRLNSVTAADTAVYYCVRGLNSPFDYWGQGTLVTVSS 85 AT13-031 Heavy QVQLQQWGAGLLKPSETLSLTCAVYGGSFSGYYWSWIRQPPGKGLEWIGEINHSGSTNYNPSLKSRVTISV chain DTSKKQFSLKLSSVTAADTAVYYCARGPRGMYSSSSGDYWGQGTLVTVSS 86 AT12-020 Heavy EVQLVESGGGLVKPGGSLRLSCAASGFTFSTYSMNWVRQAPGKGLEWVSSISSSSGYIYYADSVKGRFTISR chain DNAKNSLYLQMNSLRAEDTAVYYCARDGTFSYYYYMDVWGKGTTVTVSS 87 AT13-033 Heavy QVQLVESGGGVVQPGRSLRLSCAVSGLSFRNYGMHWVRQAPGKGLEWVAVISHDGSKTYYGHSVKGRFTI chain SRDKSKTMLFLQMNSLRPEDTAVYYCAKAGLNYYGNLLSNYFYYGMDVWGQGTTVTVSS 88 AT13-034 Heavy QVHLVESGGGVVQPGTSLRLSCAASEFTFSSHAIHWVRQAPGKGLEWVALIWYDGSNNYYADSVKGRFTIS chain RDSSKNTVHLQMNSLRVEDTAVYYCARDGCTGGSCCYFDNWGQGTLVTVSS 89 AT13-035 Heavy QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTIS chain RDNSKNTLYLQMNSLRAEDTAVYYCAKDSYYYGSGRRWGYYFDYWGQGTLVTVSS 90 AT13-036 Heavy EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMNWVRQAPGKGLEWVSSISSSSTYIYYADSVKGRFTISR chain DNARNSLYLQMNSLRAEDTAVYYCARRREVGRDGYSLYPRGYHYGMDWGQGTTVTVSS 91 AT13-037 Heavy QVQLVESGGGVVQPGRSLRLSCAASGFTFSTYGMHWVRQAPGKGLEWVAVIWYDGSNTYYADSVKGRFTI chain SRDNSKNTLYLQIKSLRAEDTAVYYCARGRGYSAQGNRNRAYYFDYWGQGTLVTVSS 92 AT12-023 Light SSELTQDPAVSVALGQTVRITCQGDFLRSYYASWYQQKPGQAPVLVIFGKNKRPSGIPDRFSGSSSGNTASL chain TITGAQAEDEADYYCNSRDRSGNHLVFGGGTKLTVL 93 AT12-025 Light DIQMTQSPSSLSASVGDRVTITCRASQSISRYLNWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTL chain TISSLQPEDFATYYCQQSYSTPRTFGPGTKVDIK 94 AT13-024 Light DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKLLIYKASSLESGVPSRFSGTGSGTEFTL chain TISSLQPDDFATYYCQQYNTYPYTFGQGTKLEIK 95 AT12-019 Light AIRLTQSPSSVSASTGDRVTITCRASQAFSSYLWYQQKPGKAPNLLIYATSTLQGGVPSRFSGSGSGTDFTL chain TISNLQSEDFATYYCQQYYSYPPTFGQGTKLEIK 96 AT13-022 Light SYELTQPPSVSVSPGQTASITCSGDKLGDKYACWYQQKPGQSPVLVIYQDSKRPSGIPERFSGSNSGNTATL chain TISGTQAMDEADYYCQAWDSSTVVFGGGTKLTVL 97 AT13-023 Light DIQMTQSPSSLSASVGDRVTITCRASQGIRNVLGWYQQKPGKAPKCLIYAASSLQSGVPSRFSGSGSGTEFTL chain TISSLQPEDFATYYCLQHNSHPRTFGQGTKVEIK 98 AT13-031 Light DIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYAAVSLQSGVPSRFSGSGSGTEFT chain LTISSLQPEDFATYYCLQHNSYPRTFGQGTKLEIK 99 AT12-020 Light AIRMTQSPSSFSASTGDRVTITCRASQDISSSLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTDFTL chain TISCLQSEDFATYYCQQYYSYPPTFGQGTRLEIK 100 AT13-033 Light QSALTQPPSASGSPGQSVTISCTGTSSDIGGYNYVSWYQHHPGKAPKLMIYEVTKRPSGVPDRFSGSKSGNT chain ASLTVSGLQAEDEAHYYCSSYAGSNDLLFGGGTKLTVL 101 AT13-034 Light EVVMTQSPATLSVSPGERATLSCRASQSISNNLGWYQQKPGQAPRLLIYGASTRATGIPGRFSGSGSGTEFT chain LTIYSLQSEDFAVYYCQQYNNWPRLTFGGGTKVEIK 102 AT13-035 Light SSELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGKNNRPSGIPDRFSGSSSGNTASL chain TITGAQAEDEADYYCNSRDSSGNHVVFGGGTKLTVL 103 AT13-036 Light QSALTQPASVSGSPRQSITISCTGTSSDVGGYNYVSWYQQLPGKAPKLMIYDVNDRPSGVSIRFSGSKSGNT chain ASLTISGLQAEDEADYYCSSYTRSNTVIFGGGTKLTVL 104 AT13-037 Light EIVMTQSPATLSVSPGERVILSCRASQSVSSNLAWYQQKPGQPPRLLIYGAFTRVTGVPARFSGSGSGTEFTL chain TISSLQSEDFAVYYCQQYNDRPPYTFGQGTKLEIK 105 AT12-023 Heavy ggt tac tac tgg agc chain CDR1 106 AT12-025 Heavy ggt tat tac tgg agc chain CDR1 107 AT13-024 Heavy agc tat ggc atg cac chain CDR1 108 AT12-019 Heavy agc tat gcc atg agt chain CDR1 109 AT13-022 Heavy agc tat ggc atg cac chain CDR1 110 AT13-023 Heavy ggt tac ttc tgg acc chain CDR1 111 AT13-031 Heavy ggt tac tac tgg agc chain CDR1 112 AT12-020 Heavy acc tat agc atg aac chain CDR1 113 AT13-033 Heavy aat tat ggc atg cac chain CDR1 114 AT13-034 Heavy tcc cat gcc ata cac chain CDR1 115 AT13-035 Heavy agc tat ggc atg cac chain CDR1 116 AT13-036 Heavy agt tat agc atg aac chain CDR1 117 AT13-037 Heavy acc tat ggc atg cac chain CDR1 118 AT12-023 Heavy gaa atc aat cat agt gga agc acc aac tac aac ccg tcc ctc aag agt chain CDR2 119 AT12-025 Heavy gaa atc aat cat agt gga agc acc aac tac aac ccg tcc ctc aag agt chain CDR2 120 AT13-024 Heavy ttt ata cgg tat gat gga agt aat aaa tac ttt gca gac tcc gtg agg ggc chain CDR2 121 AT12-019 Heavy act att agg gct agt ggt ggt agc aca agc tac gca gac tcc gtg aag ggc chain CDR2 122 AT13-022 Heavy ata tca tat gat gga agt aat aaa tac tat gca gac tcc gtg aag ggc chain CDR2 123 AT13-023 Heavy gaa acc gtt cat agt gga ggc acc aac tac aac ccg tcc ctc aag agt chain CDR2 124 AT13-031 Heavy gaa atc aat cat agt gga agc acc aac tac aac ccg tcc ctc aag agt chain CDR2 125 AT12-020 Heavy tcc att agt agt agt agt ggt tac ata tac tac gca gac tca gtg aag ggc chain CDR2 126 AT13-033 Heavy gtc att tcg cat gat gga agt aag aca tac tat gga cac tcc gtg aag ggc chain CDR2 127 AT13-034 Heavy ctt ata tgg tat gat gga agt aat aat tat tat gca gac tcc gtg aag ggc chain CDR2 128 AT13-035 Heavy gtt ata tca tat gat gga agt aat aaa tac tat gca gac tcc gtg aag ggc chain CDR2 129 AT13-036 Heavy tcc att agt agt agt agt act tac ata tac tac gca gac tca gtg aag ggc chain CDR2 130 AT13-037 Heavy gtt ata tgg tat gat gga agt aat aca tac tat gca gac tcc gtg aag ggc chain CDR2 131 AT12-023 Heavy ggc cgt agt acc agc ccg ctc gac tac tac tac tac tac atg gac gtc chain CDR3 132 AT12-025 Heavy ggc tca atg gca aga ccc aag cca ttt gac tac chain CDR3 133 AT13-024 Heavy gcg aaa gat ccc caa gag cgt att tat tac tct gat act agt ggt tac ctt gac tac chain CDR3 134 AT12-019 Heavy tct cct gct atg att cgg gga gtt agg ggg ggt gac tac ttt gac tac chain CDR3 135 AT13-022 Heavy gat ggg aag ggg att gta gtt att tac tac tac tac ggt atg gac gtc chain CDR3 136 AT13-023 Heavy ggc ctt aac agc ccc ttt gac tac chain CDR3 137 AT13-031 Heavy ccc cgg ggc atg tat agc age tcg tcc ggg gac tac chain CDR3 138 AT12-020 Heavy gat ggg act ttc tcc tac tac tac tac atg gac gtc chain CDR3 139 AT13-033 Heavy gcc ggg ttg aac tac tat gga aac cta tta tca aac tac ttc tac tac gga atg gac gtc chain CDR3 140 AT13-034 Heavy gcg aga gat ggt tgt act ggt ggt agc tgc tgc tat ttt gac aac chain CDR3 141 AT13-035 Heavy gcg aaa gac tcg tat tac tat ggt tcg ggg aga cga tgg ggc tac tac ttt gac tac chain CDR3 142 AT13-036 Heavy gcg aga agg agg gag gtc ggt aga gat ggc tac agt ttg tac ccc cgg ggg tac cac tac ggt atg gac gtc chain CDR3 143 AT13-037 Heavy gcg aga ggc cgt gga tat agt gcc caa ggg aat cgg aat agg gct tac tac ttt gac tac chain CDR3 144 AT12-023 Light caa gga gac ttc ctc aga agc tat tat gca agc chain CDR1 145 AT12-025 Light cgg gca agt cag agc att agc agg tat tta aat chain CDR1 146 AT13-024 Light cgg gcc agt cag agt att agt agc tgg ttg gcc chain CDR1 147 AT12-019 Light cgg gcg agt cag gct ttt agc agt tat tta gtc chain CDR1 148 AT13-022 Light tct gga gat aaa ttg ggg gat aaa tat gct tgc chain CDR1 149 AT13-023 Light cgg gca agt cag ggc att aga aat gtt tta ggc chain CDR1 150 AT13-031 Light cgg gca agt cag ggc att aga aat gat tta ggc chain CDR1 151 AT12-020 Light cgg gcg agt cag gat att agc agt tct tta gcc chain CDR1 152 AT13-033 Light act ggg acc agc agt gac att ggt ggt tat aac tat gtc tcc chain CDR1 153 AT13-034 Light agg gcc agt cag agc att agc aac aac tta ggc chain CDR1 154 AT13-035 Light caa gga gac agc ctc aga agc tat tat gca agc chain CDR1 155 AT13-036 Light act gga acc agc agt gac gtt ggt ggt tat aac tat gtc tcc chain CDR1 156 AT13-037 Light agg gcc agt cag agt gtt agc agc aac tta gcc chain CDR1 157 AT12-023 Light ggt aaa aac aag cgg ccc tca chain CDR2 158 AT12-025 Light gct gca tcc agt ttg caa agt chain CDR2 159 AT13-024 Light aag gcg tct agt tta gaa agt chain CDR2 160 AT12-019 Light gct aca tcc act ttg caa ggt chain CDR2 161 AT13-022 Light caa gat agc aag cgg ccc tca chain CDR2 162 AT13-023 Light gct gca tcc agt ttg caa agt chain CDR2 163 AT13-031 Light gct gca gtc agt ttg caa agt chain CDR2 164 AT12-020 Light gct gca tcc act ttg caa agt chain CDR2 165 AT13-033 Light gag gtc act aag cgg ccc tca chain CDR2 166 AT13-034 Light ggt gca tcc acc agg gcc act chain CDR2 167 AT13-035 Light ggt aaa aac aac cgg ccc tca chain CDR2 168 AT13-036 Light gat gtc aat gat cgg ccc tca chain CDR2 169 AT13-037 Light ggt gca ttc acg agg gtc act chain CDR2 170 AT12-023 Light aac tcc cgg gac cgc agt ggt aac cac ctg gtg chain CDR3 171 AT12-025 Light caa cag agt tac agt acc cct cgc act chain CDR3 172 AT13-024 Light caa cag tat aat act tac ccg tac act chain CDR3 173 AT12-019 Light caa cag tat tat agt tac cct ccg act chain CDR3 174 AT13-022 Light cag gcg tgg gac agc agc act gtg gta ttc chain CDR3 175 AT13-023 Light cta cag cat aat agt cac ccc cgg acg chain CDR3 176 AT13-031 Light cta cag cat aat agt tac cct cgg act chain CDR3 177 AT12-020 Light caa cag tat tat agt tac cct ccg acg chain CDR3 178 AT13-033 Light agc tca tat gca ggc agc aac gat ttg cta chain CDR3 179 AT13-034 Light caa caa tat aat aac tgg cct cgg ctc act chain CDR3 180 AT13-035 Light aac tcc cgg gac agc agt ggt aac cat gtg gta chain CDR3 181 AT13-036 Light agc tca tat aca aga agc aac act gtg ata chain CDR3 182 AT13-037 Light cag cag tac aat gac cgg ccc ccg tac act chain CDR3 183 AT12-023 Heavy cag gtg cag cta cag cag tgg ggc gca gga ctg ttg aag cct tcg gag acc ctg tcc ctc acc tgc gct gtc tat ggt ggg tcc ttc chain agt ggt tac tac tgg agc tgg atc cgc cag ccc cca ggg aag ggg ctg gag tgg att ggg gaa atc aat cat agt gga agc acc aac tac aac ccg tcc ctc aag agt cga gtc acc ata tca gta gac acg tcc aag aac cag ttc tcc ctg aag ctg agc tct gtg acc gcc gcg gac acg gct gtg tat tac tgt gcg agg ggc cgt agt acc agc ccg ctc gac tac tac tac tac tac atg gac gtc tgg gcc aaa ggg acc acg gtc acc gtc tcc tca 184 AT12-025 Heavy cag gtg cag cta cag cag tgg ggc gca gga ctg ttg aag cct tcg gag acc ctg tcc ctc acc tgc gct gtc tat ggt ggg tcc ttc chain agt ggt tat tac tgg agc tgg atc cgc cag ccc cca ggg aag ggg ctg gag tgg att ggg gaa atc aat cat agt gga agc acc aac tac aac ccg tcc ctc aag agt cga gtc acc ata tca gta gac acg tcc aag aac cag ttc tcc ctg aag ctg agc tct gtg acc gcc gcg gac acg gct gtg tat tac tgt gcg aga ggc tca atg gca aga ccc aag cca ttt gac tac tgg ggc cag gga acc ctg gtc acc gtc tcc tca 185 AT13-024 Heavy cag gtg cag ctg gtg gag tct ggg gga ggc gtg gtc cag cct ggg agg tcc ctg aga ctc tcc tgt gca gcg tct gga ttc acc ttc chain agt agc tat ggc atg cac tgg gtc cgc cag gct cca ggc aag ggg ctg gag tgg gtg gca ttt ata cgg tat gat gga agt aat aaa tac ttt gca gac tcc gtg agg ggc cga ttc acc atc tcc aga gac aat tcc aag aac acg ctg ttt ctg caa atg aac agc ctg aga gct gag gac acg gct gtg tat tac tgt gcg aaa gat ccc caa gag cgt att tat tac tct gat act agt ggt tac ctt gac tac tgg ggc cag gga acc ctg gtc acc gtc tcc tca 186 AT12-019 Heavy gag gtg cac ctg ttg gag tct ggg gga ggc ttg gta cag cct ggg ggg tcc ctg aga ctc tcc tgt gca gcc tct gga ttc acc ttt chain agc agc tat gcc atg agt tgg gtc cgc cag gct cca ggg aag ggg ctg gag tgg gtc tca act att agg gct agt ggt ggt agc aca agc tac gca gac tcc gtg aag ggc cgg ttc acc atc tcc aga gac aat tcc cag agc agg ttg tat ctg caa atg aac agt ctg aca gcc gag gac acg gcc gta tat tac tgt gcg aaa tct cct gct atg att cgg gga gtt agg ggg ggt gac tac ttt gac tac tgg ggc cag gga acc ctg gtc acc gtc tcc tca 187 AT13-022 Heavy cag gtg cag ctg gtg gag tct ggg gga ggc gtg gtc cag cct ggg agg tcc ctg aga ctc tcc tgt gca gcc tct gga ttc acc ttc chain agt agc tat ggc atg cac tgg gtc cgc cag gct cca ggc aag ggg ctg gag tgg gtg gca gtt ata tca tat gat gga agt aat aaa tac tat gca gac tcc gtg aag ggc cga ttc acc atc tcc aga gac aat tcc aag aac acg ctg tat ctg caa atg aac agc ctg aga gct gag gac acg gct gtg tat tac tgt gcg aaa gat ggg aag ggg att gta gtt att tac tac tac tac ggt atg gac gtc tgg ggc caa ggg acc acg gtc acc gtc tcc tca 188 AT13-023 Heavy cag gta cag cta cag cag tgg ggc gca gga ctg ttg aag cct tcg gag acc ctg tcc ctc acc tgc gct gtc tat ggt ggg tcc ttc chain agt ggt tac ttc tgg acc tgg atc cgc cag ccc cca ggg aag ggg ctg gag tgg att ggg gaa acc gtt cat agt gga ggc acc aac tac aac ccg tcc ctc aag agt cga gtc acc ata tca gtc gac acg tcc aag aac cag ttc tcc ctg agg ctg aac tct gtg acc gcc gcg gac acg gct gtg tat tac tgt gtg aga ggc ctt aac agc ccc ttt gac tac tgg ggc cag gga acc cta gtc acc gtc tcc tca 189 AT13-031 Heavy cag gtg cag cta cag cag tgg ggc gca gga ctg ttg aag cct tcg gag acc ctg tcc ctc acc tgc gct gtc tat ggt ggg tcc ttc chain agt ggt tac tac tgg agc tgg atc cgc cag ccc cca ggg aag ggg ctg gag tgg att ggg gaa atc aat cat agt gga agc acc aac tac aac ccg tcc ctc aag agt cga gtc acc ata tca gta gac acg tcc aag aag cag ttc tcc ctg aag ctg agc tct gtg acc gcc gcg gac acg gct gtg tat tat tgt gcg aga ggc ccc cgg ggc atg tat agc agc tcg tcc ggg gac tac tgg ggc cag gga acc ctg gtc acc gtc tcc tca 190 AT12-020 Heavy gag gtg cag ctg gtg gag tct ggg gga ggc ctg gtc aag cct ggg ggg tcc ctg aga ctc tcc tgt gca gcc tct gga ttc acc ttc chain agt acc tat agc atg aac tgg gtc cgc cag gct cca ggg aag ggg ctg gag tgg gtc tca tcc att agt agt agt agt ggt tac ata tac tac gca gac tca gtg aag ggc cga ttc acc atc tcc aga gac aac gcc aag aac tca ctg tat ctg caa atg aac agc ctg aga gcc gag gac acg gct gtg tat tac tgt gcg aga gat ggg act ttc tcc tac tac tac tac atg gac gtc tgg ggc aaa ggg acc acg gtc acc gtc tcc tca 191 AT13-033 Heavy cag gtg cag ctg gtg gag tct ggg gga ggc gtg gtc cag cct ggg agg tcc ctg aga ctc tcc tgt gca gtc tct gga ctc agt ttc chain agg aat tat ggc atg cac tgg gtc cgc cag gct ccc ggc aag ggg ctg gag tgg gtg gca gtc att tcg cat gat gga agt aag aca tac tat gga cac tcc gtg aag ggc cga ttc acc ata tcc aga gac aaa tcc aag act atg ttg ttt ctc caa atg aac agc ctg aga cct gag gac acg gct gtt tat tac tgt gcg aaa gcc ggg ttg aac tac tat gga aac cta tta tca aac tac ttc tac tac gga atg gac gtc tgg ggc caa ggg acc aca gtc acc gtc tcg tca 192 AT13-034 Heavy cag gtg cac ctg gtg gag tct ggg gga ggc gtg gtc cag cct ggg acg tcc ctg aga ctc tcc tgt gca gcg tct gaa ttc acc ttc chain agt tcc cat gcc ata cac tgg gtc cgc cag gct cca ggc aag ggg ctg gag tgg gtg gca ctt ata tgg tat gat gga agt aat aat tat tat gca gac tcc gtg aag ggc cga ttc acc atc tcc aga gac agt tcc aag aac acg gtg cat ctg caa atg aac agc ctg aga gtc gag gac acg gct gtg tat tac tgt gcg aga gat ggt tgt act ggt ggt agc tgc tgc tat ttt gac aac tgg ggc cag gga acc cta gtc acc gtc tcc tcg 193 AT13-035 Heavy cag gtg cag ctg gtg gag tct ggg gga ggc gtg gtc cag cct ggg agg tcc ctg aga ctc tcc tgt gca gcc tct gga ttc acc ttc chain agt agc tat ggc atg cac tgg gtc cgc cag gct cca ggc aag ggg ctg gag tgg gtg gca gtt ata tca tat gat gga agt aat aaa tac tat gca gac tcc gtg aag ggc cga ttc acc atc tcc aga gac aat tcc aag aac acg ctg tat ctg caa atg aac agc ctg aga gct gag gac acg gct gtg tat tac tgt gcg aaa gac tcg tat tac tat ggt tcg ggg aga cga tgg ggc tac tac ttt gac tac tgg ggc cag gga acc ctg gtc acc gtc tcc tca 194 AT13-036 Heavy gag gtg cag ctg gtg gag tct ggg gga ggc ctg gtc aag cct ggg ggg tcc ctg aga ctc tcc tgt gca gcc tct gga ttc acc ttc chain agt agt tat agc atg aac tgg gtc cgc cag gct cca ggg aag ggg ctg gag tgg gtc tca tcc att agt agt agt agt act tac ata tac tac gca gac tca gtg aag ggc cga ttc acc atc tcc aga gac aac gcc agg aac tca ctg tat ctg caa atg aac agc ctg aga gcc gag gac acg gct gtg tat tat tgt gcg aga agg agg gag gtc ggt aga gat ggc tac agt ttg tac ccc cgg ggg tac cac tac ggt atg gac gtc tgg ggc caa ggg acc acg gtc acc gtc tcc tca 195 AT13-037 Heavy cag gtg cag ctg gtg gag tct ggg gga ggc gtg gtc cag cct ggg agg tcc ctg aga ctc tcc tgt gca gcg tct gga ttc acc ttc chain agt acc tat ggc atg cac tgg gtc cgc cag gct cca ggc aag ggg ctt gag tgg gtg gca gtt ata tgg tat gat gga agt aat aca tac tat gca gac tcc gtg aag ggc cga ttc acc atc tcc aga gac aat tcc aag aac aca ctg tat ctg caa ata aag agc ctg aga gcc gag gac acg gct gtc tat tac tgt gcg aga ggc cgt gga tat agt gcc caa ggg aat cgg aat agg gct tac tac ttt gac tac tgg ggc cag gga acc ctg gtc acc gtc tcc tca 196 AT12-023 Light tct tct gag ctg act cag gac cct gct gtg tct gtg gcc ttg gga cag aca gtc agg atc aca tgc caa gga gac ttc ctc aga agc chain tat tat gca agc tgg tac cag cag aag cca gga cag gcc cct gta ctt gtc atc ttt ggt aaa aac aag cgg ccc tca ggg atc cca gac cga ttc tct ggc tcc agc tca gga aac aca gct tcc ttg acc atc act ggg gct cag gcg gaa gat gag gct gac tat tac tgt aac tcc cgg gac cgc agt ggt aac cac ctg gtg ttc ggc gga ggg acc aag ctg acc gtc cta 197 AT12-025 Light gac atc cag atg acc cag tct cca tcc tcc ctg tct gca tct gta gga gac aga gtc acc atc act tgc cgg gca agt cag agc att chain agc agg tat tta aat tgg tat cag cag aaa cca ggg aaa gcc cct aag ctc ctg atc tat gct gca tcc agt ttg caa agt ggg gtc cca tca agg ttc agt ggc agt gga tct ggg aca gat ttc act ctc acc atc agc agt ctg caa cct gaa gat ttt gca act tac tac tgt caa cag agt tac agt acc cct cgc act ttc ggc cct ggg acc aaa gtg gat atc aaa 198 AT13-024 Light gac atc cag atg acc cag tct cct tcc acc ctg tct gca tct gta gga gac aga gtc acc atc act tgc cgg gcc agt cag agt att chain agt agc tgg ttg gcc tgg tat cag cag aaa cca ggg aaa gcc cct aag ctc ctg atc tat aag gcg tct agt tta gaa agt ggg gtc cca tca agg ttc agc ggc act gga tct ggg aca gaa ttc act ctc acc atc agc agc ctg cag cct gat gat ttt gca act tat tac tgc caa cag tat aat act tac ccg tac act ttt ggc cag ggg acc aag ctg gag atc aaa 199 AT12-019 Light gcc atc cgg ttg acc cag tct cca tcc tca gtc tct gca tct aca gga gac aga gtc acc atc act tgt cgg gcg agt cag gct ttt agc chain agt tat tta gtc tgg tat cag caa aaa cca ggg aaa gcc cct aac ctc ctg atc tac gct aca tcc act ttg caa ggt ggg gtc cca tca agg ttc agc ggc agt gga tct ggg aca gat ttc act ctc acc atc agc aac ctg cag tct gaa gat ttt gca act tat tac tgt caa cag tat tat agt tac cct ccg act ttt ggc cag ggg acc aag ttg gag atc aaa 200 AT13-022 Light tcc tat gag ctg act cag cca ccc tca gtg tcc gtg tcc cca gga cag aca gcc agc atc acc tgc tct gga gat aaa ttg ggg gat chain aaa tat gct tgc tgg tat cag cag aag cca ggc cag tcc cct gtg ctg gtc atc tat caa gat agc aag cgg ccc tca ggg atc cct gag cga ttc tct ggc tcc aac tct ggg aac aca gcc act ctg acc atc agc ggg acc cag gct atg gat gag gct gac tat tac tgt cag gcg tgg gac agc agc act gtg gta ttc ggc gga ggg acc aag ctg acc gtc cta 201 AT13-023 Light gac atc cag atg acc cag tct cca tcc tcc ctg tct gca tct gta gga gac aga gtc acc atc act tgc cgg gca agt cag ggc att chain aga aat gtt tta ggc tgg tat cag cag aaa cca ggg aaa gcc cct aag tgc ctg atc tat gct gca tcc agt ttg caa agt ggg gtc cca tca agg ttc agc ggc agt gga tct ggg aca gaa ttc act ctc aca atc agc agc ctg cag cct gaa gat ttt gca act tat tac tgt cta cag cat aat agt cac ccc cgg acg ttc ggc caa ggg acc aag gtg gaa atc aaa 202 AT13-031 Light gac atc cag atg acc cag tct cca tcc tcc ctg tct gca tct gta gga gac aga gtc acc atc act tgc cgg gca agt cag ggc att chain aga aat gat tta ggc tgg tat cag cag aaa cca ggg aaa gcc cct aag cgc ctg atc tat gct gca gtc agt ttg caa agt ggg gtc cca tca agg ttc agc ggc agt gga tct ggg aca gaa ttc act ctc aca atc agc agc ctg cag cct gaa gat ttt gca act tat tac tgt cta cag cat aat agt tac cct cgg act ttt ggc cag ggg acc aag ctg gag atc aaa 203 AT12-020 Light gcc atc cgg atg acc cag tct cca tcc tca ttc tct gca tct aca gga gac aga gtc acc atc act tgt cgg gcg agt cag gat att chain agc agt tct tta gcc tgg tat cag caa aaa cca ggg aaa gcc cct aag ctc ctg atc tat gct gca tcc act ttg caa agt gga gtc cca tca agg ttc agc ggc agt gga tct ggg aca gac ttc act ctc acc atc agc tgc ctg cag tct gaa gat ttt gca act tat tac tgt caa cag tat tat agt tac cct ccg acg ttc ggc caa ggg acc agg ttg gaa atc aaa 204 AT13-033 Light cag tct gcc ctg act cag cct ccc tcc gcg tcc ggg tct cct ggt cag tca gtc acc atc tcc tgt act ggg acc agc agt gac att ggt chain ggt tat aac tat gtc tcc tgg tac caa cac cac cca ggc aaa gcc ccc aaa ttg atg att tat gag gtc act aag cgg ccc tca ggg gtc cct gat cgt ttc tct ggc tcc aag tct ggc aac acg gcc tcc ctg acc gtc tct gga ctc cag gct gag gat gag gct cat tat tac tgc agc tca tat gca ggc agc aac gat ttg cta ttc ggc gga ggg acc aag ctg acc gtc ctg 205 AT13-034 Light gaa gta gtg atg acg cag tct cca gcc acc ctg tct gtg tct cca ggg gaa aga gcc acc ctc tcc tgc agg gcc agt cag agc att chain agc aac aac tta ggc tgg tat cag cag aaa cct ggc cag gct ccc agg ctc ctc atc tac ggt gca tcc acc agg gcc act ggt atc cca ggc agg ttc agt ggc agt ggg tct ggg aca gag ttc act ctc acc atc tac agc ctg cag tct gag gat ttt gca gtt tat tac tgt caa caa tat aat aac tgg cct cgg ctc act ttc ggc gga ggg acc aag gtg gag atc aaa 206 AT13-035 Light tct tct gag ctg act cag gac cct gct gtg tct gtg gcc ttg gga cag aca gtc agg atc aca tgc caa gga gac agc ctc aga agc chain tat tat gca agc tgg tac cag cag aag cca gga cag gcc cct gta ctt gtc atc tat ggt aaa aac aac cgg ccc tca ggg atc cca gac cga ttc tct ggc tcc agc tca gga aac aca gct tcc ttg acc atc act ggg gct cag gcg gaa gat gag gct gac tat tac tgt aac tcc cgg gac agc agt ggt aac cat gtg gta ttc ggc gga ggg acc aag ctg acc gtc cta 207 AT13-036 Light cag tct gcc ctg act cag cct gcc tcc gtg tct ggg tct cct aga cag tcg atc acc atc tcc tgc act gga acc agc agt gac gtt ggt chain ggt tat aac tat gtc tcc tgg tac caa caa ctc cca ggc aaa gcc ccc aaa ctc atg att tat gat gtc aat gat cgg ccc tca ggg gtt tct att cgc ttc tct ggc tcc aag tct ggc aac acg gcc tcc ctg acc atc tct ggg ctc cag gct gag gac gag gct gat tat tac tgc agc tca tat aca aga agc aac act gtg ata ttc ggc gga ggg acc aaa ctg acc gtc cta 208 AT13-037 Light gaa ata gtg atg acg cag tct cca gcc acc ctg tct gtg tct cca ggg gaa agg gtc atc ctc tcc tgc agg gcc agt cag agt gtt chain agc agc aac tta gcc tgg tac cag cag aaa cct ggc cag cct ccc agg ctc ctc atc tat ggt gca ttc acg agg gtc act ggt gtc cca gcc agg ttc agt ggc agt ggg tct ggg aca gaa ttc act ctc acc atc agc agc ctg cag tct gaa gat ttt gca gtt tat tac tgt cag cag tac aat gac cgg ccc ccg tac act ttt ggc cag ggg acc aag ctg gag atc aaa
(94) TABLE-US-00002 TABLE 1B Preferred anti-AML antibodies according to the invention (CDR numbering according to Kabat et al. 1991) SEQ ID NO. Antibody Identity Sequence 209 AT14-013 Heavy SPNWWT chain CDR1 210 AT14-014 Heavy DAWMS chain CDR1 211 AT14-015 Heavy DFAMS chain CDR1 212 AT14-016 Heavy SYAMT chain CDR1 213 AT14-013 Heavy EIYYGGRVSYNSALRS chain CDR2 214 AT14-014 Heavy HINTKVDGGTTEYAAPVKG chain CDR2 215 AT14-015 Heavy FIRTKANDGTTEYAASVKG chain CDR2 216 AT14-016 Heavy SISGSGGSTYYADSVRG chain CDR2 217 AT14-013 Heavy AGQKNIGCGYSSCFISWFDT chain CDR3 218 AT14-014 Heavy TTEAIYDSSGYFHDY chain CDR3 219 AT14-015 Heavy ASDPFMTTDYYYYYMDV chain CDR3 220 AT14-016 Heavy AKGYVGCSGGNCYSGGAFDI chain CDR3 221 AT14-013 Light KSSQTILQRSNHLNYLA chain CDR1 222 AT14-014 Light KSSRSVLYSSNNKNYLA chain CDR1 223 AT14-015 Light TGTSSDVGGYNSVS chain CDR1 224 AT14-016 Light GGNNIGSESVH chain CDR1 225 AT14-013 Light WASTRES chain CDR2 226 AT14-014 Light WASIRES chain CDR2 227 AT14-015 Light EVYKRPL chain CDR2 228 AT14-016 Light YDTDRPS chain CDR2 229 AT14-013 Light HQYYTTPQT chain CDR3 230 AT14-014 Light QQYSRPPT chain CDR3 231 AT14-015 Light SSYGGTVLF chain CDR3 232 AT14-016 Light QVWDNTSDHPVVF chain CDR3 233 AT14-013 Heavy QGRLQESGPGLVKPSETLTLTCAVSGGSSVSSPNWWTWVRQAPGKGLEWIGEIYYGGRVSYNSALRSRVTI chain SSDRSKEEFSLKLRSVTAADTAIYYCAGQKNIGCGYSSCFISWFDTWGQGIAVTVSS 234 AT14-014 Heavy EVQLVESGGGLVKPGGSLRLSCAASGFTFSDAWMSWVRQAPGKGLEWVGHINTKVDGGTTEYAAPVKGR chain FTISRDDSKNSLYLHMDSLKTEDTAVYYCTTEAIYDSSGYFHDYWGQGSLVTVSS 235 AT14-015 Heavy EVQLVESGGGLAQPGRSLRLSCTASGFRFGDFAMSWVRQAPGKGLEWVGFIRTKANDGTTEYAASVKGRF chain IISRDDSKSIAYLQMNSLKTEDTAVYYCASDPFMTTDYYYYYMDVWGKGTTVTVSS 236 AT14-016 Heavy EVQVLESGGDSVQPGGSLRLSCAASGFTFSSYAMTWVRQAPGKGLKWVSSISGSGGSTYYADSVRGRFTISR chain DNSKNTLYVQMNSLRAEDTAVYYCAKGYVGCSGGNCYSGGAFDIWGQGTVVTVSS 237 AT14-013 Light DIVMTQSPDSLAVSLGERATIACKSSQTILQRSNHLNYLAWYQQKPGQPPKVLIWASTRESGVPDRFSGSG chain SGTDFTLTINSLQAEDVAVYYCHQYYTTPQTFGQGTKVEIK 238 AT14-014 Light DIVMTQSPDSLAVSLGERATINCKSSRSVLYSSNNKNYLAWYQQKPGQPPKLLIYWASIRESGVPDRFSGSG chain SGTDFTLTINSLQAEDVAVYYCQQYSRPPTFGQGTKVEIK 239 AT14-015 Light QSALTQPPSASGSPGQSVTISCTGTSSDVGGYNSVSWYQHHPGKAPKLMIYEVYKRPLGVPDRFSGSKSGN chain TASLTVSGLQAEDEAYYYCSSYGGTVLFGGGTKLTVL 240 AT14-016 Light SYVLTQPPSVSVAPGKTARITCGGNNIGSESVHWYQQKPGQAPVVVIYYDTDRPSGIPERFSGSNSGNTATL chain TISRVEAGDEADYYCQVWDNTSDHPVVFGGGTKLTVL 241 AT14-013 Heavy agt cct aac tgg tgg act chain CDR1 242 AT14-014 Heavy gac gcc tgg atg agc chain CDR1 243 AT14-015 Heavy gat ttt gct atg agt chain CDR1 244 AT14-016 Heavy agc tat gcc atg acc chain CDR1 245 AT14-013 Heavy gaa atc tat tat ggt ggg aga gtg agc tac aac tcg gcc ctc agg agt chain CDR2 246 AT14-014 Heavy cat att aac acc aaa gtt gat ggt ggg aca aca gag tac gct gca ccc gtg aaa ggc chain CDR2 247 AT14-015 Heavy ttc att aga acc aaa gct aat gat ggg aca aca gaa tac gcc gcg tct gtg aaa ggc chain CDR2 248 AT14-016 Heavy agt att agt ggt agt ggt ggt agc aca tac tac gca gac tcc gtg agg ggc chain CDR2 249 AT14-013 Heavy gcg ggt caa aaa aat att ggc tgt ggt tac agc agt tgc ttt atc agt tgg ttc gac acc chain CDR3 250 AT14-014 Heavy acc aca gag gcg ata tat gat agt agt ggt tat ttc cat gac tat chain CDR3 251 AT14-015 Heavy gct agc gat ccc ttc atg act aca gac tat tac tac tac tac atg gac gtc chain CDR3 252 AT14-016 Heavy gcg aaa gga tat gtg ggg tgt agt ggt ggg aac tgc tac tcg ggg ggt gct ttt gat atc chain CDR3 253 AT14-013 Light aag tcc agc cag act att tta caa agg tcc aac cat ttg aac tac tta gct chain CDR1 254 AT14-014 Light aag tcc agc cgg agt gtt tta tac agc tcc aac aat aag aac tac tta gct chain CDR1 255 AT14-015 Light act ggg acc agc agt gac gtt ggt ggt tat aac tct gtc tcc chain CDR1 256 AT14-016 Light ggg ggg aac aac att gga agt gaa agt gtt cac chain CDR1 257 AT14-013 Light tgg gca tct acc cgg gaa tcc chain CDR2 258 AT14-014 Light tgg gca tct atc cgg gaa tcc chain CDR2 259 AT14-015 Light gag gtc tat aag cgg ccc tta chain CDR2 260 AT14-016 Light tat gat acc gac cgg ccc tca chain CDR2 261 AT14-013 Light cac caa tat tat act act ccg cag act chain CDR3 262 AT14-014 Light cag caa tat tct cgt cct ccg acg chain CDR3 263 AT14-015 Light agc tca tat gga ggc acc gtg cta ttc chain CDR3 264 AT14-016 Light cag gtg tgg gat aac act agt gat cat cct gtg gta ttc chain CDR3 265 AT14-013 Heavy cag ggg cga ctg cag gag tcg ggc cca gga ctg gtg aag cct tcg gag acc ctg acc ctc acg tgc gct gtg tcc ggt ggc tcc tcc chain gtc agc agt cct aac tgg tgg act tgg gtc cgc cag gcc ccc ggg aag ggg ctg gag tgg att gga gaa atc tat tat ggt ggg aga gtg agc tac aac tcg gcc ctc agg agt cga gtc acc att tca tca gac agg tcc aaa gag gag ttc tcc ctg aaa ctg agg tct gtg acc gcc gcg gac acg gcc ata tat tat tgt gcg ggt caa aaa aat att ggc tgt ggt tac agc agt tgc ttt atc agt tgg ttc gac acc tgg gga cag gga att gcg gtc acc gtc tcc tca 266 AT14-014 Heavy gag gtg cag ctg gtg gag tct ggg gga ggt ttg gta aag cct ggg ggg tcc ctt aga ctc tcc tgt gca gcc tct gga ttc act ttc chain agt gac gcc tgg atg agc tgg gtc cgc cag gct cca ggg aag ggg ctg gag tgg gtt ggc cat att aac acc aaa gtt gat ggt ggg aca aca gag tac gct gca ccc gtg aaa ggc aga ttc acc atc tca aga gat gat tca aaa aat tcg ctg tat ctg cac atg gac agc ctg aaa acc gag gac aca gcc gtg tat tac tgt acc aca gag gcg ata tat gat agt agt ggt tat ttc cat gac tat tgg ggc cag gga tcc ctg gtc acc gtc tcc tca 267 AT14-015 Heavy gag gtg cag ctg gtg gag tcg ggg gga ggc ttg gca cag cca ggg cgg tcc ctg aga ctc tcc tgt aca gct tct gga ttc agg ttt chain ggt gat ttt gct atg agt tgg gtc cgc cag gct cca ggg aag gga ctg gag tgg gta ggt ttc att aga acc aaa gct aat gat ggg aca aca gaa tac gcc gcg tct gtg aaa ggc aga ttc atc atc tca aga gat gat tcc aaa agt atc gcc tat ctg caa atg aac agc ctg aaa acc gag gac aca gcc gtt tat tac tgt gct agc gat ccc ttc atg act aca gac tat tac tac tac tac atg gac gtc tgg ggc aaa ggg acc acg gtc acc gtc tcc tca 268 AT14-016 Heavy gag gtg caa gtg ttg gag tct ggg gga gac tcg gta cag cct ggg ggg tcc ctg aga ctc tcc tgt gca gcc tct gga ttc acc ttt chain agc agc tat gcc atg acc tgg gtc cgc cag gct cca ggg aag ggg ctg aaa tgg gtc tca agt att agt ggt agt ggt ggt agc aca tac tac gca gac tcc gtg agg ggc cgg ttc acc atc tcc aga gac aat tcc aag aac acg ctg tat gtg cag atg aac agc ctg aga gcc gag gac acg gcc gta tat tac tgt gcg aaa gga tat gtg ggg tgt agt ggt ggg aac tgc tac tcg ggg ggt gct ttt gat atc tgg ggc caa ggg aca gtg gtc acc gtc tct tca 269 AT14-013 Light gac atc gtg atg acc cag tct cca gac tcc ctg gct gtg tct ctg ggc gag agg gcc acc atc gcc tgc aag tcc agc cag act att chain tta caa agg tcc aac cat ttg aac tac tta gct tgg tac cag cag aaa cca gga cag cct cct aaa gtg ctc att tat tgg gca tct acc cgg gaa tcc ggg gtc cct gac cga ttc agt ggc agc ggg tct ggg aca gat ttc act ctc acc atc aac agc ctg cag gct gag gat gtg gca gtt tat tac tgt cac caa tat tat act act ccg cag act ttt ggc cag ggg acc aag gtg gag atc aaa 270 AT14-014 Light gac atc gtg atg acc cag tct cca gac tcc ctg gct gtg tct ctg ggc gag agg gcc acc atc aac tgc aag tcc agc cgg agt gtt chain tta tac agc tcc aac aat aag aac tac tta gct tgg tac cag cag aaa cca gga cag cct cct aag ctg ctc att tac tgg gca tct atc cgg gaa tcc ggg gtc cct gac cga ttc agt ggc agc ggg tct ggg aca gat ttc act ctc acc atc aac agc ctg cag gct gaa gat gtg gca gtt tat tac tgt cag caa tat tct cgt cct ccg acg ttc ggc caa ggg acc aag gtg gaa atc aaa 271 AT14-015 Light cag tct gcc ctg act cag cct ccc tcc gcg tcc ggg tct cct gga cag tca gtc acc atc tcc tgc act ggg acc agc agt gac gtt ggt chain ggt tat aac tct gtc tcc tgg tac caa cat cac cca ggc aaa gcc ccc aaa ctc atg att tat gag gtc tat aag cgg ccc tta ggg gtc cct gat cgc ttc tct ggc tcc aag tct ggc aac acg gcc tcc ctg acc gtc tct ggg ctc cag gct gag gat gag gct tat tat tac tgc agc tca tat gga ggc acc gtg cta ttc ggc gga ggg acc aag ctg acc gtc cta 272 AT14-016 Light tcc tat gtg ctg act cag cca ccc tca gtg tca gtg gcc cca gga aag acg gcc cgg att acc tgt ggg ggg aac aac att gga agt chain gaa agt gtt cac tgg tac cag cag aag cca ggc cag gcc cct gtg gtg gtc atc tat tat gat acc gac cgg ccc tca ggg atc cct gag cgc ttc tct ggc tcc aac tct ggg aac acg gcc acc ctg acc atc agc agg gtc gaa gcc ggg gat gag gcc gac tat tac tgt cag gtg tgg gat aac act agt gat cat cct gtg gta ttc ggc gga ggg acc aag ctg acc gtc cta
(95) TABLE-US-00003 TABLE 2 mAb are specific for AML mAbs Cell lines Prim cells Name Ig class Mel.sup.1 Mel.sup.2 Mel.sup.3 BJ FB Col.sup.1 Col.sup.2 Col.sup.3 Vero HUVEC HepG2 PBMC BM AT12-019 IgG1 κ − − − − − − − − − − − − − AT13-023 IgG1 κ − − − − − − − − − − − − − AT13-031 IgG1 κ − − − − − − AT12-020 IgG3 κ − − − − − − − − − − − − − AT12-023 IgG3 λ − − − − − − − − − − − − − AT12-025 IgG3 κ − − − − − − − − − − − − − AT13-022 IgG3 λ − − − − − − − − − − − − − AT13-024 IgG3 κ − − − − − − − − − − − − − Mel.sup.1: Mel 126.2; Mel.sup.2: Mel BLM; Mel.sup.3: Mel WBO; BJ: Fibroblast cell line; FB: primary fibroblasts (skin); Col.sup.1: Colo205; Col.sup.2: Caco-2; Col.sup.3 HT29; Vero: non-human kidney: PBMC: peripheral blood mononuclear cells; BM: bone marrow.
(96) TABLE-US-00004 TABLE 3 Overview AML-specific mAbs derived from a patient with a potent GvL response (donor 59) mAbs AML Primary AML* Name Ig class CD27 SHM V.sub.H/V.sub.L THP-1 MM6 M0 M1 M1 M1 M4 AT12-019 IgG1 κ + 10/9 ++ + + + ++ +/− − AT13-023 IgG1 κ + 8/4 ++ ++ + AT13-031 IgG1 κ + 1/1 ++ + − + − − +/− AT12-020 IgG3 κ + 4/2 ++ AT12-023 IgG3 λ − Germline/6 +++ ++ + ++ ++ +/− ++ AT12-025 IgG3 κ − 1/1 ++ ++ − +/− + − − AT13-022 IgG3 λ + Germline ++ ++ ++ AT13-024 IgG3 κ − 6/3 ++ ++ ++ ++ ++ MM6: MonoMac6; M0: donor 77; M1 donor 69, 79, 86 respectively; M4 donor 78 *AML according to the FAB classification; SHM: number of somatic hypermutations
(97) TABLE-US-00005 TABLE 4 Some mAb bind other hematologic tumors mAbs Other hematologic tumor cell lines Primary tumors Name Ig class OCI-Ly1 OCI-Ly7 U266 NCI-H929 NHL pt ALL pt AT12-019 IgG1 κ + − − − − − AT13-023 IgG1 κ AT13-031 IgG1 κ ++ + − +/− ++ − AT12-020 IgG3 κ AT12-023 IgG3 λ − − +/− − ++ − AT12-025 IgG3 κ − − + − − − AT13-022 IgG3 λ AT13-024 IgG3 κ ++ + − − − − OCI-Ly1 and OCI-Ly7: diffuse large B cell lymphoma cell lines; U266 and NCI-H929: multiple myeloma cell lines; NHL pt: B-non Hodgkin lymphoma cells freshly isolated from a newly diagnosed patient; ALL pt: B-acute lymphatic leukemia cells freshly isolated from a newly diagnosed patient.
(98) TABLE-US-00006 TABLE 5 Some mAb show in vitro activity mAbs Killing Name Ig class CD27 SHM V.sub.H/V.sub.L THP-1 M0/5 AT12-019 IgG1 κ + 10/9 no no AT13-023 IgG1 κ + 8/4 AT13-031 IgG1 κ + 1/1 AT12-020 IgG3 κ + 4/2 AT12-023 IgG3 λ − Germline/6 yes AT12-025 IgG3 κ − 1/1 yes yes AT13-022 IgG3 λ + Germline AT13-024 IgG3 κ − 6/3 no yes AT13-023, AT13-031, AT12-020 and AT13-022 were not yet tested for in vitro activity
(99) TABLE-US-00007 TABLE 6 2nd AML patient with GvL response (donor 58) mAbs AML Not binding to Clone CD27 Ig class SHM V.sub.H/V.sub.L THP-1 MM6 PBMC Caco HT-29 HepG2 AT13-033 + IgG3 λ 18/5 ++ ++ − − − − AT13-034 + IgG3 κ 14/6 ++ ++ − − − − AT13-035 − IgG3 λ 0/0 ++ ++ − − − − AT13-036 − IgG3 λ 4/9 ++ ++ − − − − AT13-037 + IgG3 κ 4/8 ++ ++ − − − − SHM: number of somatic hypermutations
(100) TABLE-US-00008 TABLE 7 Overview of AML-specific mAbs derived from a 3.sup.rd patient with a potent GvL response (donor 101) mAbs AML Primary AML* Name Ig class CD27 SHM V.sub.H/V.sub.L THP-1 Molm13 M0 M4 M5.sup.1 M5.sup.2 AT14-013 IgG1 κ + 26/11 +++ +++ +++ ++ +/− + AT14-014 IgG3 κ + 9/6 ++ ++ − − − − AT14-015 IgG3 λ + 9/9 ++ − − + − − AT14-016 IgG3 λ + 9/5 ++ ++ − + − − M1: donor 77; M4: donor BL-046; M5.sup.1: donor BL-034, M5.sup.2: donor BL-038 *AML according to the FAB classification; SHM: number of somatic hypermutations
(101) TABLE-US-00009 TABLE 8 mAb are specific for AML (donor 101) mAbs Cell lines PBMCs Primary cells Name Ig class FB Col Liv.sup.1 Liv.sup.2 CD3 CD14 CD19 CD56 Fetal liver cells AT14-013 IgG1 κ +/− − +/− − − − − − − AT14-014 IgG3 κ − − − − − − − − − AT14-015 IgG3 λ − − − − − − − − − AT14-016 IgG3 λ − − − − − − − − − FB: primary fibroblasts (skin); Col: Caco-2; Liv.sup.1: Huh7 liver cell line; Liv.sup.2: HepG2 liver cell line PBMC: peripheral blood mononuclear cells;
(102) TABLE-US-00010 TABLE 9A Overview of AML-specific mAbs derived from a 2.sup.nd patient with a potent GvL response (donor 58) mAbs SHM AML Primary AML* Clone CD27 Ig class V.sub.H/V.sub.L THP-1 MM6 M0 M0 M1 M4 AT13-033 + IgG3 λ 18/5 ++ ++ − − − − AT13-034 + IgG3 κ 14/6 ++ ++ +/− − − − AT13-035 − IgG3 λ 0/0 ++ ++ − − − − AT13-036 − IgG3 λ 4/9 ++ ++ − − − − AT13-037 + IgG3 κ 4/8 ++ ++ − − − − MM6: MonoMac6; M0: donor 77, BL-030; M1 donor 69, respectively; M4 donor 78 *AML according to the FAB classification; SHM: number of somatic hypermutations
(103) TABLE-US-00011 TABLE 9B Some mAb show in vitro activity (donor 59) mAbs Killing Name Ig class CD27 SHM V.sub.H/V.sub.L THP-1 M1 AT12-019 IgG1 κ + 10/9 no no AT13-023 IgG1 κ + 8/4 no nd AT13-031 IgG1 κ + 1/1 yes* nd AT12-020 IgG3 κ + 4/2 nd nd AT12-023 IgG3 λ − Germline/6 yes nd AT12-025 IgG3 κ − 1/1 yes yes AT13-022 IgG3 λ + Germline no nd AT13-024 IgG3 κ − 6/3 no yes *Only at 37 C.; nd = not determined
(104) TABLE-US-00012 TABLE 10 Some mAb show in vitro activity (donor 58) mAbs Killing Clone CD27 Ig class SHM V.sub.H/V.sub.L THP-1 AT13-033 + IgG3 λ 18/5 yes AT13-034 + IgG3 κ 14/6 no AT13-035 − IgG3 λ 0/0 yes AT13-036 − IgG3 λ 4/9 yes AT13-037 + IgG3 κ 4/8 yes
REFERENCES
(105) Bakker A B, van den Oudenrijn S, Bakker A Q, Feller N, van Meijer M, Bia J A, Jongeneelen M A, Visser T J, Bijl N, Ceuijen C A, Marissen W E, Radosevic K, Throsby M, Schuurhuis G J, Ossenkoppele G J, de Kruif J, Goudsmit J, Kruisbeek A M. 2004. C-type lectin-like molecule-1: a novel myeloid cell surface marker associated with acute myeloid leukemia. Cancer Res 64:8443-50. Bennett J M, Catovsky D, Daniel M T, Flandrin G, Galton D A, Gralnick H R, Sultan C. 1976. Proposals for the classification of the acute leukaemias. French-American-British (FAB) co-operative group. Br J Haematol 33:451-458. Bhat N M, Bieber M M, Hsu F J, Chapman C J, Spellerberg M, Stevenson F K, Teng N N H. 1997. Rapid cytotoxicity of human B lymphocytes induced by VH4-34 (VH4.21) gene-encoded monoclonal antibodies. Clin Exp Immunol 108: 151-159 Biernacki M A, Marina O, Zhang W, Liu F, Bruns I, Cai A, Neuberg D, Canning C M, Alyea E P, Soiffer R J, Brusic V, Ritz J, Wu C J. 2010. Efficacious immune therapy in chronic myelogenous leukemia (CML) recognizes antigens that are expressed on CML progenitor cells. Cancer Research 70:906-915. Chen Y, Wiesmann C, Fuh G, Li B, Christinger H W, McKay P, de Vos A M, Lowman H B. 1999. Selection and analysis of an optimized anti-VEGF antibody: crystal structure of an affinity-matured Fab in complex with antigen. J Mol Biol 293:865-881. Diehl S A, Schmidlin H, Nagasawa M, van Haren S D, Kwakkenbos M J, Yasuda E, Beaumont T, Scheeren F A, Spits H. 2008. STAT3-mediated up-regulation of BLIMP1 Is coordinated with BCL6 down-regulation to control human plasma cell differentiation. J Immunol 180:4805-4815. Drexler H G, Minowada J. 1998. History and classification of human leukemia-lymphoma cell lines. Leuk Lymphoma 31:305-316. Hernandez A M, Rodriguez N, Gonzalez J E, et al. Anti-NeuGcGM3 Antibodies, Actively Elicited by Idiotypic Vaccination in Nonsmall Cell Lung Cancer Patients, Induce Tumor Cell Death by an Oncosis-Like Mechanism. J Immunol 2011; 186(6):3735-3744. Hugh J. M et al, 2004 Methods in Molecular biology Vol. 282 Kattah N H, Kattah M G, Utz P J. The U1-snRNP complex: structural properties relating to autoimmune pathogenesis in rheumatic diseases. Immunol Reviews. 2010; 233(1):126-145. Kepp O, Galluzzi L, Lipinski M, Yuan J, Kroemer G. Cell death assays for drug discovery. Nat Rev Drug Discov 2011; 1-17. Kwakkenbos M J, Diehl S A, Yasuda E, Bakker A Q, Van Geelen C M M, Lukens M V, Van Bleek G M, Widjojoatmodjo M N, Bogers W M J M, Mei H, Radbruch A, Scheeren F A, Spits H, Beaumont T. 2010. Generation of stable monoclonal antibody-producing B cell receptor-positive human memory B cells by genetic programming. Nat Med 16:123-128. Majeti R, Chao M P, Alizadeh A A, Pang W W, Jaiswal S, Gibbs K D, Van Rooijen N, Weissman I L. 2009. CD47 is an adverse prognostic factor and therapeutic antibody target on human acute myeloid leukemia stem cells. Cell 138:286-299 Schlenk R F, Dohner K, Krauter J, Frohling S, Corbacioglu A, Bullinger L, Habdank M, Spath D, Morgan M, Benner A, Schlegelberger B, Heil G, Ganser A, Dohner H, German-Austrian Acute Myeloid Leukemia Study Group. 2008. Mutations and treatment outcome in cytogenetically normal acute myeloid leukemia. N Engl J Med 358:1909-1918. Schmid C, Labopin M, Nagler A, Bornhauser M, Finke J, Fassas A, Volin L, Ghrman G, Maertens J, Bordigoni P, Holler E, Ehninger G, Polge E, Gorin N-C, Kolb H-J, Rocha V, EBMT Acute Leukemia Working Party. Donor lymphocyte infusion in the treatment of first hematological relapse after allogeneic stem-cell transplantation in adults with acute myeloid leukemia: a retrospective risk factors analysis and comparison with other strategies by the EBMT Acute Leukemia Working Party. Journal of Clinical Oncology 25:4938-4945. Schmiedel B J, Werner A, Steinbacher J, et al. Generation and Preclinical Characterization of a Fc-optimized GITR-Ig Fusion Protein for Induction of NK Cell Reactivity Against Leukemia. Mol Ther. 2013; 21(4):877-886. Singh R, Cadeddu R-P, Fröbel J, et al. The non-steroidal anti-inflammatory drugs Sulindac sulfide and Diclofenac induce apoptosis and differentiation in human acute myeloid leukemia cells through an AP-1 dependent pathway. Apoptosis. 2011; 16(9):889-901. Tsuchiya S, Yamabe M, Yamaguchi Y, Kobayashi Y, Konno K, Tada K. 1988. Establishment and characterization of a human acute monocytic leukemia cell line (THP-1). Int J Cancer 26:171-176. Walter R B, Appelbaum F R, Estey E H, Bernstein I D. Acute myeloid leukemia stem cells and CD33-targeted immunotherapy. 2012. Blood 119: 6198-208. Willingham S B, Volkmer J P, Gentles A J, Sahoo D, Dalerba P, Mitra S S, Wang J, Contreras-Trujillo H, Martin R, Cohen J D, Lovelace P, Scheeren F A, Chao M P, Weiskopf K, Tang C, Volkmer A K, Naik T J, Storm T A, Mosley A R, Edris B, Schmid S M, Sun C K, Chua M S, Murillo O, Rajendran P, Cha A C, Chin R K, Kim D, Adorno M, Raveh T, Tseng D, Jaiswal S, Enger P O, Steinberg G K, Li G, So S K, Majeti R, Harsh G R, van de Rijn M, Teng N N, Sunwoo J B, Alizadeh A A, Clarke M F, Weissman I L. 2012. The CD47-signal regulatory protein alpha (SIRPa) interaction is a therapeutic target for human solid tumors. Proc Natl Acad Sci USA 109:6662-7. Wu C J, Yang X F, McLaughlin S, Neuberg D, Canning C, Stein B, Alyea E P, Soiffer R J, Dranoff G, Ritz J. 2000. Detection of a potent humoral response associated with immune-induced remission of chronic myelogenous leukemia. J Clin Invest 106:705-714.